F378159

General Info

Members Datasets Scaffolds Average Seq Length
272 165 544 228

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100007262|Ga0070671_1000072623
Length 255
Sequence MSPAGAASETTRSLMEPIPAASAALSPMIRARGLTRAYDTAAGRAFVLRGIDLDVAEGEFVTIMGPSGAGKSTLLGIVGMLDAGWTGEYHFLGHPVHALRAKERAALNRNHIGFVFQSYHLLDDLTVAENLDLPLSYKKIRASERASLVADTLDRFRIVAKKNLYPSQLSGGQQQLVAVARALITKPQLVLADEPTGNLHSDQGREVMELLGRLNREGTTIVQVTHSLENARYGSRVIDLKDGWIVGGDAPRDRP

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 0
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 2.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100007262 3300005355 Bacteria 8855
2 rootH2_10017869 3300003320 Bacteria 47664
3 Ga0065715_10192203 3300005293 Unclassified 1408
4 Ga0065707_10488871 3300005295 Bacteria 767
5 Ga0070690_100044562 3300005330 Bacteria 2816
6 Ga0070680_100205469 3300005336 Bacteria 1661
7 Ga0070689_100471825 3300005340 Bacteria 1071
8 Ga0070689_100561519 3300005340 Bacteria 984
9 Ga0070689_100574135 3300005340 Bacteria 974
10 Ga0070689_100693497 3300005340 Unclassified 889
11 Ga0070689_100736414 3300005340 Bacteria 863
12 Ga0070661_100027625 3300005344 Bacteria 4088
13 Ga0070675_100010715 3300005354 Bacteria 7170
14 Ga0070671_100256065 3300005355 Bacteria 1487
15 Ga0070673_100110291 3300005364 Bacteria 2281
16 Ga0070673_100228687 3300005364 Bacteria 1613
17 Ga0070688_100410684 3300005365 Bacteria 1004
18 Ga0070667_100333842 3300005367 Bacteria 1370
19 Ga0070703_10000270 3300005406 Bacteria 24643
20 Ga0070709_10000037 3300005434 Bacteria 109706
21 Ga0070713_100020972 3300005436 Bacteria 5017
22 Ga0070713_100302273 3300005436 Bacteria 1473
23 Ga0070705_100000003 3300005440 Bacteria 134946
24 Ga0070705_100146000 3300005440 Bacteria 1563
25 Ga0070694_100002311 3300005444 Bacteria 11268
26 Ga0070694_100565405 3300005444 Bacteria 912
27 Ga0070708_100086298 3300005445 Bacteria 2850
28 Ga0070708_100280035 3300005445 Bacteria 1570
29 Ga0070708_100310605 3300005445 Bacteria 1485
30 Ga0070708_100370771 3300005445 Bacteria 1350
31 Ga0070678_100211249 3300005456 Bacteria 1608
32 Ga0070662_100091027 3300005457 Bacteria 2290
33 Ga0070662_100484384 3300005457 Bacteria 1030
34 Ga0070706_100000115 3300005467 Bacteria 97916
35 Ga0070706_100003116 3300005467 Bacteria 16417
36 Ga0070706_100004399 3300005467 Bacteria 13611
37 Ga0070706_100117877 3300005467 Bacteria 2473
38 Ga0070706_100117888 3300005467 Bacteria 2473
39 Ga0070707_100044641 3300005468 Bacteria 4243
40 Ga0070707_100614374 3300005468 Bacteria 1049
41 Ga0070707_100672834 3300005468 Bacteria 998
42 Ga0070698_100002301 3300005471 Bacteria 21148
43 Ga0070698_100110158 3300005471 Bacteria 2719
44 Ga0070699_100001688 3300005518 Bacteria 20089
45 Ga0070699_100042511 3300005518 Bacteria 3933
46 Ga0070699_100257001 3300005518 Bacteria 1562
47 Ga0070697_100014643 3300005536 Bacteria 6157
48 Ga0070697_100265608 3300005536 Bacteria 1470
49 Ga0070697_100736171 3300005536 Bacteria 871
50 Ga0070686_100036499 3300005544 Bacteria 3043
51 Ga0070686_100144871 3300005544 Bacteria 1658
52 Ga0070695_100009343 3300005545 Bacteria 5832
53 Ga0070695_100096758 3300005545 Bacteria 1981
54 Ga0070695_100191048 3300005545 Bacteria 1457
55 Ga0070696_100000005 3300005546 Bacteria 118096
56 Ga0070696_100068316 3300005546 Bacteria 2495
57 Ga0070693_100159834 3300005547 Bacteria 1434
58 Ga0070704_100017986 3300005549 Bacteria 4508
59 Ga0070704_100038878 3300005549 Bacteria 3263
60 Ga0070664_100012097 3300005564 Bacteria 7012
61 Ga0068857_100613997 3300005577 Bacteria 1029
62 Ga0068859_100268424 3300005617 Bacteria 1798
63 Ga0068859_100357634 3300005617 Bacteria 1555
64 Ga0068859_100551596 3300005617 Bacteria 1247
65 Ga0068864_100498860 3300005618 Bacteria 1171
66 Ga0068870_10471451 3300005840 Bacteria 831
67 Ga0068863_100156789 3300005841 Bacteria 2180
68 Ga0068858_100302482 3300005842 Bacteria 1526
69 Ga0068860_100620446 3300005843 Bacteria 1088
70 Ga0068862_100021770 3300005844 Bacteria 5360
71 Ga0068862_100310803 3300005844 Bacteria 1452
72 Ga0068862_100371188 3300005844 Bacteria 1332
73 Ga0070716_100303254 3300006173 Bacteria 1112
74 Ga0070712_100194083 3300006175 Bacteria 1591
75 Ga0068871_100946268 3300006358 Bacteria 800
76 Ga0075428_100841217 3300006844 Bacteria 974
77 Ga0075430_100010393 3300006846 Bacteria 7883
78 Ga0075431_100211825 3300006847 Bacteria 1979
79 Ga0075433_10002514 3300006852 Bacteria 13952
80 Ga0075433_10228683 3300006852 Archaea 1652
81 Ga0075433_10274452 3300006852 Bacteria 1494
82 Ga0075433_10548618 3300006852 Bacteria 1016
83 Ga0075434_100000901 3300006871 Bacteria 23803
84 Ga0075434_100174855 3300006871 Bacteria 2167
85 Ga0075434_100192011 3300006871 Bacteria 2063
86 Ga0075434_100367994 3300006871 Bacteria 1458
87 Ga0075429_100419657 3300006880 Bacteria 1172
88 Ga0075436_100316387 3300006914 Archaea 1121
89 Ga0097620_100268418 3300006931 Bacteria 1798
90 Ga0097620_100357633 3300006931 Bacteria 1555
91 Ga0097620_100488932 3300006931 Unclassified 1326
92 Ga0097620_100551567 3300006931 Bacteria 1247
93 Ga0075435_100001186 3300007076 Bacteria 16676
94 Ga0075435_100360303 3300007076 Bacteria 1247
95 Ga0111539_10006825 3300009094 Bacteria 14680
96 Ga0111539_10010753 3300009094 Bacteria 11519
97 Ga0111539_10164837 3300009094 Bacteria 2591
98 Ga0111539_10297433 3300009094 Bacteria 1878
99 Ga0111539_10397274 3300009094 Bacteria 1606
100 Ga0111539_10863110 3300009094 Bacteria 1053
101 Ga0114129_10062099 3300009147 Bacteria 5220
102 Ga0114129_10125434 3300009147 Bacteria 3530
103 Ga0114129_10308890 3300009147 Bacteria 2105
104 Ga0114129_10625234 3300009147 Bacteria 1392
105 Ga0114129_11455472 3300009147 Bacteria 843
106 Ga0105241_10342578 3300009174 Bacteria 1295
107 Ga0105242_10004307 3300009176 Bacteria 11092
108 Ga0105242_10090286 3300009176 Unclassified 2577
109 Ga0105248_10085852 3300009177 Bacteria 3541
110 Ga0105249_10163697 3300009553 Bacteria 2152
111 Ga0105249_10430790 3300009553 Bacteria 1354
112 Ga0099796_10007983 3300010159 Bacteria 2797
113 Ga0157378_10832471 3300013297 Bacteria 950
114 Ga0163162_10845797 3300013306 Bacteria 1030
115 Ga0163163_10135476 3300014325 Bacteria 2504
116 Ga0163163_10163715 3300014325 Unclassified 2270
117 Ga0157379_10913261 3300014968 Bacteria 833
118 Ga0207653_10000287 3300025885 Bacteria 29380
119 Ga0207688_10313242 3300025901 Bacteria 961
120 Ga0207699_10000048 3300025906 Bacteria 109686
121 Ga0207684_10000247 3300025910 Bacteria 81321
122 Ga0207684_10001565 3300025910 Bacteria 24452
123 Ga0207684_10068585 3300025910 Bacteria 3014
124 Ga0207684_10149597 3300025910 Bacteria 2009
125 Ga0207693_10280413 3300025915 Bacteria 1306
126 Ga0207660_10272253 3300025917 Bacteria 1342
127 Ga0207646_10431916 3300025922 Bacteria 1188
128 Ga0207681_10219241 3300025923 Bacteria 1471
129 Ga0207650_10045416 3300025925 Bacteria 3232
130 Ga0207659_10078448 3300025926 Bacteria 2433
131 Ga0207700_10008975 3300025928 Bacteria 6223
132 Ga0207700_10233733 3300025928 Bacteria 1564
133 Ga0207644_10006101 3300025931 Bacteria 7857
134 Ga0207644_10253850 3300025931 Bacteria 1404
135 Ga0207706_10019370 3300025933 Bacteria 6121
136 Ga0207706_10198362 3300025933 Bacteria 1760
137 Ga0207686_10025000 3300025934 Bacteria 3468
138 Ga0207670_10061455 3300025936 Bacteria 2564
139 Ga0207670_10190674 3300025936 Bacteria 1551
140 Ga0207670_10240895 3300025936 Bacteria 1393
141 Ga0207670_10474740 3300025936 Bacteria 1012
142 Ga0207704_10642529 3300025938 Bacteria 873
143 Ga0207665_10086916 3300025939 Bacteria 2161
144 Ga0207691_10237575 3300025940 Bacteria 1576
145 Ga0207711_10499207 3300025941 Bacteria 1134
146 Ga0207711_10575735 3300025941 Bacteria 1050
147 Ga0207661_10031435 3300025944 Bacteria 4101
148 Ga0207679_10032804 3300025945 Bacteria 3650
149 Ga0207651_10078768 3300025960 Bacteria 2365
150 Ga0207651_10320977 3300025960 Bacteria 1294
151 Ga0207658_10860141 3300025986 Bacteria 825
152 Ga0207703_10232354 3300026035 Bacteria 1654
153 Ga0207703_10773119 3300026035 Bacteria 916
154 Ga0207641_10742546 3300026088 Bacteria 968
155 Ga0207675_100754141 3300026118 Bacteria 985
156 Ga0207428_10104683 3300027907 Bacteria 2183
157 Ga0268265_10171698 3300028380 Bacteria 1854
158 Ga0268265_10302520 3300028380 Bacteria 1441
159 Ga0268265_10423039 3300028380 Bacteria 1237
160 Ga0268264_10159568 3300028381 Bacteria 2030
161 Ga0265337_1002884 3300028556 Bacteria 7668
162 Ga0265319_1000472 3300028563 Bacteria 28452
163 Ga0265334_10002074 3300028573 Bacteria 9477
164 Ga0265318_10001737 3300028577 Bacteria 12462
165 Ga0265322_10002273 3300028654 Bacteria 5950
166 Ga0265336_10000072 3300028666 Bacteria 84279
167 Ga0265338_10003300 3300028800 Bacteria 22881
168 Ga0265338_10064046 3300028800 Bacteria 3201
169 Ga0265324_10000867 3300029957 Bacteria 19424
170 Ga0265324_10009526 3300029957 Bacteria 3786
171 Ga0265332_10160408 3300031238 Bacteria 940
172 Ga0265325_10005831 3300031241 Bacteria 7545
173 Ga0265340_10009514 3300031247 Bacteria 5211
174 Ga0265327_10000016 3300031251 Bacteria 467439
175 Ga0265316_10004552 3300031344 Bacteria 13774
176 Ga0265316_10331672 3300031344 Bacteria 1104
177 Ga0307408_100054907 3300031548 Bacteria 2882
178 Ga0265313_10000454 3300031595 Bacteria 43333
179 Ga0265313_10006799 3300031595 Bacteria 7989
180 Ga0265313_10017519 3300031595 Bacteria 4067
181 Ga0265314_10088231 3300031711 Bacteria 2026
182 Ga0265314_10139451 3300031711 Bacteria 1501
183 Ga0265342_10062666 3300031712 Bacteria 2188
184 Ga0265342_10180867 3300031712 Bacteria 1155
185 Ga0316578_10057013 3300031728 Bacteria 2295
186 Ga0307416_100211552 3300032002 Bacteria 1850
187 Ga0316583_10008820 3300032133 Bacteria 3638
188 Ga0373946_0048520 3300035171 Bacteria 1768
189 Ga0316574_0072587 3300035398 Bacteria 2175
190 Ga0373924_0193474 3300035410 Bacteria 896
191 Ga0373933_0026906 3300035724 Bacteria 3308
192 Ga0373947_0045977 3300035725 Bacteria 2613
193 Ga0373925_0021663 3300037068 Bacteria 4684
194 Ga0373925_0023387 3300037068 Bacteria 4509
195 Ga0439433_0039825 3300041999 Bacteria 1092
196 Ga0451577_0000024 3300042876 Bacteria 411758
197 Ga0451577_0004230 3300042876 Bacteria 15295
198 Ga0451577_0384683 3300042876 Bacteria 1273
199 Ga0451577_0404311 3300042876 Bacteria 1239
200 Ga0466969_0003890 3300044656 Bacteria 7926
201 Ga0453683_0196273 3300044673 Unclassified 1281
202 Ga0453684_0000001 3300044712 Bacteria 2623166
203 Ga0453684_0000893 3300044712 Bacteria 99593
204 Ga0453684_0006045 3300044712 Bacteria 23398
205 Ga0453684_0015881 3300044712 Bacteria 11839
206 Ga0453684_0739534 3300044712 Bacteria 1066
207 Ga0451576_0003273 3300045051 Bacteria 22484
208 Ga0451576_0005289 3300045051 Bacteria 16229
209 Ga0451576_0073141 3300045051 Bacteria 3567
210 Ga0451576_0141637 3300045051 Bacteria 2507
211 Ga0451576_0163100 3300045051 Bacteria 2326
212 Ga0451576_0218455 3300045051 Bacteria 1990
213 Ga0451576_1210832 3300045051 Bacteria 788
214 Ga0495592_0000437 3300046454 Bacteria 31326
215 Ga0495629_0000001 3300046459 Bacteria 807972
216 Ga0495629_0102673 3300046459 Bacteria 1995
217 Ga0495580_0001783 3300046472 Bacteria 18938
218 Ga0495639_0000200 3300046475 Bacteria 31147
219 Ga0495662_0011128 3300046476 Bacteria 4396
220 Ga0495594_0064138 3300046499 Bacteria 2036
221 Ga0495594_0121501 3300046499 Bacteria 1477
222 Ga0495618_0006363 3300046514 Bacteria 7171
223 Ga0495630_0004143 3300046517 Bacteria 10154
224 Ga0495666_0000321 3300046526 Bacteria 20895
225 Ga0495666_0012536 3300046526 Bacteria 4226
226 Ga0495652_0010461 3300046529 Bacteria 8407
227 Ga0495640_0035426 3300046533 Bacteria 3532
228 Ga0495586_0000718 3300046535 Bacteria 18904
229 Ga0495586_0004260 3300046535 Bacteria 7650
230 Ga0495657_0041888 3300046675 Bacteria 3130
231 Ga0495599_0077327 3300046678 Bacteria 2077
232 Ga0495599_0182275 3300046678 Bacteria 1294
233 Ga0495623_0054953 3300046679 Bacteria 2511
234 Ga0495647_0009174 3300046681 Bacteria 3343
235 Ga0495647_0016403 3300046681 Bacteria 2607
236 Ga0495658_0002345 3300046683 Bacteria 9565
237 Ga0495613_0216397 3300046689 Bacteria 1346
238 Ga0495624_0048036 3300046690 Bacteria 2710
239 Ga0495581_0005828 3300047315 Bacteria 7143
240 Ga0495674_0011009 3300047319 Bacteria 8542
241 Ga0495676_0000685 3300047321 Bacteria 28220
242 Ga0495602_0125808 3300048088 Bacteria 2054
243 Ga0501032_0000093 3300049569 Bacteria 76932
244 Ga0501046_0045554 3300049580 Bacteria 3484
245 Ga0501047_0023170 3300049581 Bacteria 5961
246 Ga0501067_0140523 3300049583 Bacteria 1345
247 Ga0501076_0234600 3300049592 Bacteria 1500
248 Ga0501035_0001443 3300049822 Bacteria 24362
249 Ga0501035_0004485 3300049822 Bacteria 13252
250 Ga0501044_0000050 3300049823 Bacteria 143754
251 Ga0501045_0395460 3300049824 Bacteria 1029
252 nmdc:mga05p37_1273_c1 3300050507 Bacteria 29269
253 nmdc:mga05p37_404451_c1 3300050507 Bacteria 1593
254 nmdc:mga05p37_444082_c1 3300050507 Bacteria 1503
255 nmdc:mga09592_375886_c1 3300050508 Bacteria 1229
256 nmdc:mga0qj67_7818_c1 3300050509 Bacteria 7904
257 nmdc:mga06r32_215865_c1 3300050510 Bacteria 1906
258 nmdc:mga08y16_11157_c1 3300050511 Bacteria 9436
259 nmdc:mga08y16_15149_c1 3300050511 Bacteria 8106
260 nmdc:mga08y16_370336_c1 3300050511 Bacteria 1469
261 nmdc:mga0n895_257310_c1 3300050512 Bacteria 1772
262 nmdc:mga0n895_334231_c1 3300050512 Bacteria 1535
263 nmdc:mga0n895_53293_c1 3300050512 Bacteria 3974
264 nmdc:mga0rr50_308123_c1 3300050513 Bacteria 1326
265 nmdc:mga08x19_273460_c1 3300050514 Archaea 1169
266 nmdc:mga0a205_233462_c1 3300050515 Archaea 1722
267 nmdc:mga0a205_279809_c1 3300050515 Bacteria 1544
268 nmdc:mga0a205_294581_c1 3300050515 Unclassified 1496
269 nmdc:mga0a205_432478_c1 3300050515 Bacteria 1177
270 nmdc:mga0a205_90505_c1 3300050515 Bacteria 2957
271 Ga0500566_0091009 3300053094 Bacteria 1686
272 2788436687 2786546940 Bacteria 6396474
273 Ga0070671_100007262
274 rootH2_10017869
275 Ga0065715_10192203
276 Ga0065707_10488871
277 Ga0070690_100044562
278 Ga0070680_100205469
279 Ga0070689_100471825
280 Ga0070689_100561519
281 Ga0070689_100574135
282 Ga0070689_100693497
283 Ga0070689_100736414
284 Ga0070661_100027625
285 Ga0070675_100010715
286 Ga0070671_100256065
287 Ga0070673_100110291
288 Ga0070673_100228687
289 Ga0070688_100410684
290 Ga0070667_100333842
291 Ga0070703_10000270
292 Ga0070709_10000037
293 Ga0070713_100020972
294 Ga0070713_100302273
295 Ga0070705_100000003
296 Ga0070705_100146000
297 Ga0070694_100002311
298 Ga0070694_100565405
299 Ga0070708_100086298
300 Ga0070708_100280035
301 Ga0070708_100310605
302 Ga0070708_100370771
303 Ga0070678_100211249
304 Ga0070662_100091027
305 Ga0070662_100484384
306 Ga0070706_100000115
307 Ga0070706_100003116
308 Ga0070706_100004399
309 Ga0070706_100117877
310 Ga0070706_100117888
311 Ga0070707_100044641
312 Ga0070707_100614374
313 Ga0070707_100672834
314 Ga0070698_100002301
315 Ga0070698_100110158
316 Ga0070699_100001688
317 Ga0070699_100042511
318 Ga0070699_100257001
319 Ga0070697_100014643
320 Ga0070697_100265608
321 Ga0070697_100736171
322 Ga0070686_100036499
323 Ga0070686_100144871
324 Ga0070695_100009343
325 Ga0070695_100096758
326 Ga0070695_100191048
327 Ga0070696_100000005
328 Ga0070696_100068316
329 Ga0070693_100159834
330 Ga0070704_100017986
331 Ga0070704_100038878
332 Ga0070664_100012097
333 Ga0068857_100613997
334 Ga0068859_100268424
335 Ga0068859_100357634
336 Ga0068859_100551596
337 Ga0068864_100498860
338 Ga0068870_10471451
339 Ga0068863_100156789
340 Ga0068858_100302482
341 Ga0068860_100620446
342 Ga0068862_100021770
343 Ga0068862_100310803
344 Ga0068862_100371188
345 Ga0070716_100303254
346 Ga0070712_100194083
347 Ga0068871_100946268
348 Ga0075428_100841217
349 Ga0075430_100010393
350 Ga0075431_100211825
351 Ga0075433_10002514
352 Ga0075433_10228683
353 Ga0075433_10274452
354 Ga0075433_10548618
355 Ga0075434_100000901
356 Ga0075434_100174855
357 Ga0075434_100192011
358 Ga0075434_100367994
359 Ga0075429_100419657
360 Ga0075436_100316387
361 Ga0097620_100268418
362 Ga0097620_100357633
363 Ga0097620_100488932
364 Ga0097620_100551567
365 Ga0075435_100001186
366 Ga0075435_100360303
367 Ga0111539_10006825
368 Ga0111539_10010753
369 Ga0111539_10164837
370 Ga0111539_10297433
371 Ga0111539_10397274
372 Ga0111539_10863110
373 Ga0114129_10062099
374 Ga0114129_10125434
375 Ga0114129_10308890
376 Ga0114129_10625234
377 Ga0114129_11455472
378 Ga0105241_10342578
379 Ga0105242_10004307
380 Ga0105242_10090286
381 Ga0105248_10085852
382 Ga0105249_10163697
383 Ga0105249_10430790
384 Ga0099796_10007983
385 Ga0157378_10832471
386 Ga0163162_10845797
387 Ga0163163_10135476
388 Ga0163163_10163715
389 Ga0157379_10913261
390 Ga0207653_10000287
391 Ga0207688_10313242
392 Ga0207699_10000048
393 Ga0207684_10000247
394 Ga0207684_10001565
395 Ga0207684_10068585
396 Ga0207684_10149597
397 Ga0207693_10280413
398 Ga0207660_10272253
399 Ga0207646_10431916
400 Ga0207681_10219241
401 Ga0207650_10045416
402 Ga0207659_10078448
403 Ga0207700_10008975
404 Ga0207700_10233733
405 Ga0207644_10006101
406 Ga0207644_10253850
407 Ga0207706_10019370
408 Ga0207706_10198362
409 Ga0207686_10025000
410 Ga0207670_10061455
411 Ga0207670_10190674
412 Ga0207670_10240895
413 Ga0207670_10474740
414 Ga0207704_10642529
415 Ga0207665_10086916
416 Ga0207691_10237575
417 Ga0207711_10499207
418 Ga0207711_10575735
419 Ga0207661_10031435
420 Ga0207679_10032804
421 Ga0207651_10078768
422 Ga0207651_10320977
423 Ga0207658_10860141
424 Ga0207703_10232354
425 Ga0207703_10773119
426 Ga0207641_10742546
427 Ga0207675_100754141
428 Ga0207428_10104683
429 Ga0268265_10171698
430 Ga0268265_10302520
431 Ga0268265_10423039
432 Ga0268264_10159568
433 Ga0265337_1002884
434 Ga0265319_1000472
435 Ga0265334_10002074
436 Ga0265318_10001737
437 Ga0265322_10002273
438 Ga0265336_10000072
439 Ga0265338_10003300
440 Ga0265338_10064046
441 Ga0265324_10000867
442 Ga0265324_10009526
443 Ga0265332_10160408
444 Ga0265325_10005831
445 Ga0265340_10009514
446 Ga0265327_10000016
447 Ga0265316_10004552
448 Ga0265316_10331672
449 Ga0307408_100054907
450 Ga0265313_10000454
451 Ga0265313_10006799
452 Ga0265313_10017519
453 Ga0265314_10088231
454 Ga0265314_10139451
455 Ga0265342_10062666
456 Ga0265342_10180867
457 Ga0316578_10057013
458 Ga0307416_100211552
459 Ga0316583_10008820
460 Ga0373946_0048520
461 Ga0316574_0072587
462 Ga0373924_0193474
463 Ga0373933_0026906
464 Ga0373947_0045977
465 Ga0373925_0021663
466 Ga0373925_0023387
467 Ga0439433_0039825
468 Ga0451577_0000024
469 Ga0451577_0004230
470 Ga0451577_0384683
471 Ga0451577_0404311
472 Ga0466969_0003890
473 Ga0453683_0196273
474 Ga0453684_0000001
475 Ga0453684_0000893
476 Ga0453684_0006045
477 Ga0453684_0015881
478 Ga0453684_0739534
479 Ga0451576_0003273
480 Ga0451576_0005289
481 Ga0451576_0073141
482 Ga0451576_0141637
483 Ga0451576_0163100
484 Ga0451576_0218455
485 Ga0451576_1210832
486 Ga0495592_0000437
487 Ga0495629_0000001
488 Ga0495629_0102673
489 Ga0495580_0001783
490 Ga0495639_0000200
491 Ga0495662_0011128
492 Ga0495594_0064138
493 Ga0495594_0121501
494 Ga0495618_0006363
495 Ga0495630_0004143
496 Ga0495666_0000321
497 Ga0495666_0012536
498 Ga0495652_0010461
499 Ga0495640_0035426
500 Ga0495586_0000718
501 Ga0495586_0004260
502 Ga0495657_0041888
503 Ga0495599_0077327
504 Ga0495599_0182275
505 Ga0495623_0054953
506 Ga0495647_0009174
507 Ga0495647_0016403
508 Ga0495658_0002345
509 Ga0495613_0216397
510 Ga0495624_0048036
511 Ga0495581_0005828
512 Ga0495674_0011009
513 Ga0495676_0000685
514 Ga0495602_0125808
515 Ga0501032_0000093
516 Ga0501046_0045554
517 Ga0501047_0023170
518 Ga0501067_0140523
519 Ga0501076_0234600
520 Ga0501035_0001443
521 Ga0501035_0004485
522 Ga0501044_0000050
523 Ga0501045_0395460
524 nmdc:mga05p37_1273_c1
525 nmdc:mga05p37_404451_c1
526 nmdc:mga05p37_444082_c1
527 nmdc:mga09592_375886_c1
528 nmdc:mga0qj67_7818_c1
529 nmdc:mga06r32_215865_c1
530 nmdc:mga08y16_11157_c1
531 nmdc:mga08y16_15149_c1
532 nmdc:mga08y16_370336_c1
533 nmdc:mga0n895_257310_c1
534 nmdc:mga0n895_334231_c1
535 nmdc:mga0n895_53293_c1
536 nmdc:mga0rr50_308123_c1
537 nmdc:mga08x19_273460_c1
538 nmdc:mga0a205_233462_c1
539 nmdc:mga0a205_279809_c1
540 nmdc:mga0a205_294581_c1
541 nmdc:mga0a205_432478_c1
542 nmdc:mga0a205_90505_c1
543 Ga0500566_0091009
544 2788436687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

197

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9435 1 202
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9391 2 202
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9364 2 202
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.924 1 203
5nik-assembly1.cif.gz_J structure of the macab-tolc abc-type tripartite multidrug efflux pump 0.9238 2 202
ID Description Score Start End Superfamily
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9435 20 202 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 26 204 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9355 2 202 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9341 2 205 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9329 1 207 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Q7W5S7-F1-model_v4 ABC transporter ATP-binding protein 0.9446 2 197 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-W4UY91-F1-model_v4 ABC transporter ATP-binding protein 0.9435 21 204 GO:0005524
GO:0016887
AF-A0A484F3V7-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9407 2 203 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7C3WP49-F1-model_v4 ABC transporter ATP-binding protein 0.9406 2 203 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7H4ZMJ9-F1-model_v4 deleted 0.9401 1 202

Map