F378028

General Info

Members Datasets Scaffolds Average Seq Length
271 196 540 341

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2905926851|2905926860
Length 382
Sequence KGRRPTTAPLPVLTAGQLRLRHGSGSTDTALHGAQQRSKPMEYRKLGNSGTSVSHLALGTMTFGAESDEATSHAILSDYAAAGGNLIDTADVYSAGTSEEIIGRWLAKNPLERDRMVLASKGRFPMGTGPNDLGLSRRHLRRALDASLARLGVDHIDLYQVHAWDPLTPLEETLGFLNEAVVRGKIGYYGFSNYTGWQLTKAVLIARHRGYSLPVTLQPQYSLLVRDIEAEIVPAVLDAEMGMLPWSPLGGGWLTGKYSRDAEPTGATRLGENPKRGMEAWEKRNADRTWDIVDTVTGIAAERGINASHVALAWVAAKPAVTSVILGARTQDQLADNLASSGVELTPEELERLDEVSAPTFGDYPYGAPGQEQRSRKIEGGR

Samples

Sample ID Description Type Environment
1 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
190 2643221616 Leifsonia sp. Root227 Isolate Unclassified
191 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
192 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
193 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
194 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
195 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
196 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 1.11
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.12
Nodule 0
Rhizoplane 11.07
Rhizosphere 71.22
Stem 0
Stem Tuber 0.74
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000156 3300002772 Bacteria 64607
2 JGI25164J39214_1000786 3300002772 Bacteria 11449
3 JGI25165J46597_1000004 3300003214 Bacteria 667510
4 JGI25165J46597_1000005 3300003214 Bacteria 623702
5 Ga0055527_1000023 3300003760 Bacteria 204513
6 Ga0055542_1000023 3300003762 Bacteria 292964
7 Ga0055529_1000180 3300003763 Bacteria 86768
8 Ga0070658_10226749 3300005327 Bacteria 1581
9 Ga0070690_100090447 3300005330 Bacteria 2015
10 Ga0070670_100322710 3300005331 Bacteria 1353
11 Ga0068869_100076207 3300005334 Bacteria 2493
12 Ga0068868_100084005 3300005338 Bacteria 2557
13 Ga0070661_100286833 3300005344 Bacteria 1278
14 Ga0070709_10094777 3300005434 Bacteria 1975
15 Ga0070713_100000914 3300005436 Bacteria 18871
16 Ga0070711_100020456 3300005439 Bacteria 4266
17 Ga0070700_100073972 3300005441 Bacteria 2182
18 Ga0070708_100236098 3300005445 Bacteria 1716
19 Ga0070663_100000942 3300005455 Bacteria 15816
20 Ga0070662_100003568 3300005457 Bacteria 9712
21 Ga0070706_100014928 3300005467 Bacteria 7175
22 Ga0070698_100024159 3300005471 Bacteria 6342
23 Ga0070679_100385124 3300005530 Bacteria 1349
24 Ga0070684_100137339 3300005535 Bacteria 2209
25 Ga0070665_100189575 3300005548 Bacteria 2057
26 Ga0070664_100007051 3300005564 Bacteria 9070
27 Ga0070664_100074233 3300005564 Bacteria 2919
28 Ga0068857_100110561 3300005577 Bacteria 2469
29 Ga0068857_100207330 3300005577 Bacteria 1788
30 Ga0068856_100036854 3300005614 Bacteria 4796
31 Ga0068856_100578710 3300005614 Bacteria 1144
32 Ga0068852_100072168 3300005616 Bacteria 3033
33 Ga0068862_100088075 3300005844 Bacteria 2700
34 Ga0081539_10002011 3300005985 Bacteria 30800
35 Ga0075433_10090803 3300006852 Bacteria 2700
36 Ga0075434_100063581 3300006871 Bacteria 3673
37 Ga0075429_100234604 3300006880 Bacteria 1607
38 Ga0068865_100232588 3300006881 Bacteria 1447
39 Ga0075436_100042128 3300006914 Bacteria 3148
40 Ga0105244_10023105 3300009036 Bacteria 3415
41 Ga0111539_10000944 3300009094 Bacteria 38074
42 Ga0105245_10043052 3300009098 Bacteria 4028
43 Ga0105243_10213865 3300009148 Bacteria 1699
44 Ga0105248_10607584 3300009177 Bacteria 1234
45 Ga0105237_10034796 3300009545 Bacteria 5098
46 Ga0105238_10639718 3300009551 Bacteria 1073
47 Ga0105246_10096137 3300011119 Bacteria 2146
48 Ga0105246_10121602 3300011119 Bacteria 1935
49 Ga0157369_10159256 3300013105 Bacteria 2383
50 Ga0157369_10174320 3300013105 Bacteria 2264
51 Ga0163162_10214651 3300013306 Bacteria 2054
52 Ga0157372_10198250 3300013307 Bacteria 2325
53 Ga0157375_10439378 3300013308 Bacteria 1470
54 Ga0206354_11560869 3300020081 Bacteria 1376
55 Ga0206353_10309435 3300020082 Bacteria 1631
56 Ga0206353_11715273 3300020082 Bacteria 2936
57 Ga0209672_100064 3300025228 Bacteria 204609
58 Ga0209147_100965 3300025229 Bacteria 12606
59 Ga0207427_100010 3300025231 Bacteria 648610
60 Ga0207427_100028 3300025231 Bacteria 388949
61 Ga0209437_100211 3300025233 Bacteria 108544
62 Ga0209258_101966 3300025242 Bacteria 5965
63 Ga0209148_1000108 3300025254 Bacteria 204609
64 Ga0209148_1003560 3300025254 Bacteria 4221
65 Ga0209233_1000001 3300025261 Bacteria 2992747
66 Ga0209455_1000102 3300025272 Bacteria 204609
67 Ga0207699_10000927 3300025906 Bacteria 13987
68 Ga0207645_10064583 3300025907 Bacteria 2339
69 Ga0207671_10078754 3300025914 Bacteria 2469
70 Ga0207663_10048293 3300025916 Bacteria 2633
71 Ga0207649_10122747 3300025920 Bacteria 1753
72 Ga0207652_10357856 3300025921 Bacteria 1317
73 Ga0207681_10155066 3300025923 Bacteria 1720
74 Ga0207659_10007208 3300025926 Bacteria 6830
75 Ga0207687_10084766 3300025927 Bacteria 2297
76 Ga0207664_10183106 3300025929 Bacteria 1799
77 Ga0207706_10032566 3300025933 Bacteria 4641
78 Ga0207689_10017721 3300025942 Bacteria 6019
79 Ga0207679_10020424 3300025945 Bacteria 4470
80 Ga0207667_10040228 3300025949 Bacteria 4979
81 Ga0207712_10198744 3300025961 Bacteria 1588
82 Ga0207677_10144800 3300026023 Bacteria 1825
83 Ga0207639_10060397 3300026041 Bacteria 2924
84 Ga0207678_10002940 3300026067 Bacteria 15438
85 Ga0207708_10094970 3300026075 Bacteria 2302
86 Ga0207674_10181584 3300026116 Bacteria 2055
87 Ga0265334_10028173 3300028573 Bacteria 2259
88 Ga0265338_10001720 3300028800 Bacteria 34705
89 Ga0265338_10147441 3300028800 Bacteria 1834
90 Ga0307512_10003105 3300030522 Bacteria 19822
91 Ga0307512_10005659 3300030522 Bacteria 12916
92 Ga0265339_10025266 3300031249 Bacteria 3410
93 Ga0307513_10003799 3300031456 Bacteria 20354
94 Ga0265313_10056507 3300031595 Bacteria 1856
95 Ga0307508_10030989 3300031616 Bacteria 4835
96 Ga0265314_10039494 3300031711 Bacteria 3398
97 Ga0307516_10029722 3300031730 Bacteria 5522
98 Ga0307516_10082647 3300031730 Bacteria 3053
99 Ga0307516_10206058 3300031730 Bacteria 1683
100 Ga0307413_10144915 3300031824 Bacteria 1647
101 Ga0307410_10028608 3300031852 Bacteria 3538
102 Ga0307410_10157362 3300031852 Bacteria 1699
103 Ga0307409_100207171 3300031995 Bacteria 1759
104 Ga0307416_100082987 3300032002 Bacteria 2717
105 Ga0307414_10223941 3300032004 Bacteria 1546
106 Ga0307415_100006825 3300032126 Bacteria 6194
107 Ga0307415_100086363 3300032126 Bacteria 2257
108 Ga0307415_100215322 3300032126 Bacteria 1536
109 Ga0395899_0113860 3300037312 Bacteria 1942
110 Ga0395900_0070255 3300037418 Bacteria 3600
111 Ga0395900_0104196 3300037418 Bacteria 2914
112 Ga0395898_0001449 3300037466 Bacteria 33602
113 Ga0395898_0018009 3300037466 Bacteria 7206
114 Ga0395898_0048833 3300037466 Bacteria 4148
115 Ga0451791_0959350 3300041451 Bacteria 999
116 Ga0451797_0400171 3300041453 Bacteria 1421
117 Ga0451853_2223971 3300041512 Bacteria 1192
118 Ga0439448_0018146 3300042005 Bacteria 2153
119 Ga0466972_0056177 3300044658 Bacteria 1893
120 Ga0466965_0066265 3300044683 Bacteria 1810
121 Ga0466965_0074897 3300044683 Bacteria 1706
122 Ga0466961_0108458 3300044693 Bacteria 1748
123 Ga0466963_0021133 3300044694 Bacteria 4101
124 Ga0466970_0038934 3300044765 Bacteria 2523
125 Ga0466970_0041252 3300044765 Bacteria 2452
126 Ga0466970_0188767 3300044765 Bacteria 1145
127 Ga0466960_0037883 3300044901 Bacteria 2264
128 Ga0466967_0000514 3300045976 Bacteria 18890
129 Ga0466967_0037358 3300045976 Bacteria 4155
130 Ga0466967_0098495 3300045976 Bacteria 2670
131 Ga0495592_0002589 3300046454 Bacteria 12778
132 Ga0495592_0066952 3300046454 Bacteria 2626
133 Ga0495629_0193228 3300046459 Bacteria 1408
134 Ga0495651_0071819 3300046462 Bacteria 2630
135 Ga0495653_0101409 3300046463 Bacteria 2085
136 Ga0495662_0009793 3300046476 Bacteria 4708
137 Ga0495662_0015406 3300046476 Bacteria 3712
138 Ga0495606_0230919 3300046507 Bacteria 1037
139 Ga0495628_0035962 3300046516 Bacteria 3978
140 Ga0495628_0100594 3300046516 Bacteria 2231
141 Ga0495630_0050116 3300046517 Bacteria 3124
142 Ga0495632_0015126 3300046519 Bacteria 4339
143 Ga0495652_0032044 3300046529 Bacteria 4598
144 Ga0495652_0116830 3300046529 Bacteria 2135
145 Ga0495652_0215895 3300046529 Bacteria 1444
146 Ga0495587_0014227 3300046536 Bacteria 4993
147 Ga0495645_0023087 3300046543 Bacteria 4503
148 Ga0495667_0090660 3300046559 Bacteria 1980
149 Ga0495634_0014814 3300046642 Bacteria 5607
150 Ga0495634_0044836 3300046642 Bacteria 2991
151 Ga0495625_0072688 3300046660 Bacteria 2412
152 Ga0495635_0027289 3300046663 Bacteria 3971
153 Ga0495657_0168306 3300046675 Bacteria 1351
154 Ga0495599_0070057 3300046678 Bacteria 2188
155 Ga0495623_0087382 3300046679 Bacteria 1920
156 Ga0495646_0004877 3300046680 Bacteria 8477
157 Ga0495613_0010681 3300046689 Bacteria 6809
158 Ga0495613_0169491 3300046689 Bacteria 1550
159 Ga0495600_0023706 3300046809 Bacteria 3948
160 Ga0495600_0077218 3300046809 Bacteria 2174
161 Ga0495581_0112628 3300047315 Bacteria 1582
162 Ga0495604_0071200 3300047317 Bacteria 2630
163 Ga0495604_0092604 3300047317 Bacteria 2238
164 Ga0495676_0023520 3300047321 Bacteria 5348
165 Ga0495675_0050562 3300047444 Bacteria 2642
166 Ga0495675_0072396 3300047444 Bacteria 2174
167 Ga0495684_0035199 3300047471 Bacteria 3840
168 Ga0495602_0056064 3300048088 Bacteria 3468
169 Ga0496100_0160032 3300048903 Bacteria 1613
170 Ga0496100_0184484 3300048903 Bacteria 1511
171 Ga0496100_0187160 3300048903 Bacteria 1501
172 Ga0496101_0146367 3300048904 Bacteria 1804
173 Ga0496101_0173563 3300048904 Bacteria 1657
174 Ga0496101_0247921 3300048904 Bacteria 1387
175 Ga0496102_0018481 3300048905 Bacteria 6127
176 Ga0496102_0041022 3300048905 Bacteria 4190
177 Ga0496104_0044538 3300048907 Bacteria 4169
178 Ga0496105_0072219 3300048908 Bacteria 2852
179 Ga0496107_0156288 3300048910 Bacteria 1689
180 Ga0496108_0104607 3300048911 Bacteria 2416
181 Ga0496108_0325150 3300048911 Bacteria 1341
182 Ga0496109_0063133 3300048912 Bacteria 3388
183 Ga0496109_0327062 3300048912 Bacteria 1447
184 Ga0496110_0023170 3300048913 Bacteria 5280
185 Ga0496110_0042527 3300048913 Bacteria 3966
186 Ga0496110_0078935 3300048913 Bacteria 2930
187 Ga0496110_0144192 3300048913 Bacteria 2154
188 Ga0496110_0326209 3300048913 Bacteria 1398
189 Ga0496113_0092807 3300048916 Bacteria 2329
190 Ga0496113_0093613 3300048916 Bacteria 2320
191 Ga0496114_0097229 3300048917 Bacteria 2508
192 Ga0496114_0116807 3300048917 Bacteria 2291
193 Ga0496114_0181925 3300048917 Bacteria 1836
194 Ga0496114_0304280 3300048917 Bacteria 1408
195 Ga0496115_0197433 3300048918 Bacteria 1662
196 Ga0496115_0372601 3300048918 Bacteria 1162
197 Ga0496116_0077480 3300048919 Bacteria 2077
198 Ga0496117_0028247 3300048920 Bacteria 4348
199 Ga0496118_0025963 3300048921 Bacteria 5006
200 Ga0496119_0078388 3300048922 Bacteria 1911
201 Ga0496120_0079770 3300048923 Bacteria 1776
202 Ga0496122_0023961 3300048925 Bacteria 5358
203 Ga0496123_0023553 3300048926 Bacteria 4709
204 Ga0496124_0011579 3300048927 Bacteria 8801
205 Ga0496124_0071140 3300048927 Bacteria 2884
206 Ga0496125_0000129 3300048928 Bacteria 163342
207 Ga0496125_0008440 3300048928 Bacteria 10781
208 Ga0496126_0005847 3300048929 Bacteria 13892
209 Ga0496126_0020344 3300048929 Bacteria 6512
210 Ga0496126_0140708 3300048929 Bacteria 2077
211 Ga0501031_0000153 3300049568 Bacteria 39050
212 Ga0501031_0006167 3300049568 Bacteria 7828
213 Ga0501031_0083382 3300049568 Bacteria 2083
214 Ga0501032_0000456 3300049569 Bacteria 32973
215 Ga0501032_0011325 3300049569 Bacteria 6405
216 Ga0501033_0004289 3300049570 Bacteria 11458
217 Ga0501033_0079639 3300049570 Bacteria 2404
218 Ga0501033_0109200 3300049570 Bacteria 2014
219 Ga0501034_0013086 3300049571 Bacteria 8550
220 Ga0501036_0000662 3300049572 Bacteria 25288
221 Ga0501036_0037026 3300049572 Bacteria 4127
222 Ga0501037_0000343 3300049573 Bacteria 39227
223 Ga0501037_0056939 3300049573 Bacteria 2855
224 Ga0501037_0127919 3300049573 Bacteria 1823
225 Ga0501038_0000714 3300049574 Bacteria 29677
226 Ga0501038_0022110 3300049574 Bacteria 5700
227 Ga0501038_0094364 3300049574 Bacteria 2501
228 Ga0501039_0000599 3300049575 Bacteria 26075
229 Ga0501042_0012794 3300049578 Bacteria 5696
230 Ga0501043_0000764 3300049579 Bacteria 28593
231 Ga0501043_0015520 3300049579 Bacteria 5969
232 Ga0501046_0000677 3300049580 Bacteria 33065
233 Ga0501046_0250763 3300049580 Bacteria 1303
234 Ga0501047_0001076 3300049581 Bacteria 27193
235 Ga0501047_0071446 3300049581 Bacteria 3341
236 Ga0501047_0192686 3300049581 Bacteria 1901
237 Ga0501047_0448036 3300049581 Bacteria 1120
238 Ga0501048_0004707 3300049582 Bacteria 10391
239 Ga0501068_0011532 3300049584 Bacteria 4992
240 Ga0501069_0000436 3300049585 Bacteria 18984
241 Ga0501070_0000684 3300049586 Bacteria 31074
242 Ga0501073_0003289 3300049589 Bacteria 12139
243 Ga0501074_0100758 3300049590 Bacteria 2067
244 Ga0501080_0000676 3300049742 Bacteria 27213
245 Ga0501080_0239759 3300049742 Bacteria 1655
246 Ga0501083_0135709 3300049744 Bacteria 1612
247 Ga0501044_0133642 3300049823 Bacteria 2473
248 Ga0501044_0136594 3300049823 Bacteria 2443
249 Ga0501044_0198415 3300049823 Bacteria 1966
250 Ga0501045_0124310 3300049824 Bacteria 1916
251 nmdc:mga08y16_54828_c1 3300050511 Bacteria 4166
252 nmdc:mga0n895_40648_c1 3300050512 Bacteria 4518
253 nmdc:mga0rr50_70653_c1 3300050513 Bacteria 2661
254 nmdc:mga08x19_69901_c1 3300050514 Bacteria 2287
255 nmdc:mga0a205_103676_c1 3300050515 Bacteria 2743
256 Ga0495601_0093987 3300053077 Bacteria 1932
257 Ga0500651_0075256 3300053093 Bacteria 2098
258 Ga0500618_007150 3300053125 Bacteria 3211
259 Ga0500559_0009957 3300053136 Bacteria 4096
260 Ga0500634_0000273 3300053161 Bacteria 16502
261 Ga0501084_0009487 3300054114 Bacteria 8054
262 2905926860 2905926851 Bacteria 4423176
263 2644096766 2643221616 Bacteria 4066575
264 2776377297 2775506925 Bacteria 7237746
265 2812321275 2811994871 Bacteria 4497550
266 2863074337 2863067949 Bacteria 8541735
267 2884766020 2884763398 Bacteria 4091164
268 2884767051 2884763398 Bacteria 4091164
269 2946004291 2946003308 Bacteria 3857229
270 2966925953 2966924647 Bacteria 3268643
271 JGI25164J39214_1000156
272 JGI25164J39214_1000786
273 JGI25165J46597_1000004
274 JGI25165J46597_1000005
275 Ga0055527_1000023
276 Ga0055542_1000023
277 Ga0055529_1000180
278 Ga0070658_10226749
279 Ga0070690_100090447
280 Ga0070670_100322710
281 Ga0068869_100076207
282 Ga0068868_100084005
283 Ga0070661_100286833
284 Ga0070709_10094777
285 Ga0070713_100000914
286 Ga0070711_100020456
287 Ga0070700_100073972
288 Ga0070708_100236098
289 Ga0070663_100000942
290 Ga0070662_100003568
291 Ga0070706_100014928
292 Ga0070698_100024159
293 Ga0070679_100385124
294 Ga0070684_100137339
295 Ga0070665_100189575
296 Ga0070664_100007051
297 Ga0070664_100074233
298 Ga0068857_100110561
299 Ga0068857_100207330
300 Ga0068856_100036854
301 Ga0068856_100578710
302 Ga0068852_100072168
303 Ga0068862_100088075
304 Ga0081539_10002011
305 Ga0075433_10090803
306 Ga0075434_100063581
307 Ga0075429_100234604
308 Ga0068865_100232588
309 Ga0075436_100042128
310 Ga0105244_10023105
311 Ga0111539_10000944
312 Ga0105245_10043052
313 Ga0105243_10213865
314 Ga0105248_10607584
315 Ga0105237_10034796
316 Ga0105238_10639718
317 Ga0105246_10096137
318 Ga0105246_10121602
319 Ga0157369_10159256
320 Ga0157369_10174320
321 Ga0163162_10214651
322 Ga0157372_10198250
323 Ga0157375_10439378
324 Ga0206354_11560869
325 Ga0206353_10309435
326 Ga0206353_11715273
327 Ga0209672_100064
328 Ga0209147_100965
329 Ga0207427_100010
330 Ga0207427_100028
331 Ga0209437_100211
332 Ga0209258_101966
333 Ga0209148_1000108
334 Ga0209148_1003560
335 Ga0209233_1000001
336 Ga0209455_1000102
337 Ga0207699_10000927
338 Ga0207645_10064583
339 Ga0207671_10078754
340 Ga0207663_10048293
341 Ga0207649_10122747
342 Ga0207652_10357856
343 Ga0207681_10155066
344 Ga0207659_10007208
345 Ga0207687_10084766
346 Ga0207664_10183106
347 Ga0207706_10032566
348 Ga0207689_10017721
349 Ga0207679_10020424
350 Ga0207667_10040228
351 Ga0207712_10198744
352 Ga0207677_10144800
353 Ga0207639_10060397
354 Ga0207678_10002940
355 Ga0207708_10094970
356 Ga0207674_10181584
357 Ga0265334_10028173
358 Ga0265338_10001720
359 Ga0265338_10147441
360 Ga0307512_10003105
361 Ga0307512_10005659
362 Ga0265339_10025266
363 Ga0307513_10003799
364 Ga0265313_10056507
365 Ga0307508_10030989
366 Ga0265314_10039494
367 Ga0307516_10029722
368 Ga0307516_10082647
369 Ga0307516_10206058
370 Ga0307413_10144915
371 Ga0307410_10028608
372 Ga0307410_10157362
373 Ga0307409_100207171
374 Ga0307416_100082987
375 Ga0307414_10223941
376 Ga0307415_100006825
377 Ga0307415_100086363
378 Ga0307415_100215322
379 Ga0395899_0113860
380 Ga0395900_0070255
381 Ga0395900_0104196
382 Ga0395898_0001449
383 Ga0395898_0018009
384 Ga0395898_0048833
385 Ga0451791_0959350
386 Ga0451797_0400171
387 Ga0451853_2223971
388 Ga0439448_0018146
389 Ga0466972_0056177
390 Ga0466965_0066265
391 Ga0466965_0074897
392 Ga0466961_0108458
393 Ga0466963_0021133
394 Ga0466970_0038934
395 Ga0466970_0041252
396 Ga0466970_0188767
397 Ga0466960_0037883
398 Ga0466967_0000514
399 Ga0466967_0037358
400 Ga0466967_0098495
401 Ga0495592_0002589
402 Ga0495592_0066952
403 Ga0495629_0193228
404 Ga0495651_0071819
405 Ga0495653_0101409
406 Ga0495662_0009793
407 Ga0495662_0015406
408 Ga0495606_0230919
409 Ga0495628_0035962
410 Ga0495628_0100594
411 Ga0495630_0050116
412 Ga0495632_0015126
413 Ga0495652_0032044
414 Ga0495652_0116830
415 Ga0495652_0215895
416 Ga0495587_0014227
417 Ga0495645_0023087
418 Ga0495667_0090660
419 Ga0495634_0014814
420 Ga0495634_0044836
421 Ga0495625_0072688
422 Ga0495635_0027289
423 Ga0495657_0168306
424 Ga0495599_0070057
425 Ga0495623_0087382
426 Ga0495646_0004877
427 Ga0495613_0010681
428 Ga0495613_0169491
429 Ga0495600_0023706
430 Ga0495600_0077218
431 Ga0495581_0112628
432 Ga0495604_0071200
433 Ga0495604_0092604
434 Ga0495676_0023520
435 Ga0495675_0050562
436 Ga0495675_0072396
437 Ga0495684_0035199
438 Ga0495602_0056064
439 Ga0496100_0160032
440 Ga0496100_0184484
441 Ga0496100_0187160
442 Ga0496101_0146367
443 Ga0496101_0173563
444 Ga0496101_0247921
445 Ga0496102_0018481
446 Ga0496102_0041022
447 Ga0496104_0044538
448 Ga0496105_0072219
449 Ga0496107_0156288
450 Ga0496108_0104607
451 Ga0496108_0325150
452 Ga0496109_0063133
453 Ga0496109_0327062
454 Ga0496110_0023170
455 Ga0496110_0042527
456 Ga0496110_0078935
457 Ga0496110_0144192
458 Ga0496110_0326209
459 Ga0496113_0092807
460 Ga0496113_0093613
461 Ga0496114_0097229
462 Ga0496114_0116807
463 Ga0496114_0181925
464 Ga0496114_0304280
465 Ga0496115_0197433
466 Ga0496115_0372601
467 Ga0496116_0077480
468 Ga0496117_0028247
469 Ga0496118_0025963
470 Ga0496119_0078388
471 Ga0496120_0079770
472 Ga0496122_0023961
473 Ga0496123_0023553
474 Ga0496124_0011579
475 Ga0496124_0071140
476 Ga0496125_0000129
477 Ga0496125_0008440
478 Ga0496126_0005847
479 Ga0496126_0020344
480 Ga0496126_0140708
481 Ga0501031_0000153
482 Ga0501031_0006167
483 Ga0501031_0083382
484 Ga0501032_0000456
485 Ga0501032_0011325
486 Ga0501033_0004289
487 Ga0501033_0079639
488 Ga0501033_0109200
489 Ga0501034_0013086
490 Ga0501036_0000662
491 Ga0501036_0037026
492 Ga0501037_0000343
493 Ga0501037_0056939
494 Ga0501037_0127919
495 Ga0501038_0000714
496 Ga0501038_0022110
497 Ga0501038_0094364
498 Ga0501039_0000599
499 Ga0501042_0012794
500 Ga0501043_0000764
501 Ga0501043_0015520
502 Ga0501046_0000677
503 Ga0501046_0250763
504 Ga0501047_0001076
505 Ga0501047_0071446
506 Ga0501047_0192686
507 Ga0501047_0448036
508 Ga0501048_0004707
509 Ga0501068_0011532
510 Ga0501069_0000436
511 Ga0501070_0000684
512 Ga0501073_0003289
513 Ga0501074_0100758
514 Ga0501080_0000676
515 Ga0501080_0239759
516 Ga0501083_0135709
517 Ga0501044_0133642
518 Ga0501044_0136594
519 Ga0501044_0198415
520 Ga0501045_0124310
521 nmdc:mga08y16_54828_c1
522 nmdc:mga0n895_40648_c1
523 nmdc:mga0rr50_70653_c1
524 nmdc:mga08x19_69901_c1
525 nmdc:mga0a205_103676_c1
526 Ga0495601_0093987
527 Ga0500651_0075256
528 Ga0500618_007150
529 Ga0500559_0009957
530 Ga0500634_0000273
531 Ga0501084_0009487
532 2905926860
533 2644096766
534 2776377297
535 2812321275
536 2863074337
537 2884766020
538 2884767051
539 2946004291
540 2966925953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

55

358

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9718 3 341
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9714 1 341
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9679 1 341
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9594 1 341
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9578 1 341
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9254 1 320 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9233 1 316 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9184 1 320 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9145 1 320 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.912 1 321 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9873 107 206 GO:0005829
GO:0016491
AF-A0A531LSG7-F1-model_v4 Aldo/keto reductase 0.974 102 221 GO:0005829
GO:0016491
AF-A0A381ZS10-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9722 13 175
AF-A0A529HD53-F1-model_v4 Aldo/keto reductase 0.9718 89 212 GO:0005829
GO:0016491
AF-A0A3D0ZGE5-F1-model_v4 Aldo/keto reductase 0.9679 1 119 GO:0016491

Map