F377972

General Info

Members Datasets Scaffolds Average Seq Length
271 195 542 162

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0063824|Ga0501080_0063824_1815_2369
Length 184
Sequence MCRPDCQHSFVAVRRLDAMAIEPGVRRIRFTTIDGEKKTLGDYADQTLLVVNVASRCGLTPQYTQLEELQKRYGDQGFTVIGFPCNQFLGQEPGSTDEIKEFCSTTYGVTFPLMEKTRVNGPFKHPLYAALTREPDAAGKAGKVSWNFEKFVIAPDGTVSRFRPKTKPDAPEVIAAIEQGLAQR

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
102 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
156 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
157 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
168 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
169 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
170 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
171 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
172 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
173 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
174 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
175 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
176 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
177 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
178 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
179 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
180 2919069694 Microbacterium sp. 1154 Isolate Unclassified
181 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
182 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
183 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
184 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
185 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
186 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
187 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
188 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
189 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
190 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
191 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
192 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
193 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
194 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
195 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.19
Metatranscriptomes 1.11
Isolates 10.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 15.5
Nodule 0
Rhizoplane 11.07
Rhizosphere 56.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0063824 3300049742 Bacteria 3427
2 Ga0006562J51391_1163932 3300003578 Bacteria 4840
3 Ga0055533_1000001 3300003756 Bacteria 1863437
4 Ga0055525_1000121 3300003759 Bacteria 119321
5 Ga0055541_1012818 3300003841 Bacteria 1193
6 Ga0070682_100439568 3300005337 Bacteria 996
7 Ga0070705_100553890 3300005440 Bacteria 882
8 Ga0070663_100010162 3300005455 Bacteria 5858
9 Ga0070663_100810507 3300005455 Bacteria 803
10 Ga0070685_10003770 3300005466 Bacteria 7664
11 Ga0070685_10014842 3300005466 Bacteria 4131
12 Ga0070686_100618961 3300005544 Bacteria 855
13 Ga0070665_100002079 3300005548 Bacteria 22462
14 Ga0070665_100433804 3300005548 Bacteria 1323
15 Ga0068856_101420538 3300005614 Bacteria 708
16 Ga0070702_100412731 3300005615 Bacteria 969
17 Ga0068859_100919092 3300005617 Bacteria 959
18 Ga0068864_102095520 3300005618 Bacteria 572
19 Ga0068863_100247837 3300005841 Bacteria 1720
20 Ga0068858_100890746 3300005842 Bacteria 870
21 Ga0075365_10081305 3300006038 Bacteria 2195
22 Ga0075365_10191984 3300006038 Bacteria 1429
23 Ga0075365_10500460 3300006038 Bacteria 859
24 Ga0075363_100218512 3300006048 Bacteria 1092
25 Ga0075364_10005297 3300006051 Bacteria 7487
26 Ga0075364_10063030 3300006051 Bacteria 2434
27 Ga0075364_10404975 3300006051 Bacteria 931
28 Ga0075369_10002918 3300006186 Bacteria 6169
29 Ga0075369_10070577 3300006186 Bacteria 1537
30 Ga0075370_10139666 3300006353 Bacteria 1416
31 Ga0075428_100679950 3300006844 Bacteria 1097
32 Ga0075431_100379069 3300006847 Bacteria 1419
33 Ga0075433_10301386 3300006852 Bacteria 1419
34 Ga0068865_100112621 3300006881 Bacteria 2010
35 Ga0097620_100919296 3300006931 Bacteria 959
36 Ga0105244_10265149 3300009036 Bacteria 799
37 Ga0111539_10394321 3300009094 Bacteria 1612
38 Ga0111539_10667777 3300009094 Bacteria 1210
39 Ga0105245_10068675 3300009098 Bacteria 3212
40 Ga0114129_10249284 3300009147 Bacteria 2385
41 Ga0105243_10131722 3300009148 Bacteria 2122
42 Ga0105243_10389026 3300009148 Bacteria 1292
43 Ga0105243_10703545 3300009148 Bacteria 985
44 Ga0105238_10995590 3300009551 Bacteria 859
45 Ga0157370_10519523 3300013104 Bacteria 1093
46 Ga0157369_10060973 3300013105 Bacteria 4067
47 Ga0157369_10348409 3300013105 Bacteria 1538
48 Ga0157369_11248982 3300013105 Bacteria 758
49 Ga0171462_1001 3300013250 Bacteria 1135406
50 Ga0157375_10350473 3300013308 Bacteria 1642
51 Ga0157375_12385308 3300013308 Bacteria 631
52 Ga0163163_10381554 3300014325 Bacteria 1467
53 Ga0157380_10039864 3300014326 Bacteria 3655
54 Ga0157380_10064723 3300014326 Bacteria 2936
55 Ga0157380_11473791 3300014326 Bacteria 733
56 Ga0157376_10218749 3300014969 Bacteria 1763
57 Ga0163161_10224716 3300017792 Bacteria 1455
58 Ga0206355_1629138 3300020076 Bacteria 662
59 Ga0206354_11599738 3300020081 Bacteria 2651
60 Ga0213876_10021797 3300021384 Bacteria 3388
61 Ga0209566_100065 3300025225 Bacteria 190999
62 Ga0209674_100001 3300025226 Bacteria 4013750
63 Ga0209563_100001 3300025230 Bacteria 4013775
64 Ga0209563_100201 3300025230 Bacteria 32234
65 Ga0209677_100001 3300025253 Bacteria 4013787
66 Ga0209677_101445 3300025253 Bacteria 10272
67 Ga0209455_1000600 3300025272 Bacteria 23017
68 Ga0207655_1143771 3300025728 Bacteria 762
69 Ga0207662_10421439 3300025918 Bacteria 908
70 Ga0207709_10056725 3300025935 Bacteria 2425
71 Ga0207709_10325732 3300025935 Bacteria 1152
72 Ga0207709_10494739 3300025935 Bacteria 953
73 Ga0207704_10049810 3300025938 Bacteria 2523
74 Ga0207661_11706172 3300025944 Bacteria 575
75 Ga0207677_10035270 3300026023 Bacteria 3247
76 Ga0207678_10014360 3300026067 Bacteria 6964
77 Ga0207708_10246002 3300026075 Bacteria 1440
78 Ga0207641_10160835 3300026088 Bacteria 2042
79 Ga0207648_10021662 3300026089 Bacteria 5774
80 Ga0207648_10759041 3300026089 Bacteria 901
81 Ga0207674_10223439 3300026116 Bacteria 1831
82 Ga0207675_100145667 3300026118 Bacteria 2252
83 Ga0207698_10101497 3300026142 Bacteria 2386
84 Ga0207428_10302691 3300027907 Bacteria 1183
85 Ga0268266_10000507 3300028379 Bacteria 55037
86 Ga0268266_11004853 3300028379 Bacteria 807
87 Ga0265336_10007112 3300028666 Bacteria 3997
88 Ga0265338_10002869 3300028800 Bacteria 25152
89 Ga0265338_10596544 3300028800 Bacteria 770
90 Ga0316181_1118691 3300030744 Bacteria 698
91 Ga0316576_10019856 3300031727 Bacteria 4610
92 Ga0316578_10064214 3300031728 Bacteria 2166
93 Ga0307405_10312320 3300031731 Bacteria 1197
94 Ga0307413_10252511 3300031824 Bacteria 1309
95 Ga0307413_10525315 3300031824 Bacteria 955
96 Ga0307410_10903087 3300031852 Bacteria 757
97 Ga0307406_10000123 3300031901 Bacteria 45640
98 Ga0307406_10067705 3300031901 Bacteria 2329
99 Ga0307406_10071865 3300031901 Bacteria 2269
100 Ga0307406_10468255 3300031901 Bacteria 1015
101 Ga0307407_10199183 3300031903 Bacteria 1341
102 Ga0307407_10277133 3300031903 Bacteria 1160
103 Ga0307412_10330346 3300031911 Bacteria 1217
104 Ga0307409_100776671 3300031995 Bacteria 964
105 Ga0307409_100890792 3300031995 Bacteria 903
106 Ga0307416_101514981 3300032002 Bacteria 776
107 Ga0307414_11088381 3300032004 Bacteria 738
108 Ga0307414_11517146 3300032004 Bacteria 624
109 Ga0307415_101097496 3300032126 Bacteria 745
110 Ga0316574_0089566 3300035398 Bacteria 1960
111 Ga0316582_0138743 3300036647 Bacteria 1638
112 Ga0316584_0590315 3300036712 Bacteria 771
113 Ga0395899_0002856 3300037312 Bacteria 13899
114 Ga0395900_0809617 3300037418 Bacteria 864
115 Ga0395898_0496498 3300037466 Bacteria 1161
116 Ga0395901_0381354 3300038443 Bacteria 1451
117 Ga0436365_0327860 3300039437 Bacteria 2749
118 Ga0436360_0837247 3300039438 Bacteria 679
119 Ga0436363_1566376 3300039450 Bacteria 568
120 Ga0451791_0093765 3300041451 Bacteria 583
121 Ga0451791_0252800 3300041451 Bacteria 1214
122 Ga0451791_0633932 3300041451 Bacteria 4493
123 Ga0451793_0186201 3300041452 Bacteria 733
124 Ga0451793_0655229 3300041452 Bacteria 4081
125 Ga0451793_1395209 3300041452 Bacteria 4357
126 Ga0451797_0210096 3300041453 Bacteria 3392
127 Ga0451795_0598596 3300041456 Bacteria 633
128 Ga0451807_0163925 3300041486 Bacteria 1350
129 Ga0451841_1014895 3300041498 Bacteria 2047
130 Ga0451851_1126569 3300041507 Bacteria 936
131 Ga0451843_0993431 3300041509 Bacteria 806
132 Ga0451843_1506221 3300041509 Bacteria 1249
133 Ga0451855_0280661 3300041511 Bacteria 851
134 Ga0451855_1284889 3300041511 Bacteria 770
135 Ga0451853_1287257 3300041512 Bacteria 752
136 Ga0451853_1319714 3300041512 Bacteria 686
137 Ga0451853_3950410 3300041512 Bacteria 854
138 Ga0439431_0114505 3300041997 Bacteria 749
139 Ga0450900_051968 3300042136 Bacteria 629
140 Ga0450901_025290 3300042533 Bacteria 646
141 Ga0466972_0012761 3300044658 Bacteria 4219
142 Ga0466965_0000015 3300044683 Bacteria 81629
143 Ga0466965_0195858 3300044683 Bacteria 1070
144 Ga0466966_0145821 3300044684 Bacteria 1445
145 Ga0466961_0322470 3300044693 Bacteria 942
146 Ga0466970_0006796 3300044765 Bacteria 5726
147 Ga0466957_0024109 3300044842 Bacteria 3601
148 Ga0466960_0038296 3300044901 Bacteria 2254
149 Ga0466960_0141453 3300044901 Bacteria 1279
150 Ga0466960_0156859 3300044901 Bacteria 1219
151 Ga0466959_0009433 3300045049 Bacteria 6940
152 Ga0466967_0012689 3300045976 Bacteria 6465
153 Ga0466967_0992905 3300045976 Bacteria 836
154 Ga0495590_0404933 3300046457 Bacteria 524
155 Ga0495651_0058959 3300046462 Bacteria 2945
156 Ga0495650_0000130 3300046471 Bacteria 175669
157 Ga0495664_0240654 3300046477 Bacteria 1095
158 Ga0495596_0362080 3300046500 Bacteria 565
159 Ga0495637_0134334 3300046520 Bacteria 943
160 Ga0495671_0110470 3300046692 Bacteria 1343
161 Ga0495672_0097214 3300047320 Bacteria 1604
162 Ga0495686_0011357 3300047472 Bacteria 6278
163 Ga0496100_0717464 3300048903 Bacteria 781
164 Ga0496102_0299289 3300048905 Bacteria 1516
165 Ga0496104_1367969 3300048907 Bacteria 611
166 Ga0496105_0036500 3300048908 Bacteria 4049
167 Ga0496105_1315624 3300048908 Bacteria 527
168 Ga0496108_0064097 3300048911 Bacteria 3095
169 Ga0496108_0353782 3300048911 Bacteria 1282
170 Ga0496108_0498519 3300048911 Bacteria 1063
171 Ga0496109_0042165 3300048912 Bacteria 4133
172 Ga0496109_0044656 3300048912 Bacteria 4020
173 Ga0496110_0027097 3300048913 Bacteria 4910
174 Ga0496110_0032425 3300048913 Bacteria 4512
175 Ga0496110_0999874 3300048913 Bacteria 744
176 Ga0496111_0091208 3300048914 Bacteria 2233
177 Ga0496111_0499483 3300048914 Bacteria 895
178 Ga0496113_0101112 3300048916 Bacteria 2235
179 Ga0496113_0157720 3300048916 Bacteria 1793
180 Ga0496114_0094903 3300048917 Bacteria 2538
181 Ga0496114_0183201 3300048917 Bacteria 1829
182 Ga0496114_0270246 3300048917 Bacteria 1498
183 Ga0496114_1082843 3300048917 Bacteria 686
184 Ga0496117_0000069 3300048920 Bacteria 246025
185 Ga0496117_0159440 3300048920 Bacteria 1324
186 Ga0496119_0000715 3300048922 Bacteria 44620
187 Ga0496119_0011315 3300048922 Bacteria 7409
188 Ga0496119_0027501 3300048922 Bacteria 3907
189 Ga0496120_0005253 3300048923 Bacteria 10405
190 Ga0496120_0020963 3300048923 Bacteria 4138
191 Ga0496120_0075116 3300048923 Bacteria 1845
192 Ga0496121_0000040 3300048924 Bacteria 348494
193 Ga0496122_0039003 3300048925 Bacteria 3794
194 Ga0496123_0006334 3300048926 Bacteria 11492
195 Ga0496124_0006665 3300048927 Bacteria 12523
196 Ga0496124_0184041 3300048927 Bacteria 1605
197 Ga0496125_0000061 3300048928 Bacteria 262739
198 Ga0496125_0003552 3300048928 Bacteria 18782
199 Ga0496126_0037729 3300048929 Bacteria 4505
200 Ga0496126_0050793 3300048929 Bacteria 3778
201 Ga0496126_0055146 3300048929 Bacteria 3597
202 Ga0496126_0514405 3300048929 Bacteria 955
203 Ga0501034_0318119 3300049571 Bacteria 1489
204 Ga0501034_0420148 3300049571 Bacteria 1258
205 Ga0501034_0774859 3300049571 Bacteria 853
206 Ga0501067_0114986 3300049583 Bacteria 1496
207 Ga0501070_0002165 3300049586 Bacteria 17254
208 Ga0501071_0249191 3300049587 Bacteria 1340
209 Ga0501072_0191399 3300049588 Bacteria 1631
210 Ga0501073_0000366 3300049589 Bacteria 30456
211 Ga0501074_0045727 3300049590 Bacteria 3166
212 Ga0501074_0612436 3300049590 Bacteria 770
213 Ga0501076_0454342 3300049592 Bacteria 1055
214 Ga0501080_0531907 3300049742 Bacteria 1048
215 nmdc:mga03n38_63686_c1 3300050490 Bacteria 1685
216 nmdc:mga00v17_221198_c1 3300050491 Bacteria 1226
217 nmdc:mga00v17_45581_c1 3300050491 Bacteria 2650
218 nmdc:mga0yw44_26212_c1 3300050492 Bacteria 3327
219 nmdc:mga0yw44_78335_c1 3300050492 Bacteria 2067
220 nmdc:mga06r32_621273_c1 3300050510 Bacteria 1050
221 nmdc:mga08y16_288677_c1 3300050511 Bacteria 1691
222 nmdc:mga0sz30_10688_c2 3300050516 Bacteria 2650
223 nmdc:mga0sz30_43102_c1 3300050516 Bacteria 1899
224 Ga0495595_0161919 3300053084 Bacteria 1104
225 Ga0500650_0025732 3300053098 Bacteria 2633
226 Ga0500555_042855 3300053103 Bacteria 1256
227 Ga0500556_0000001 3300053104 Bacteria 1135060
228 Ga0500556_0000204 3300053104 Bacteria 48558
229 Ga0500593_001484 3300053117 Bacteria 8442
230 Ga0500655_002071 3300053133 Bacteria 3729
231 Ga0500559_0000317 3300053136 Bacteria 36554
232 Ga0500568_0000016 3300053139 Bacteria 217194
233 Ga0500568_0000893 3300053139 Bacteria 20733
234 Ga0500573_0002405 3300053140 Bacteria 9340
235 Ga0500573_0004211 3300053140 Bacteria 7541
236 Ga0500573_0041562 3300053140 Bacteria 2654
237 Ga0500577_0013274 3300053142 Bacteria 2512
238 Ga0500577_0421757 3300053142 Bacteria 583
239 Ga0500616_0025335 3300053153 Bacteria 3291
240 Ga0501084_1115522 3300054114 Bacteria 662
241 Ga0501082_0184338 3300060353 Bacteria 1816
242 Ga0501082_0898406 3300060353 Bacteria 775
243 2723640144 2721755702 Bacteria 4373124
244 2758227392 2757320536 Bacteria 3629334
245 2774381282 2773857758 Bacteria 3592392
246 2774394727 2773857762 Bacteria 5971770
247 2808884139 2808606368 Bacteria 3174172
248 2812349178 2811994878 Bacteria 5992952
249 2839988075 2839986021 Bacteria 3685650
250 2870629533 2870628048 Bacteria 3696012
251 2891973111 2891968417 Bacteria 5821697
252 2904510803 2904509784 Bacteria 3520416
253 2908680419 2908678064 Bacteria 3482747
254 2909077037 2909074476 Bacteria 3436050
255 2919041823 2919039151 Bacteria 3391018
256 2919073144 2919069694 Bacteria 3622919
257 2928092275 2928090899 Bacteria 3158267
258 2932434264 2932431166 Bacteria 4215299
259 2935412538 2935409751 Bacteria 4179611
260 2964329640 2964326757 Bacteria 3290868
261 2974296108 2974294766 Bacteria 3767688
262 2974327628 2974324384 Bacteria 3750535
263 2977229216 2977228692 Bacteria 3450105
264 2977238746 2977236895 Bacteria 3569373
265 2977268002 2977264416 Bacteria 3750737
266 2984543470 2984542743 Bacteria 3569378
267 8016256346 8016254467 Bacteria 3797036
268 8045832391 8045830549 Bacteria 4444727
269 8046354198 8046352972 Bacteria 3613806
270 8055036067 8055034563 Bacteria 3562128
271 8055038447 8055037949 Bacteria 3337834
272 Ga0501080_0063824
273 Ga0006562J51391_1163932
274 Ga0055533_1000001
275 Ga0055525_1000121
276 Ga0055541_1012818
277 Ga0070682_100439568
278 Ga0070705_100553890
279 Ga0070663_100010162
280 Ga0070663_100810507
281 Ga0070685_10003770
282 Ga0070685_10014842
283 Ga0070686_100618961
284 Ga0070665_100002079
285 Ga0070665_100433804
286 Ga0068856_101420538
287 Ga0070702_100412731
288 Ga0068859_100919092
289 Ga0068864_102095520
290 Ga0068863_100247837
291 Ga0068858_100890746
292 Ga0075365_10081305
293 Ga0075365_10191984
294 Ga0075365_10500460
295 Ga0075363_100218512
296 Ga0075364_10005297
297 Ga0075364_10063030
298 Ga0075364_10404975
299 Ga0075369_10002918
300 Ga0075369_10070577
301 Ga0075370_10139666
302 Ga0075428_100679950
303 Ga0075431_100379069
304 Ga0075433_10301386
305 Ga0068865_100112621
306 Ga0097620_100919296
307 Ga0105244_10265149
308 Ga0111539_10394321
309 Ga0111539_10667777
310 Ga0105245_10068675
311 Ga0114129_10249284
312 Ga0105243_10131722
313 Ga0105243_10389026
314 Ga0105243_10703545
315 Ga0105238_10995590
316 Ga0157370_10519523
317 Ga0157369_10060973
318 Ga0157369_10348409
319 Ga0157369_11248982
320 Ga0171462_1001
321 Ga0157375_10350473
322 Ga0157375_12385308
323 Ga0163163_10381554
324 Ga0157380_10039864
325 Ga0157380_10064723
326 Ga0157380_11473791
327 Ga0157376_10218749
328 Ga0163161_10224716
329 Ga0206355_1629138
330 Ga0206354_11599738
331 Ga0213876_10021797
332 Ga0209566_100065
333 Ga0209674_100001
334 Ga0209563_100001
335 Ga0209563_100201
336 Ga0209677_100001
337 Ga0209677_101445
338 Ga0209455_1000600
339 Ga0207655_1143771
340 Ga0207662_10421439
341 Ga0207709_10056725
342 Ga0207709_10325732
343 Ga0207709_10494739
344 Ga0207704_10049810
345 Ga0207661_11706172
346 Ga0207677_10035270
347 Ga0207678_10014360
348 Ga0207708_10246002
349 Ga0207641_10160835
350 Ga0207648_10021662
351 Ga0207648_10759041
352 Ga0207674_10223439
353 Ga0207675_100145667
354 Ga0207698_10101497
355 Ga0207428_10302691
356 Ga0268266_10000507
357 Ga0268266_11004853
358 Ga0265336_10007112
359 Ga0265338_10002869
360 Ga0265338_10596544
361 Ga0316181_1118691
362 Ga0316576_10019856
363 Ga0316578_10064214
364 Ga0307405_10312320
365 Ga0307413_10252511
366 Ga0307413_10525315
367 Ga0307410_10903087
368 Ga0307406_10000123
369 Ga0307406_10067705
370 Ga0307406_10071865
371 Ga0307406_10468255
372 Ga0307407_10199183
373 Ga0307407_10277133
374 Ga0307412_10330346
375 Ga0307409_100776671
376 Ga0307409_100890792
377 Ga0307416_101514981
378 Ga0307414_11088381
379 Ga0307414_11517146
380 Ga0307415_101097496
381 Ga0316574_0089566
382 Ga0316582_0138743
383 Ga0316584_0590315
384 Ga0395899_0002856
385 Ga0395900_0809617
386 Ga0395898_0496498
387 Ga0395901_0381354
388 Ga0436365_0327860
389 Ga0436360_0837247
390 Ga0436363_1566376
391 Ga0451791_0093765
392 Ga0451791_0252800
393 Ga0451791_0633932
394 Ga0451793_0186201
395 Ga0451793_0655229
396 Ga0451793_1395209
397 Ga0451797_0210096
398 Ga0451795_0598596
399 Ga0451807_0163925
400 Ga0451841_1014895
401 Ga0451851_1126569
402 Ga0451843_0993431
403 Ga0451843_1506221
404 Ga0451855_0280661
405 Ga0451855_1284889
406 Ga0451853_1287257
407 Ga0451853_1319714
408 Ga0451853_3950410
409 Ga0439431_0114505
410 Ga0450900_051968
411 Ga0450901_025290
412 Ga0466972_0012761
413 Ga0466965_0000015
414 Ga0466965_0195858
415 Ga0466966_0145821
416 Ga0466961_0322470
417 Ga0466970_0006796
418 Ga0466957_0024109
419 Ga0466960_0038296
420 Ga0466960_0141453
421 Ga0466960_0156859
422 Ga0466959_0009433
423 Ga0466967_0012689
424 Ga0466967_0992905
425 Ga0495590_0404933
426 Ga0495651_0058959
427 Ga0495650_0000130
428 Ga0495664_0240654
429 Ga0495596_0362080
430 Ga0495637_0134334
431 Ga0495671_0110470
432 Ga0495672_0097214
433 Ga0495686_0011357
434 Ga0496100_0717464
435 Ga0496102_0299289
436 Ga0496104_1367969
437 Ga0496105_0036500
438 Ga0496105_1315624
439 Ga0496108_0064097
440 Ga0496108_0353782
441 Ga0496108_0498519
442 Ga0496109_0042165
443 Ga0496109_0044656
444 Ga0496110_0027097
445 Ga0496110_0032425
446 Ga0496110_0999874
447 Ga0496111_0091208
448 Ga0496111_0499483
449 Ga0496113_0101112
450 Ga0496113_0157720
451 Ga0496114_0094903
452 Ga0496114_0183201
453 Ga0496114_0270246
454 Ga0496114_1082843
455 Ga0496117_0000069
456 Ga0496117_0159440
457 Ga0496119_0000715
458 Ga0496119_0011315
459 Ga0496119_0027501
460 Ga0496120_0005253
461 Ga0496120_0020963
462 Ga0496120_0075116
463 Ga0496121_0000040
464 Ga0496122_0039003
465 Ga0496123_0006334
466 Ga0496124_0006665
467 Ga0496124_0184041
468 Ga0496125_0000061
469 Ga0496125_0003552
470 Ga0496126_0037729
471 Ga0496126_0050793
472 Ga0496126_0055146
473 Ga0496126_0514405
474 Ga0501034_0318119
475 Ga0501034_0420148
476 Ga0501034_0774859
477 Ga0501067_0114986
478 Ga0501070_0002165
479 Ga0501071_0249191
480 Ga0501072_0191399
481 Ga0501073_0000366
482 Ga0501074_0045727
483 Ga0501074_0612436
484 Ga0501076_0454342
485 Ga0501080_0531907
486 nmdc:mga03n38_63686_c1
487 nmdc:mga00v17_221198_c1
488 nmdc:mga00v17_45581_c1
489 nmdc:mga0yw44_26212_c1
490 nmdc:mga0yw44_78335_c1
491 nmdc:mga06r32_621273_c1
492 nmdc:mga08y16_288677_c1
493 nmdc:mga0sz30_10688_c2
494 nmdc:mga0sz30_43102_c1
495 Ga0495595_0161919
496 Ga0500650_0025732
497 Ga0500555_042855
498 Ga0500556_0000001
499 Ga0500556_0000204
500 Ga0500593_001484
501 Ga0500655_002071
502 Ga0500559_0000317
503 Ga0500568_0000016
504 Ga0500568_0000893
505 Ga0500573_0002405
506 Ga0500573_0004211
507 Ga0500573_0041562
508 Ga0500577_0013274
509 Ga0500577_0421757
510 Ga0500616_0025335
511 Ga0501084_1115522
512 Ga0501082_0184338
513 Ga0501082_0898406
514 2723640144
515 2758227392
516 2774381282
517 2774394727
518 2808884139
519 2812349178
520 2839988075
521 2870629533
522 2891973111
523 2904510803
524 2908680419
525 2909077037
526 2919041823
527 2919073144
528 2928092275
529 2932434264
530 2935412538
531 2964329640
532 2974296108
533 2974327628
534 2977229216
535 2977238746
536 2977268002
537 2984543470
538 8016256346
539 8045832391
540 8046354198
541 8055036067
542 8055038447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

25

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9201 8 167
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.919 8 165
7u4i-assembly1.cif.gz_A crystal structure of human gpx4-u46c-r152h in complex with cds9 0.9178 8 165
7l8m-assembly1.cif.gz_A crystal structure of human gpx4-u46c mutant k48l 0.9151 8 165
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.9099 8 166
ID Description Score Start End Superfamily
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9491 9 165 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9336 7 167 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9281 8 165 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9259 9 165 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9241 8 167 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A370FTJ2-F1-model_v4 Glutathione peroxidase 0.9907 9 167 GO:0004601
GO:0034599
AF-A0A1B9NGV2-F1-model_v4 Glutathione peroxidase 0.9906 7 166 GO:0004601
GO:0034599
AF-A0A4P7FJ29-F1-model_v4 deleted 0.9903 8 166
AF-A0A373DKW3-F1-model_v4 Glutathione peroxidase 0.9883 8 167 GO:0004601
GO:0034599
AF-A0A0B2A9C9-F1-model_v4 Glutathione peroxidase 0.9878 1 167 GO:0004601
GO:0034599

Map