F377996

General Info

Members Datasets Scaffolds Average Seq Length
271 139 542 147

Family's Representative Sequence

Representative Sequence 3300059423|Ga0590074_081583|Ga0590074_081583_29_532
Length 167
Sequence MAIARAHHPVGVAAAPRRVDDPVFQAFTLLRIGFTVAPILFGLDKFLDWLVDWEQYLAPEVNDLIPGNAHQAMLAVGVVEIVAGLLVAARPRLGGYLVAAWLGGIIVNLLLQADHYDIALRDFGLLLAALTLARLATVCDRRRADEEGTAPTRLAPPTATSQEDPHD

Samples

Sample ID Description Type Environment
1 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
139 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0.37
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.64
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590074_081583 3300059423 Bacteria 618
2 JGI25407J50210_10000493 3300003373 Bacteria 7880
3 JGI25407J50210_10016580 3300003373 Bacteria 1908
4 Ga0058863_11402089 3300004799 Bacteria 1221
5 Ga0070683_100021132 3300005329 Bacteria 5804
6 Ga0070683_100184618 3300005329 Bacteria 1980
7 Ga0070683_101318532 3300005329 Bacteria 694
8 Ga0070680_100014628 3300005336 Bacteria 6137
9 Ga0070680_100238769 3300005336 Bacteria 1536
10 Ga0070675_100879301 3300005354 Bacteria 821
11 Ga0070659_101208224 3300005366 Bacteria 669
12 Ga0070705_100045802 3300005440 Bacteria 2519
13 Ga0070700_101278996 3300005441 Bacteria 616
14 Ga0070708_100178948 3300005445 Bacteria 1982
15 Ga0070708_100267268 3300005445 Bacteria 1608
16 Ga0070708_100396838 3300005445 Bacteria 1301
17 Ga0070681_10019014 3300005458 Bacteria 6875
18 Ga0070681_10023754 3300005458 Bacteria 6171
19 Ga0070681_10349640 3300005458 Bacteria 1388
20 Ga0070681_10432761 3300005458 Bacteria 1228
21 Ga0070706_100114010 3300005467 Bacteria 2517
22 Ga0070706_100117578 3300005467 Bacteria 2476
23 Ga0070707_100377540 3300005468 Bacteria 1377
24 Ga0070707_100807739 3300005468 Bacteria 902
25 Ga0070699_100061719 3300005518 Bacteria 3248
26 Ga0070679_100022434 3300005530 Bacteria 6169
27 Ga0070679_100220430 3300005530 Bacteria 1858
28 Ga0070684_100018533 3300005535 Bacteria 5737
29 Ga0070697_100508697 3300005536 Bacteria 1054
30 Ga0070697_100604381 3300005536 Bacteria 964
31 Ga0070686_100534717 3300005544 Bacteria 915
32 Ga0070695_100012139 3300005545 Bacteria 5165
33 Ga0070693_100455879 3300005547 Bacteria 898
34 Ga0070665_102370598 3300005548 Bacteria 533
35 Ga0068855_101036562 3300005563 Bacteria 860
36 Ga0070664_100931750 3300005564 Bacteria 815
37 Ga0070702_100555479 3300005615 Unclassified 853
38 Ga0068852_100162713 3300005616 Bacteria 2085
39 Ga0081455_10010281 3300005937 Bacteria 9515
40 Ga0081455_10387802 3300005937 Bacteria 974
41 Ga0081538_10000567 3300005981 Bacteria 40928
42 Ga0081538_10001244 3300005981 Bacteria 26667
43 Ga0081538_10152371 3300005981 Bacteria 1044
44 Ga0075428_100515430 3300006844 Bacteria 1279
45 Ga0075430_100033827 3300006846 Bacteria 4337
46 Ga0075430_100069379 3300006846 Bacteria 2957
47 Ga0075430_100742626 3300006846 Bacteria 809
48 Ga0075430_101577449 3300006846 Bacteria 539
49 Ga0075431_100420174 3300006847 Bacteria 1336
50 Ga0075431_100994905 3300006847 Bacteria 806
51 Ga0075431_101399967 3300006847 Bacteria 659
52 Ga0075433_11589329 3300006852 Bacteria 564
53 Ga0075429_100221443 3300006880 Bacteria 1657
54 Ga0075429_100274767 3300006880 Bacteria 1475
55 Ga0111539_10001032 3300009094 Bacteria 36496
56 Ga0111539_10019265 3300009094 Bacteria 8427
57 Ga0111539_10062911 3300009094 Bacteria 4392
58 Ga0111539_10186082 3300009094 Bacteria 2425
59 Ga0105245_11134156 3300009098 Bacteria 829
60 Ga0105245_11647506 3300009098 Bacteria 693
61 Ga0114129_10494341 3300009147 Bacteria 1598
62 Ga0114129_10565926 3300009147 Bacteria 1476
63 Ga0114129_11059149 3300009147 Bacteria 1018
64 Ga0105243_12057447 3300009148 Bacteria 606
65 Ga0105242_10534307 3300009176 Bacteria 1121
66 Ga0105248_10323443 3300009177 Bacteria 1737
67 Ga0157378_10263256 3300013297 Bacteria 1655
68 Ga0163162_10522325 3300013306 Bacteria 1317
69 Ga0157375_10132607 3300013308 Bacteria 2612
70 Ga0157375_10393321 3300013308 Bacteria 1553
71 Ga0163163_10045537 3300014325 Bacteria 4307
72 Ga0182008_10003614 3300014497 Bacteria 9255
73 Ga0157376_11881443 3300014969 Bacteria 635
74 Ga0207684_10302695 3300025910 Bacteria 1378
75 Ga0207684_10448057 3300025910 Bacteria 1108
76 Ga0207654_11118443 3300025911 Bacteria 574
77 Ga0207707_10001980 3300025912 Bacteria 18611
78 Ga0207707_10016754 3300025912 Bacteria 6385
79 Ga0207707_10112798 3300025912 Bacteria 2377
80 Ga0207707_10970172 3300025912 Bacteria 699
81 Ga0207660_10000508 3300025917 Bacteria 26010
82 Ga0207660_10428743 3300025917 Bacteria 1067
83 Ga0207652_10001104 3300025921 Bacteria 24346
84 Ga0207646_10100412 3300025922 Bacteria 2594
85 Ga0207646_10394706 3300025922 Bacteria 1250
86 Ga0207694_11854990 3300025924 Bacteria 506
87 Ga0207659_10196339 3300025926 Bacteria 1609
88 Ga0207644_10524541 3300025931 Bacteria 979
89 Ga0207690_10759324 3300025932 Bacteria 800
90 Ga0207711_10209922 3300025941 Bacteria 1778
91 Ga0207661_10154790 3300025944 Bacteria 1984
92 Ga0207661_10258740 3300025944 Bacteria 1550
93 Ga0207667_10928326 3300025949 Bacteria 861
94 Ga0207651_10682649 3300025960 Bacteria 904
95 Ga0207658_11271869 3300025986 Bacteria 673
96 Ga0207683_10655556 3300026121 Bacteria 972
97 Ga0207698_10061524 3300026142 Bacteria 2926
98 Ga0209974_10128607 3300027876 Bacteria 902
99 Ga0207428_10014507 3300027907 Bacteria 6839
100 Ga0207428_10035035 3300027907 Bacteria 4107
101 Ga0207428_10244198 3300027907 Bacteria 1341
102 Ga0307410_10226037 3300031852 Bacteria 1442
103 Ga0307416_100998731 3300032002 Bacteria 940
104 Ga0373937_0793747 3300036401 Bacteria 895
105 Ga0395899_0288170 3300037312 Bacteria 1115
106 Ga0395898_0150156 3300037466 Bacteria 2230
107 Ga0395905_0124323 3300037471 Bacteria 2426
108 Ga0395901_0050732 3300038443 Bacteria 4310
109 Ga0436365_0265123 3300039437 Bacteria 21423
110 Ga0439465_0263482 3300041413 Bacteria 639
111 Ga0451807_1782284 3300041486 Bacteria 547
112 Ga0466967_0401099 3300045976 Bacteria 1334
113 Ga0495629_0225127 3300046459 Bacteria 1293
114 Ga0495662_0509513 3300046476 Bacteria 590
115 Ga0495618_0056172 3300046514 Bacteria 2493
116 Ga0495658_0049634 3300046683 Bacteria 2371
117 Ga0495658_0176191 3300046683 Bacteria 1325
118 Ga0495658_0585442 3300046683 Bacteria 715
119 Ga0495581_0261430 3300047315 Bacteria 1012
120 Ga0495604_0391221 3300047317 Bacteria 917
121 Ga0495674_1107518 3300047319 Unclassified 602
122 Ga0495676_0247133 3300047321 Bacteria 1219
123 Ga0495675_0245879 3300047444 Bacteria 1076
124 Ga0495614_0062456 3300048089 Bacteria 1601
125 Ga0496100_0299633 3300048903 Bacteria 1203
126 Ga0496101_0337280 3300048904 Bacteria 1184
127 Ga0496102_0038792 3300048905 Bacteria 4302
128 Ga0496102_1330436 3300048905 Bacteria 637
129 Ga0496104_0486404 3300048907 Bacteria 1145
130 Ga0496105_0080039 3300048908 Bacteria 2698
131 Ga0496106_0884385 3300048909 Bacteria 706
132 Ga0496108_0641605 3300048911 Bacteria 923
133 Ga0496109_0013560 3300048912 Bacteria 7076
134 Ga0496110_0073441 3300048913 Bacteria 3035
135 Ga0496110_0275836 3300048913 Bacteria 1531
136 Ga0496110_0294700 3300048913 Bacteria 1478
137 Ga0496111_0072736 3300048914 Bacteria 2503
138 Ga0496111_0120726 3300048914 Bacteria 1936
139 Ga0496113_0006414 3300048916 Bacteria 7455
140 Ga0496114_0035043 3300048917 Bacteria 4143
141 Ga0496114_0720610 3300048917 Bacteria 874
142 Ga0501031_0068019 3300049568 Bacteria 2320
143 Ga0501031_0109717 3300049568 Bacteria 1802
144 Ga0501031_0212899 3300049568 Bacteria 1259
145 Ga0501032_0057706 3300049569 Bacteria 2608
146 Ga0501032_0153004 3300049569 Bacteria 1516
147 Ga0501033_0019421 3300049570 Bacteria 5140
148 Ga0501033_0185182 3300049570 Bacteria 1492
149 Ga0501034_0017112 3300049571 Bacteria 7437
150 Ga0501034_0595414 3300049571 Bacteria 1012
151 Ga0501036_0013138 3300049572 Bacteria 6878
152 Ga0501036_0143079 3300049572 Bacteria 2017
153 Ga0501036_0190465 3300049572 Bacteria 1726
154 Ga0501037_0048486 3300049573 Bacteria 3112
155 Ga0501037_0276263 3300049573 Bacteria 1171
156 Ga0501037_0353481 3300049573 Bacteria 1013
157 Ga0501038_0063736 3300049574 Bacteria 3145
158 Ga0501038_0434886 3300049574 Bacteria 1011
159 Ga0501038_0774381 3300049574 Bacteria 714
160 Ga0501039_0017525 3300049575 Bacteria 5494
161 Ga0501039_0308664 3300049575 Bacteria 1243
162 Ga0501039_0473677 3300049575 Bacteria 983
163 Ga0501040_0006640 3300049576 Bacteria 7509
164 Ga0501040_0127849 3300049576 Bacteria 1785
165 Ga0501040_0358007 3300049576 Bacteria 1046
166 Ga0501040_0476129 3300049576 Bacteria 899
167 Ga0501040_0734149 3300049576 Bacteria 714
168 Ga0501040_0974858 3300049576 Bacteria 614
169 Ga0501040_1358356 3300049576 Bacteria 516
170 Ga0501041_0008059 3300049577 Bacteria 6199
171 Ga0501041_0110234 3300049577 Bacteria 1707
172 Ga0501041_0218906 3300049577 Bacteria 1195
173 Ga0501041_0237967 3300049577 Unclassified 1144
174 Ga0501041_0347819 3300049577 Bacteria 937
175 Ga0501042_0008407 3300049578 Bacteria 6811
176 Ga0501042_0212295 3300049578 Bacteria 1396
177 Ga0501042_0449483 3300049578 Bacteria 934
178 Ga0501042_0691713 3300049578 Bacteria 741
179 Ga0501042_0824313 3300049578 Bacteria 675
180 Ga0501043_0114950 3300049579 Bacteria 2112
181 Ga0501043_0354604 3300049579 Bacteria 1114
182 Ga0501046_0007247 3300049580 Bacteria 9749
183 Ga0501046_0081164 3300049580 Bacteria 2505
184 Ga0501046_0139498 3300049580 Bacteria 1835
185 Ga0501048_0010641 3300049582 Bacteria 6862
186 Ga0501048_0041008 3300049582 Bacteria 3316
187 Ga0501048_0536272 3300049582 Bacteria 839
188 Ga0501068_0075561 3300049584 Bacteria 2061
189 Ga0501068_0155089 3300049584 Bacteria 1441
190 Ga0501068_0595246 3300049584 Bacteria 720
191 Ga0501068_0665066 3300049584 Bacteria 680
192 Ga0501069_0069481 3300049585 Bacteria 1972
193 Ga0501070_0285618 3300049586 Bacteria 1346
194 Ga0501070_0290377 3300049586 Bacteria 1333
195 Ga0501071_0091532 3300049587 Bacteria 2234
196 Ga0501071_0173971 3300049587 Bacteria 1612
197 Ga0501071_0183180 3300049587 Bacteria 1569
198 Ga0501071_0220256 3300049587 Bacteria 1428
199 Ga0501071_0222069 3300049587 Bacteria 1422
200 Ga0501072_0012168 3300049588 Bacteria 6575
201 Ga0501072_0071882 3300049588 Bacteria 2733
202 Ga0501072_0075286 3300049588 Bacteria 2670
203 Ga0501072_0132503 3300049588 Bacteria 1987
204 Ga0501072_0171496 3300049588 Bacteria 1731
205 Ga0501072_0335323 3300049588 Bacteria 1201
206 Ga0501072_0409831 3300049588 Bacteria 1075
207 Ga0501072_0822302 3300049588 Bacteria 727
208 Ga0501073_1154538 3300049589 Bacteria 532
209 Ga0501073_1266966 3300049589 Bacteria 506
210 Ga0501074_0172808 3300049590 Bacteria 1542
211 Ga0501074_0181900 3300049590 Bacteria 1499
212 Ga0501074_0288090 3300049590 Bacteria 1167
213 Ga0501075_0009950 3300049591 Bacteria 6666
214 Ga0501075_0083684 3300049591 Bacteria 2417
215 Ga0501075_0121713 3300049591 Bacteria 1986
216 Ga0501075_0379570 3300049591 Bacteria 1077
217 Ga0501075_0416200 3300049591 Bacteria 1025
218 Ga0501075_1353705 3300049591 Bacteria 539
219 Ga0501076_0065032 3300049592 Bacteria 2907
220 Ga0501076_0070261 3300049592 Bacteria 2799
221 Ga0501076_0141760 3300049592 Bacteria 1953
222 Ga0501076_0159351 3300049592 Bacteria 1838
223 Ga0501076_0277326 3300049592 Bacteria 1373
224 Ga0501077_0018797 3300049593 Bacteria 4372
225 Ga0501077_0031043 3300049593 Bacteria 3399
226 Ga0501077_0636184 3300049593 Bacteria 685
227 Ga0501079_0027621 3300049741 Bacteria 4353
228 Ga0501079_0066348 3300049741 Bacteria 2785
229 Ga0501079_0111259 3300049741 Bacteria 2128
230 Ga0501080_0022600 3300049742 Bacteria 5826
231 Ga0501080_0795531 3300049742 Bacteria 830
232 Ga0501081_0053222 3300049743 Bacteria 2794
233 Ga0501081_0109410 3300049743 Bacteria 1960
234 Ga0501081_0684997 3300049743 Bacteria 769
235 Ga0501083_0037693 3300049744 Bacteria 3291
236 Ga0501035_0075023 3300049822 Bacteria 2991
237 Ga0501035_1131680 3300049822 Bacteria 610
238 Ga0501044_0860471 3300049823 Bacteria 783
239 Ga0501045_0014698 3300049824 Bacteria 5551
240 Ga0501045_0040861 3300049824 Bacteria 3373
241 Ga0501045_0059605 3300049824 Bacteria 2796
242 Ga0501045_0077313 3300049824 Bacteria 2452
243 nmdc:mga05p37_1321744_c1 3300050507 Bacteria 733
244 nmdc:mga05p37_252855_c1 3300050507 Bacteria 2113
245 nmdc:mga0qj67_1299465_c1 3300050509 Bacteria 564
246 nmdc:mga0qj67_176381_c1 3300050509 Bacteria 1735
247 nmdc:mga06r32_1615368_c1 3300050510 Bacteria 587
248 nmdc:mga06r32_290489_c1 3300050510 Bacteria 1622
249 nmdc:mga06r32_368716_c1 3300050510 Bacteria 1419
250 nmdc:mga08y16_123842_c1 3300050511 Bacteria 2690
251 nmdc:mga08y16_174148_c1 3300050511 Bacteria 2234
252 nmdc:mga08y16_388062_c1 3300050511 Bacteria 1431
253 Ga0495612_0063773 3300053078 Bacteria 1528
254 Ga0495595_0049102 3300053084 Bacteria 1951
255 Ga0495619_0655894 3300053085 Bacteria 715
256 Ga0501084_0048332 3300054114 Bacteria 3561
257 Ga0501084_0718167 3300054114 Bacteria 842
258 Ga0501084_1013926 3300054114 Bacteria 697
259 Ga0501082_0015867 3300060353 Bacteria 6477
260 Ga0501082_0021723 3300060353 Bacteria 5533
261 Ga0501082_0417537 3300060353 Bacteria 1171
262 Ga0501082_0456182 3300060353 Bacteria 1117
263 Ga0501082_0632932 3300060353 Bacteria 936
264 Ga0530510_0009059 3300061734 Bacteria 6978
265 Ga0530510_0012551 3300061734 Bacteria 5955
266 Ga0530510_0033405 3300061734 Bacteria 3704
267 Ga0530510_0464193 3300061734 Bacteria 958
268 Ga0530510_0550782 3300061734 Bacteria 876
269 Ga0530510_1298505 3300061734 Bacteria 558
270 2623590384 2622736626 Bacteria 7181580
271 2809194983 2808606439 Bacteria 5952208
272 Ga0590074_081583
273 JGI25407J50210_10000493
274 JGI25407J50210_10016580
275 Ga0058863_11402089
276 Ga0070683_100021132
277 Ga0070683_100184618
278 Ga0070683_101318532
279 Ga0070680_100014628
280 Ga0070680_100238769
281 Ga0070675_100879301
282 Ga0070659_101208224
283 Ga0070705_100045802
284 Ga0070700_101278996
285 Ga0070708_100178948
286 Ga0070708_100267268
287 Ga0070708_100396838
288 Ga0070681_10019014
289 Ga0070681_10023754
290 Ga0070681_10349640
291 Ga0070681_10432761
292 Ga0070706_100114010
293 Ga0070706_100117578
294 Ga0070707_100377540
295 Ga0070707_100807739
296 Ga0070699_100061719
297 Ga0070679_100022434
298 Ga0070679_100220430
299 Ga0070684_100018533
300 Ga0070697_100508697
301 Ga0070697_100604381
302 Ga0070686_100534717
303 Ga0070695_100012139
304 Ga0070693_100455879
305 Ga0070665_102370598
306 Ga0068855_101036562
307 Ga0070664_100931750
308 Ga0070702_100555479
309 Ga0068852_100162713
310 Ga0081455_10010281
311 Ga0081455_10387802
312 Ga0081538_10000567
313 Ga0081538_10001244
314 Ga0081538_10152371
315 Ga0075428_100515430
316 Ga0075430_100033827
317 Ga0075430_100069379
318 Ga0075430_100742626
319 Ga0075430_101577449
320 Ga0075431_100420174
321 Ga0075431_100994905
322 Ga0075431_101399967
323 Ga0075433_11589329
324 Ga0075429_100221443
325 Ga0075429_100274767
326 Ga0111539_10001032
327 Ga0111539_10019265
328 Ga0111539_10062911
329 Ga0111539_10186082
330 Ga0105245_11134156
331 Ga0105245_11647506
332 Ga0114129_10494341
333 Ga0114129_10565926
334 Ga0114129_11059149
335 Ga0105243_12057447
336 Ga0105242_10534307
337 Ga0105248_10323443
338 Ga0157378_10263256
339 Ga0163162_10522325
340 Ga0157375_10132607
341 Ga0157375_10393321
342 Ga0163163_10045537
343 Ga0182008_10003614
344 Ga0157376_11881443
345 Ga0207684_10302695
346 Ga0207684_10448057
347 Ga0207654_11118443
348 Ga0207707_10001980
349 Ga0207707_10016754
350 Ga0207707_10112798
351 Ga0207707_10970172
352 Ga0207660_10000508
353 Ga0207660_10428743
354 Ga0207652_10001104
355 Ga0207646_10100412
356 Ga0207646_10394706
357 Ga0207694_11854990
358 Ga0207659_10196339
359 Ga0207644_10524541
360 Ga0207690_10759324
361 Ga0207711_10209922
362 Ga0207661_10154790
363 Ga0207661_10258740
364 Ga0207667_10928326
365 Ga0207651_10682649
366 Ga0207658_11271869
367 Ga0207683_10655556
368 Ga0207698_10061524
369 Ga0209974_10128607
370 Ga0207428_10014507
371 Ga0207428_10035035
372 Ga0207428_10244198
373 Ga0307410_10226037
374 Ga0307416_100998731
375 Ga0373937_0793747
376 Ga0395899_0288170
377 Ga0395898_0150156
378 Ga0395905_0124323
379 Ga0395901_0050732
380 Ga0436365_0265123
381 Ga0439465_0263482
382 Ga0451807_1782284
383 Ga0466967_0401099
384 Ga0495629_0225127
385 Ga0495662_0509513
386 Ga0495618_0056172
387 Ga0495658_0049634
388 Ga0495658_0176191
389 Ga0495658_0585442
390 Ga0495581_0261430
391 Ga0495604_0391221
392 Ga0495674_1107518
393 Ga0495676_0247133
394 Ga0495675_0245879
395 Ga0495614_0062456
396 Ga0496100_0299633
397 Ga0496101_0337280
398 Ga0496102_0038792
399 Ga0496102_1330436
400 Ga0496104_0486404
401 Ga0496105_0080039
402 Ga0496106_0884385
403 Ga0496108_0641605
404 Ga0496109_0013560
405 Ga0496110_0073441
406 Ga0496110_0275836
407 Ga0496110_0294700
408 Ga0496111_0072736
409 Ga0496111_0120726
410 Ga0496113_0006414
411 Ga0496114_0035043
412 Ga0496114_0720610
413 Ga0501031_0068019
414 Ga0501031_0109717
415 Ga0501031_0212899
416 Ga0501032_0057706
417 Ga0501032_0153004
418 Ga0501033_0019421
419 Ga0501033_0185182
420 Ga0501034_0017112
421 Ga0501034_0595414
422 Ga0501036_0013138
423 Ga0501036_0143079
424 Ga0501036_0190465
425 Ga0501037_0048486
426 Ga0501037_0276263
427 Ga0501037_0353481
428 Ga0501038_0063736
429 Ga0501038_0434886
430 Ga0501038_0774381
431 Ga0501039_0017525
432 Ga0501039_0308664
433 Ga0501039_0473677
434 Ga0501040_0006640
435 Ga0501040_0127849
436 Ga0501040_0358007
437 Ga0501040_0476129
438 Ga0501040_0734149
439 Ga0501040_0974858
440 Ga0501040_1358356
441 Ga0501041_0008059
442 Ga0501041_0110234
443 Ga0501041_0218906
444 Ga0501041_0237967
445 Ga0501041_0347819
446 Ga0501042_0008407
447 Ga0501042_0212295
448 Ga0501042_0449483
449 Ga0501042_0691713
450 Ga0501042_0824313
451 Ga0501043_0114950
452 Ga0501043_0354604
453 Ga0501046_0007247
454 Ga0501046_0081164
455 Ga0501046_0139498
456 Ga0501048_0010641
457 Ga0501048_0041008
458 Ga0501048_0536272
459 Ga0501068_0075561
460 Ga0501068_0155089
461 Ga0501068_0595246
462 Ga0501068_0665066
463 Ga0501069_0069481
464 Ga0501070_0285618
465 Ga0501070_0290377
466 Ga0501071_0091532
467 Ga0501071_0173971
468 Ga0501071_0183180
469 Ga0501071_0220256
470 Ga0501071_0222069
471 Ga0501072_0012168
472 Ga0501072_0071882
473 Ga0501072_0075286
474 Ga0501072_0132503
475 Ga0501072_0171496
476 Ga0501072_0335323
477 Ga0501072_0409831
478 Ga0501072_0822302
479 Ga0501073_1154538
480 Ga0501073_1266966
481 Ga0501074_0172808
482 Ga0501074_0181900
483 Ga0501074_0288090
484 Ga0501075_0009950
485 Ga0501075_0083684
486 Ga0501075_0121713
487 Ga0501075_0379570
488 Ga0501075_0416200
489 Ga0501075_1353705
490 Ga0501076_0065032
491 Ga0501076_0070261
492 Ga0501076_0141760
493 Ga0501076_0159351
494 Ga0501076_0277326
495 Ga0501077_0018797
496 Ga0501077_0031043
497 Ga0501077_0636184
498 Ga0501079_0027621
499 Ga0501079_0066348
500 Ga0501079_0111259
501 Ga0501080_0022600
502 Ga0501080_0795531
503 Ga0501081_0053222
504 Ga0501081_0109410
505 Ga0501081_0684997
506 Ga0501083_0037693
507 Ga0501035_0075023
508 Ga0501035_1131680
509 Ga0501044_0860471
510 Ga0501045_0014698
511 Ga0501045_0040861
512 Ga0501045_0059605
513 Ga0501045_0077313
514 nmdc:mga05p37_1321744_c1
515 nmdc:mga05p37_252855_c1
516 nmdc:mga0qj67_1299465_c1
517 nmdc:mga0qj67_176381_c1
518 nmdc:mga06r32_1615368_c1
519 nmdc:mga06r32_290489_c1
520 nmdc:mga06r32_368716_c1
521 nmdc:mga08y16_123842_c1
522 nmdc:mga08y16_174148_c1
523 nmdc:mga08y16_388062_c1
524 Ga0495612_0063773
525 Ga0495595_0049102
526 Ga0495619_0655894
527 Ga0501084_0048332
528 Ga0501084_0718167
529 Ga0501084_1013926
530 Ga0501082_0015867
531 Ga0501082_0021723
532 Ga0501082_0417537
533 Ga0501082_0456182
534 Ga0501082_0632932
535 Ga0530510_0009059
536 Ga0530510_0012551
537 Ga0530510_0033405
538 Ga0530510_0464193
539 Ga0530510_0550782
540 Ga0530510_1298505
541 2623590384
542 2809194983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvg-assembly2.cif.gz_B human cd53 0.4527 30 133
6wvg-assembly1.cif.gz_A human cd53 0.4525 30 133
6k4j-assembly1.cif.gz_A crystal structure of the the cd9 0.4265 24 115
5bkf-assembly1.cif.gz_E cyro-em structure of human glycine receptor alpha2-beta heteromer, glycine bound, desensitized state 0.4227 23 120
6grj-assembly1.cif.gz_I structure of the ahlb pore of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.4131 19 138
ID Description Score Start End Superfamily
af_Q8NCS4_7_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6631 27 131 1.20.120.550
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.6228 23 89 1.20.58.220
af_Q53FP2_11_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6116 31 133 1.20.120.550
af_P40030_21_129_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6057 27 116 3.40.605.10
af_Q9LSW5_1_134_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5986 26 136 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7J9YY96-F1-model_v4 DoxX family membrane protein 0.9226 19 141 GO:0016020
AF-A0A534TFL6-F1-model_v4 DoxX family membrane protein 0.9128 24 134
AF-A0A1Q9S6F3-F1-model_v4 DoxX family protein 0.8985 24 146 GO:0016020
AF-A0A534Q1W8-F1-model_v4 DoxX family protein 0.8939 27 145 GO:0016020
AF-A0A3N5KNZ4-F1-model_v4 DoxX family membrane protein 0.8797 19 127 GO:0016020

Map