F377960

General Info

Members Datasets Scaffolds Average Seq Length
271 194 247 345

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0020369|Ga0501047_0020369_164_1321
Length 385
Sequence MAMAMFLSFILPRLLPAASPMPIPSSMTHPVPIFDGHNDVLLRLMHKRGGGGDHEAGAKAFLEGTDKGHLDLPRARAGGFTGGLFAVFCPPIERSPGNDELMKESRYDIPLPPGLALTDAQQAAIAMIAGLFRIERSSKGAVRICRSAADIDRAGEAGALAAVLHIEGAEPIDADFRMLDILYQAGLRSIGPVWSRSNIFGHGVPFRFPSSPDTGPGLTDAGKALVRACNELKVLIDLSHLNEKGFWDVAKLSDAPLVASHSNAHAVSPHSRNLTDDQLRAVRDSGGLVGINYATSFLREDGRMNADTPLEQMVRHADHLIGILGADGVGLGSDFDGAVIPAAISDVAGLPRLVEAFRSAGYDEETIRKICRDNWVSVLRRTWGE

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
4 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
5 2773857925 Microvirga vignae BR3299 Isolate Unclassified
6 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
7 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
8 2818991467 Bosea vestrisii 3192 Isolate Unclassified
9 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
10 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
11 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
12 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
13 2876601092 Pantoea endophytica 596 Isolate Unclassified
14 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
15 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
16 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
17 2904504865 Serratia marcescens 1822 Isolate Unclassified
18 2909042592 Labrys sp. LIt4 Isolate Nodule
19 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
20 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
75 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
193 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
194 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.04
Metatranscriptomes 1.11
Isolates 8.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 3.32
Rhizoplane 4.43
Rhizosphere 75.28
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007977 3300002987 Bacteria 2964
2 JGI25151J46595_10000180 3300003187 Bacteria 79747
3 JGI25160J50197_1013981 3300003354 Bacteria 2707
4 Ga0058692_1000171 3300003856 Bacteria 40209
5 Ga0070658_10162371 3300005327 Bacteria 1875
6 Ga0070683_100044602 3300005329 Bacteria 4089
7 Ga0070683_100164926 3300005329 Bacteria 2102
8 Ga0070670_100017187 3300005331 Bacteria 6205
9 Ga0070680_100118647 3300005336 Bacteria 2207
10 Ga0070680_100242976 3300005336 Bacteria 1522
11 Ga0070682_100020088 3300005337 Bacteria 3927
12 Ga0070660_100032284 3300005339 Bacteria 3939
13 Ga0070660_100071670 3300005339 Bacteria 2706
14 Ga0070661_100088928 3300005344 Bacteria 2287
15 Ga0070659_100064810 3300005366 Bacteria 2892
16 Ga0070659_100075264 3300005366 Bacteria 2691
17 Ga0070714_100001982 3300005435 Bacteria 14961
18 Ga0070711_100120215 3300005439 Bacteria 1941
19 Ga0070681_10024721 3300005458 Bacteria 6043
20 Ga0070699_100000016 3300005518 Bacteria 206838
21 Ga0070679_100044217 3300005530 Bacteria 4438
22 Ga0070679_100075708 3300005530 Bacteria 3355
23 Ga0070684_100285393 3300005535 Bacteria 1513
24 Ga0070696_100037895 3300005546 Bacteria 3326
25 Ga0070665_100097087 3300005548 Bacteria 2951
26 Ga0068855_100017192 3300005563 Bacteria 8702
27 Ga0068855_100050746 3300005563 Bacteria 4888
28 Ga0068857_100072285 3300005577 Bacteria 3074
29 Ga0068856_100193875 3300005614 Bacteria 2046
30 Ga0068852_100142372 3300005616 Bacteria 2221
31 Ga0068852_100152296 3300005616 Bacteria 2151
32 Ga0081455_10000577 3300005937 Bacteria 47777
33 Ga0075365_10001573 3300006038 Bacteria 10476
34 Ga0075364_10019221 3300006051 Bacteria 4286
35 Ga0075367_10068657 3300006178 Bacteria 2127
36 Ga0075367_10083984 3300006178 Bacteria 1930
37 Ga0075428_100293966 3300006844 Bacteria 1747
38 Ga0075428_100497394 3300006844 Bacteria 1305
39 Ga0075430_100203052 3300006846 Bacteria 1645
40 Ga0075431_100005958 3300006847 Bacteria 12068
41 Ga0075431_100006080 3300006847 Bacteria 11966
42 Ga0075434_100028345 3300006871 Bacteria 5501
43 Ga0075434_100137524 3300006871 Bacteria 2462
44 Ga0075435_100070633 3300007076 Bacteria 2850
45 Ga0105251_10049891 3300009011 Bacteria 2001
46 Ga0105244_10000442 3300009036 Bacteria 37972
47 Ga0105244_10015627 3300009036 Bacteria 4348
48 Ga0105250_10000002 3300009092 Bacteria 566949
49 Ga0105240_10118044 3300009093 Bacteria 3198
50 Ga0111539_10233773 3300009094 Bacteria 2140
51 Ga0114129_10118277 3300009147 Bacteria 3650
52 Ga0105243_10059067 3300009148 Bacteria 3059
53 Ga0105237_10018945 3300009545 Bacteria 7112
54 Ga0105237_10268492 3300009545 Bacteria 1709
55 Ga0105238_10072890 3300009551 Bacteria 3429
56 Ga0105239_10047956 3300010375 Bacteria 4682
57 Ga0105246_10039225 3300011119 Bacteria 3189
58 Ga0105246_10116231 3300011119 Bacteria 1974
59 Ga0157373_10000189 3300013100 Bacteria 50406
60 Ga0157371_10011328 3300013102 Bacteria 6879
61 Ga0157370_10002482 3300013104 Bacteria 22240
62 Ga0157370_10294144 3300013104 Bacteria 1500
63 Ga0157370_10403170 3300013104 Bacteria 1259
64 Ga0157369_10111184 3300013105 Bacteria 2912
65 Ga0157369_10181898 3300013105 Bacteria 2212
66 Ga0157372_10239854 3300013307 Bacteria 2103
67 Ga0157372_10574738 3300013307 Bacteria 1314
68 Ga0163163_10042044 3300014325 Bacteria 4473
69 Ga0197907_10962241 3300020069 Bacteria 2068
70 Ga0206356_10002443 3300020070 Bacteria 4041
71 Ga0206354_11566463 3300020081 Bacteria 3199
72 Ga0214542_1001109 3300021321 Bacteria 53996
73 Ga0214543_1000091 3300021327 Bacteria 113539
74 Ga0209130_1000579 3300025284 Bacteria 35634
75 Ga0209025_1000422 3300025294 Bacteria 84434
76 Ga0209758_1008019 3300025297 Bacteria 6982
77 Ga0207426_1000133 3300025302 Bacteria 206783
78 Ga0207696_1000239 3300025711 Bacteria 75936
79 Ga0207696_1000506 3300025711 Bacteria 32549
80 Ga0207655_1000712 3300025728 Bacteria 38225
81 Ga0207655_1001807 3300025728 Bacteria 18519
82 Ga0207713_1011877 3300025735 Bacteria 4699
83 Ga0207688_10088406 3300025901 Bacteria 1777
84 Ga0207705_10075520 3300025909 Bacteria 2448
85 Ga0207705_10113291 3300025909 Bacteria 2006
86 Ga0207707_10022533 3300025912 Bacteria 5506
87 Ga0207707_10066999 3300025912 Bacteria 3127
88 Ga0207695_10095588 3300025913 Bacteria 2975
89 Ga0207671_10176723 3300025914 Bacteria 1660
90 Ga0207660_10014248 3300025917 Bacteria 5224
91 Ga0207660_10218217 3300025917 Bacteria 1496
92 Ga0207657_10005654 3300025919 Bacteria 13046
93 Ga0207657_10006980 3300025919 Bacteria 11629
94 Ga0207657_10204014 3300025919 Bacteria 1589
95 Ga0207657_10341674 3300025919 Bacteria 1181
96 Ga0207649_10183619 3300025920 Bacteria 1466
97 Ga0207652_10010091 3300025921 Bacteria 7608
98 Ga0207652_10209337 3300025921 Bacteria 1756
99 Ga0207694_10046996 3300025924 Bacteria 3338
100 Ga0207650_10131597 3300025925 Bacteria 1958
101 Ga0207664_10001610 3300025929 Bacteria 14838
102 Ga0207679_10358064 3300025945 Bacteria 1274
103 Ga0207667_10026543 3300025949 Bacteria 6324
104 Ga0207667_10106529 3300025949 Bacteria 2891
105 Ga0207667_10125900 3300025949 Bacteria 2639
106 Ga0207678_10169447 3300026067 Bacteria 1864
107 Ga0207702_10149807 3300026078 Bacteria 2121
108 Ga0207674_10053403 3300026116 Bacteria 4119
109 Ga0209371_1000417 3300027312 Bacteria 43898
110 Ga0268266_10002132 3300028379 Bacteria 21813
111 Ga0307515_10000386 3300028794 Bacteria 107196
112 Ga0268256_1000202 3300030500 Bacteria 67837
113 Ga0265325_10043880 3300031241 Bacteria 2331
114 Ga0307513_10281812 3300031456 Bacteria 1439
115 Ga0316576_10103552 3300031727 Bacteria 2129
116 Ga0307516_10170426 3300031730 Bacteria 1918
117 Ga0307413_10118327 3300031824 Bacteria 1789
118 Ga0307410_10075469 3300031852 Bacteria 2350
119 Ga0307410_10088286 3300031852 Bacteria 2195
120 Ga0307407_10043744 3300031903 Bacteria 2520
121 Ga0307407_10110724 3300031903 Bacteria 1723
122 Ga0307412_10220767 3300031911 Bacteria 1453
123 Ga0307409_100248173 3300031995 Bacteria 1625
124 Ga0307416_100116181 3300032002 Bacteria 2371
125 Ga0307416_100229345 3300032002 Bacteria 1789
126 Ga0307414_10063689 3300032004 Bacteria 2622
127 Ga0307415_100057819 3300032126 Bacteria 2667
128 Ga0373927_0054309 3300035695 Bacteria 2591
129 Ga0316582_0158494 3300036647 Bacteria 1532
130 Ga0316584_0022817 3300036712 Bacteria 4567
131 Ga0395905_0249696 3300037471 Bacteria 1657
132 Ga0395901_0026066 3300038443 Bacteria 6002
133 Ga0395901_0046293 3300038443 Bacteria 4518
134 Ga0400483_088040 3300039062 Unclassified 4466
135 Ga0400483_171296 3300039062 Bacteria 1936
136 Ga0400483_249130 3300039062 Bacteria 20216
137 Ga0451791_1710580 3300041451 Bacteria 1159
138 Ga0466966_0180401 3300044684 Bacteria 1281
139 Ga0466961_0063062 3300044693 Bacteria 2355
140 Ga0466963_0015233 3300044694 Bacteria 4757
141 Ga0466963_0093267 3300044694 Bacteria 2052
142 Ga0466968_0027108 3300044735 Bacteria 2356
143 Ga0466960_0056814 3300044901 Bacteria 1907
144 Ga0466959_0032512 3300045049 Bacteria 3862
145 Ga0466958_0181083 3300045836 Bacteria 1337
146 Ga0466967_0065011 3300045976 Bacteria 3246
147 Ga0466967_0488027 3300045976 Bacteria 1208
148 Ga0495617_003656 3300046452 Bacteria 5734
149 Ga0495591_000111 3300046458 Bacteria 93733
150 Ga0495610_0011125 3300046512 Bacteria 5525
151 Ga0495616_0101371 3300046513 Bacteria 1350
152 Ga0495654_0000250 3300046530 Bacteria 49614
153 Ga0495686_0085198 3300047472 Bacteria 1925
154 Ga0496100_0256961 3300048903 Bacteria 1294
155 Ga0496101_0000164 3300048904 Bacteria 56560
156 Ga0496102_0396974 3300048905 Bacteria 1297
157 Ga0496104_0001908 3300048907 Bacteria 18063
158 Ga0496108_0004168 3300048911 Bacteria 11637
159 Ga0496109_0006039 3300048912 Bacteria 10176
160 Ga0496110_0002277 3300048913 Bacteria 14343
161 Ga0496110_0158943 3300048913 Bacteria 2048
162 Ga0496111_0044176 3300048914 Bacteria 3203
163 Ga0496112_0036037 3300048915 Bacteria 4823
164 Ga0496113_0086165 3300048916 Bacteria 2413
165 Ga0496117_0031967 3300048920 Bacteria 4009
166 Ga0496118_0057073 3300048921 Bacteria 2930
167 Ga0496120_0001859 3300048923 Bacteria 23494
168 Ga0496122_0003775 3300048925 Bacteria 19529
169 Ga0496122_0046034 3300048925 Bacteria 3384
170 Ga0496123_0002476 3300048926 Bacteria 22795
171 Ga0496123_0025144 3300048926 Bacteria 4499
172 Ga0496124_0008929 3300048927 Bacteria 10387
173 Ga0496125_0068452 3300048928 Bacteria 2793
174 Ga0496126_0055174 3300048929 Bacteria 3596
175 Ga0496126_0487118 3300048929 Bacteria 987
176 Ga0501031_0014111 3300049568 Bacteria 5199
177 Ga0501032_0000001 3300049569 Bacteria 422097
178 Ga0501032_0003313 3300049569 Bacteria 12388
179 Ga0501033_0000198 3300049570 Bacteria 57365
180 Ga0501033_0000509 3300049570 Bacteria 36587
181 Ga0501033_0162617 3300049570 Bacteria 1606
182 Ga0501034_0000036 3300049571 Bacteria 239274
183 Ga0501034_0070812 3300049571 Bacteria 3498
184 Ga0501036_0000046 3300049572 Bacteria 76444
185 Ga0501036_0169471 3300049572 Bacteria 1840
186 Ga0501037_0000017 3300049573 Bacteria 157276
187 Ga0501037_0000253 3300049573 Bacteria 45817
188 Ga0501038_0000153 3300049574 Bacteria 59196
189 Ga0501038_0258856 3300049574 Bacteria 1376
190 Ga0501039_0000011 3300049575 Bacteria 245124
191 Ga0501039_0036908 3300049575 Bacteria 3771
192 Ga0501040_0201690 3300049576 Unclassified 1412
193 Ga0501041_0043224 3300049577 Unclassified 2739
194 Ga0501042_0153428 3300049578 Unclassified 1661
195 Ga0501043_0000016 3300049579 Bacteria 170869
196 Ga0501043_0000100 3300049579 Bacteria 79167
197 Ga0501043_0111726 3300049579 Bacteria 2146
198 Ga0501047_0020369 3300049581 Bacteria 6370
199 Ga0501047_0257687 3300049581 Bacteria 1592
200 Ga0501067_0058339 3300049583 Bacteria 2138
201 Ga0501068_0225805 3300049584 Bacteria 1190
202 Ga0501069_0000020 3300049585 Bacteria 122595
203 Ga0501069_0001304 3300049585 Bacteria 12231
204 Ga0501070_0000193 3300049586 Bacteria 57357
205 Ga0501070_0000595 3300049586 Bacteria 32980
206 Ga0501070_0005381 3300049586 Bacteria 10920
207 Ga0501070_0160008 3300049586 Bacteria 1857
208 Ga0501074_0000063 3300049590 Bacteria 51162
209 Ga0501074_0071697 3300049590 Bacteria 2490
210 Ga0501074_0116053 3300049590 Bacteria 1915
211 Ga0501076_0033997 3300049592 Unclassified 3982
212 Ga0501077_0061097 3300049593 Bacteria 2391
213 Ga0501079_0013928 3300049741 Bacteria 6134
214 Ga0501080_0013423 3300049742 Bacteria 7536
215 Ga0501080_0028111 3300049742 Bacteria 5229
216 Ga0501080_0030360 3300049742 Bacteria 5035
217 Ga0501080_0031668 3300049742 Bacteria 4928
218 Ga0501081_0052738 3300049743 Unclassified 2807
219 Ga0501083_0000205 3300049744 Bacteria 38186
220 Ga0501083_0144032 3300049744 Bacteria 1560
221 Ga0501035_0000028 3300049822 Bacteria 179195
222 Ga0501035_0000070 3300049822 Bacteria 127442
223 Ga0501035_0001992 3300049822 Bacteria 20414
224 Ga0501035_0029394 3300049822 Bacteria 5011
225 Ga0501035_0059552 3300049822 Bacteria 3401
226 Ga0501035_0072015 3300049822 Bacteria 3059
227 Ga0501044_0000037 3300049823 Bacteria 161924
228 Ga0501044_0003716 3300049823 Bacteria 17148
229 Ga0501044_0016707 3300049823 Bacteria 7879
230 Ga0501044_0095055 3300049823 Bacteria 3004
231 Ga0501044_0258449 3300049823 Bacteria 1680
232 Ga0501044_0272924 3300049823 Bacteria 1626
233 Ga0501044_0411030 3300049823 Bacteria 1264
234 nmdc:mga0yw44_29594_c1 3300050492 Bacteria 3163
235 nmdc:mga06z11_9606_c1 3300050494 Bacteria 4082
236 nmdc:mga07m45_13973_c1 3300050496 Bacteria 4268
237 nmdc:mga05p37_166211_c1 3300050507 Bacteria 2692
238 nmdc:mga05p37_38042_c1 3300050507 Bacteria 3907
239 nmdc:mga0n895_104908_c1 3300050512 Bacteria 2839
240 nmdc:mga0n895_71687_c1 3300050512 Bacteria 3436
241 nmdc:mga0rr50_290193_c1 3300050513 Bacteria 1367
242 Ga0500555_003376 3300053103 Bacteria 4553
243 Ga0500568_0036957 3300053139 Bacteria 1984
244 Ga0500568_0074927 3300053139 Bacteria 1291
245 Ga0501084_0001895 3300054114 Bacteria 16698
246 Ga0501082_0044314 3300060353 Bacteria 3837
247 Ga0530510_0026346 3300061734 Bacteria 4161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025917 Ga0207660_10014248 Ga0207660_100142484 293
2 3300041451 Ga0451791_1710580 Ga0451791_1710580_29_925 296
3 3300044901 Ga0466960_0056814 Ga0466960_0056814_169_1302 302
4 3300048905 Ga0496102_0396974 Ga0496102_0396974_38_967 302
5 3300048929 Ga0496126_0487118 Ga0496126_0487118_45_974 302
6 3300009093 Ga0105240_10118044 Ga0105240_101180443 304
7 3300044693 Ga0466961_0063062 Ga0466961_0063062_946_1884 305
8 3300044735 Ga0466968_0027108 Ga0466968_0027108_913_1851 305
9 3300045049 Ga0466959_0032512 Ga0466959_0032512_331_1269 305
10 3300045836 Ga0466958_0181083 Ga0466958_0181083_135_1073 305
11 3300044684 Ga0466966_0180401 Ga0466966_0180401_211_1179 311
12 3300048925 Ga0496122_0003775 Ga0496122_0003775_10662_11717 313
13 3300048926 Ga0496123_0025144 Ga0496123_0025144_2841_3896 313
14 3300048928 Ga0496125_0068452 Ga0496125_0068452_1582_2637 313
15 3300005327 Ga0070658_10162371 Ga0070658_101623713 314
16 3300005329 Ga0070683_100164926 Ga0070683_1001649262 314
17 3300005336 Ga0070680_100242976 Ga0070680_1002429762 314
18 3300005337 Ga0070682_100020088 Ga0070682_1000200883 314
19 3300005339 Ga0070660_100032284 Ga0070660_1000322844 314
20 3300005339 Ga0070660_100071670 Ga0070660_1000716703 314
21 3300005344 Ga0070661_100088928 Ga0070661_1000889282 314
22 3300005366 Ga0070659_100075264 Ga0070659_1000752642 314
23 3300005458 Ga0070681_10024721 Ga0070681_100247212 314
24 3300005530 Ga0070679_100044217 Ga0070679_1000442172 314
25 3300005530 Ga0070679_100075708 Ga0070679_1000757083 314
26 3300005535 Ga0070684_100285393 Ga0070684_1002853932 314
27 3300005546 Ga0070696_100037895 Ga0070696_1000378954 314
28 3300005563 Ga0068855_100017192 Ga0068855_1000171927 314
29 3300005563 Ga0068855_100050746 Ga0068855_1000507462 314
30 3300009545 Ga0105237_10018945 Ga0105237_100189453 314
31 3300013104 Ga0157370_10294144 Ga0157370_102941442 314
32 3300013105 Ga0157369_10111184 Ga0157369_101111843 314
33 3300013307 Ga0157372_10574738 Ga0157372_105747382 314
34 3300020069 Ga0197907_10962241 Ga0197907_109622412 314
35 3300020070 Ga0206356_10002443 Ga0206356_100024434 314
36 3300020081 Ga0206354_11566463 Ga0206354_115664634 314
37 3300025909 Ga0207705_10075520 Ga0207705_100755202 314
38 3300025912 Ga0207707_10022533 Ga0207707_100225334 314
39 3300025917 Ga0207660_10218217 Ga0207660_102182171 314
40 3300025919 Ga0207657_10005654 Ga0207657_100056545 314
41 3300025919 Ga0207657_10204014 Ga0207657_102040141 314
42 3300025920 Ga0207649_10183619 Ga0207649_101836192 314
43 3300025921 Ga0207652_10209337 Ga0207652_102093372 314
44 3300025924 Ga0207694_10046996 Ga0207694_100469964 314
45 3300025949 Ga0207667_10026543 Ga0207667_100265438 314
46 3300025949 Ga0207667_10106529 Ga0207667_101065293 314
47 3300044694 Ga0466963_0093267 Ga0466963_0093267_429_1394 314
48 3300049583 Ga0501067_0058339 Ga0501067_0058339_847_1812 314
49 3300005329 Ga0070683_100044602 Ga0070683_1000446023 315
50 3300005366 Ga0070659_100064810 Ga0070659_1000648103 315
51 3300005577 Ga0068857_100072285 Ga0068857_1000722852 315
52 3300009545 Ga0105237_10268492 Ga0105237_102684923 315
53 3300010375 Ga0105239_10047956 Ga0105239_100479564 315
54 3300013105 Ga0157369_10181898 Ga0157369_101818982 315
55 3300013307 Ga0157372_10239854 Ga0157372_102398542 315
56 3300025912 Ga0207707_10066999 Ga0207707_100669992 315
57 3300025914 Ga0207671_10176723 Ga0207671_101767232 315
58 3300025919 Ga0207657_10341674 Ga0207657_103416741 315
59 3300025921 Ga0207652_10010091 Ga0207652_100100912 315
60 3300026067 Ga0207678_10169447 Ga0207678_101694472 315
61 3300026116 Ga0207674_10053403 Ga0207674_100534033 315
62 3300044694 Ga0466963_0015233 Ga0466963_0015233_1491_2459 315
63 3300005548 Ga0070665_100097087 Ga0070665_1000970873 316
64 3300025913 Ga0207695_10095588 Ga0207695_100955883 316
65 3300025919 Ga0207657_10006980 Ga0207657_100069806 316
66 3300025945 Ga0207679_10358064 Ga0207679_103580642 316
67 3300045976 Ga0466967_0065011 Ga0466967_0065011_1095_2126 322
68 3300048912 Ga0496109_0006039 Ga0496109_0006039_4819_5856 324
69 3300049579 Ga0501043_0111726 Ga0501043_0111726_896_1960 328
70 3300049569 Ga0501032_0000001 Ga0501032_0000001_273713_274753 329
71 3300049570 Ga0501033_0000198 Ga0501033_0000198_31680_32720 329
72 3300049571 Ga0501034_0000036 Ga0501034_0000036_146356_147396 329
73 3300049572 Ga0501036_0000046 Ga0501036_0000046_29176_30216 329
74 3300049573 Ga0501037_0000017 Ga0501037_0000017_17904_18944 329
75 3300049574 Ga0501038_0000153 Ga0501038_0000153_44881_45921 329
76 3300049575 Ga0501039_0000011 Ga0501039_0000011_148805_149845 329
77 3300049579 Ga0501043_0000016 Ga0501043_0000016_69426_70466 329
78 3300049581 Ga0501047_0257687 Ga0501047_0257687_306_1346 329
79 3300049822 Ga0501035_0000028 Ga0501035_0000028_146482_147522 329
80 3300049823 Ga0501044_0003716 Ga0501044_0003716_8851_9891 329
81 3300050494 nmdc:mga06z11_9606_c1 nmdc:mga06z11_9606_c1_2656_3735 332
82 3300050496 nmdc:mga07m45_13973_c1 nmdc:mga07m45_13973_c1_2674_3753 332
83 3300006038 Ga0075365_10001573 Ga0075365_100015739 333
84 3300006051 Ga0075364_10019221 Ga0075364_100192216 333
85 3300006178 Ga0075367_10083984 Ga0075367_100839842 333
86 3300009094 Ga0111539_10233773 Ga0111539_102337733 333
87 3300050492 nmdc:mga0yw44_29594_c1 nmdc:mga0yw44_29594_c1_1642_2721 333
88 3300006844 Ga0075428_100497394 Ga0075428_1004973941 334
89 3300006846 Ga0075430_100203052 Ga0075430_1002030522 334
90 3300050507 nmdc:mga05p37_166211_c1 nmdc:mga05p37_166211_c1_1038_2084 334
91 3300006178 Ga0075367_10068657 Ga0075367_100686573 335
92 3300035695 Ga0373927_0054309 Ga0373927_0054309_38_1084 335
93 iso_pu_bacteria 2508501114 2509076500 335
94 3300009148 Ga0105243_10059067 Ga0105243_100590674 336
95 3300011119 Ga0105246_10116231 Ga0105246_101162312 336
96 3300031903 Ga0307407_10110724 Ga0307407_101107241 339
97 3300031911 Ga0307412_10220767 Ga0307412_102207672 339
98 3300031995 Ga0307409_100248173 Ga0307409_1002481732 339
99 3300032004 Ga0307414_10063689 Ga0307414_100636892 339
100 3300032126 Ga0307415_100057819 Ga0307415_1000578192 339
101 3300005435 Ga0070714_100001982 Ga0070714_1000019827 340
102 3300005937 Ga0081455_10000577 Ga0081455_1000057737 340
103 3300025929 Ga0207664_10001610 Ga0207664_100016107 340
104 3300053139 Ga0500568_0036957 Ga0500568_0036957_499_1527 340
105 iso_pu_bacteria 2511231025 2511380875 340
106 iso_pu_bacteria 2511231035 2511437648 340
107 iso_pu_bacteria 2876601092 2876601758 340
108 iso_pu_bacteria 8016733728 8016733965 340
109 iso_pu_bacteria 8019499862 8019504546 340
110 3300005518 Ga0070699_100000016 Ga0070699_100000016178 341
111 3300021321 Ga0214542_1001109 Ga0214542_100110955 341
112 3300021327 Ga0214543_1000091 Ga0214543_100009119 341
113 3300003856 Ga0058692_1000171 Ga0058692_10001712 342
114 3300005331 Ga0070670_100017187 Ga0070670_1000171873 342
115 3300009011 Ga0105251_10049891 Ga0105251_100498912 342
116 3300009036 Ga0105244_10015627 Ga0105244_100156274 342
117 3300011119 Ga0105246_10039225 Ga0105246_100392252 342
118 3300013100 Ga0157373_10000189 Ga0157373_1000018942 342
119 3300013102 Ga0157371_10011328 Ga0157371_100113285 342
120 3300025711 Ga0207696_1000506 Ga0207696_10005062 342
121 3300025728 Ga0207655_1001807 Ga0207655_10018074 342
122 3300025735 Ga0207713_1011877 Ga0207713_10118773 342
123 3300027312 Ga0209371_1000417 Ga0209371_100041740 342
124 3300030500 Ga0268256_1000202 Ga0268256_100020221 342
125 3300031456 Ga0307513_10281812 Ga0307513_102818121 342
126 3300046452 Ga0495617_003656 Ga0495617_003656_2048_3118 342
127 3300046458 Ga0495591_000111 Ga0495591_000111_50683_51753 342
128 3300046530 Ga0495654_0000250 Ga0495654_0000250_4693_5763 342
129 3300048903 Ga0496100_0256961 Ga0496100_0256961_207_1277 342
130 3300048904 Ga0496101_0000164 Ga0496101_0000164_12387_13457 342
131 3300048920 Ga0496117_0031967 Ga0496117_0031967_1178_2248 342
132 3300048921 Ga0496118_0057073 Ga0496118_0057073_419_1489 342
133 3300048923 Ga0496120_0001859 Ga0496120_0001859_19318_20388 342
134 3300048925 Ga0496122_0046034 Ga0496122_0046034_1665_2735 342
135 3300048926 Ga0496123_0002476 Ga0496123_0002476_21076_22146 342
136 3300048927 Ga0496124_0008929 Ga0496124_0008929_2469_3524 342
137 3300048929 Ga0496126_0055174 Ga0496126_0055174_2218_3327 342
138 iso_pu_bacteria 3000017691 3000018672 342
139 3300028794 Ga0307515_10000386 Ga0307515_1000038615 343
140 3300031730 Ga0307516_10170426 Ga0307516_101704262 343
141 iso_pu_bacteria 2775506901 2776258385 343
142 3300039062 Ga0400483_088040 Ga0400483_088040_2143_3204 344
143 3300038443 Ga0395901_0046293 Ga0395901_0046293_2442_3482 345
144 3300053103 Ga0500555_003376 Ga0500555_003376_2688_3731 345
145 iso_pu_bacteria 2919679072 2919682633 345
146 3300005439 Ga0070711_100120215 Ga0070711_1001202152 346
147 3300006847 Ga0075431_100005958 Ga0075431_1000059583 346
148 3300006871 Ga0075434_100137524 Ga0075434_1001375242 346
149 3300007076 Ga0075435_100070633 Ga0075435_1000706332 346
150 3300009036 Ga0105244_10000442 Ga0105244_1000044234 346
151 3300025728 Ga0207655_1000712 Ga0207655_10007122 346
152 3300031241 Ga0265325_10043880 Ga0265325_100438801 346
153 3300031727 Ga0316576_10103552 Ga0316576_101035522 346
154 3300036647 Ga0316582_0158494 Ga0316582_0158494_219_1277 346
155 3300036712 Ga0316584_0022817 Ga0316584_0022817_2538_3596 346
156 3300048907 Ga0496104_0001908 Ga0496104_0001908_10958_12004 346
157 3300048911 Ga0496108_0004168 Ga0496108_0004168_1139_2185 346
158 3300048913 Ga0496110_0002277 Ga0496110_0002277_10478_11524 346
159 3300048914 Ga0496111_0044176 Ga0496111_0044176_640_1686 346
160 3300048915 Ga0496112_0036037 Ga0496112_0036037_1298_2344 346
161 3300048916 Ga0496113_0086165 Ga0496113_0086165_46_1092 346
162 3300049571 Ga0501034_0070812 Ga0501034_0070812_101_1147 346
163 3300049823 Ga0501044_0095055 Ga0501044_0095055_565_1611 346
164 3300050512 nmdc:mga0n895_71687_c1 nmdc:mga0n895_71687_c1_1633_2679 346
165 3300050513 nmdc:mga0rr50_290193_c1 nmdc:mga0rr50_290193_c1_208_1254 346
166 iso_pu_bacteria 2818991467 2819721458 346
167 iso_pu_bacteria 8054002106 8054008646 346
168 3300006871 Ga0075434_100028345 Ga0075434_1000283455 347
169 3300025901 Ga0207688_10088406 Ga0207688_100884061 347
170 3300025925 Ga0207650_10131597 Ga0207650_101315971 347
171 3300037471 Ga0395905_0249696 Ga0395905_0249696_578_1627 347
172 3300045976 Ga0466967_0488027 Ga0466967_0488027_109_1158 347
173 3300047472 Ga0495686_0085198 Ga0495686_0085198_112_1161 347
174 3300050512 nmdc:mga0n895_104908_c1 nmdc:mga0n895_104908_c1_444_1541 347
175 iso_pu_bacteria 2854681122 2854682372 347
176 3300039062 Ga0400483_171296 Ga0400483_171296_817_1881 348
177 3300038443 Ga0395901_0026066 Ga0395901_0026066_189_1247 349
178 iso_pu_bacteria 2508501050 2508727657 349
179 iso_pu_bacteria 2508501114 2509077359 349
180 iso_pu_bacteria 2773857925 2774869157 349
181 iso_pu_bacteria 2821443989 2821446856 349
182 iso_pu_bacteria 2835312727 2835317459 349
183 iso_pu_bacteria 2882456835 2882457613 349
184 iso_pu_bacteria 2884298095 2884301218 349
185 iso_pu_bacteria 2894232714 2894236162 349
186 3300005336 Ga0070680_100118647 Ga0070680_1001186473 350
187 3300005614 Ga0068856_100193875 Ga0068856_1001938752 350
188 3300005616 Ga0068852_100142372 Ga0068852_1001423723 350
189 3300005616 Ga0068852_100152296 Ga0068852_1001522962 350
190 3300006847 Ga0075431_100006080 Ga0075431_1000060801 350
191 3300009147 Ga0114129_10118277 Ga0114129_101182777 350
192 3300025909 Ga0207705_10113291 Ga0207705_101132913 350
193 3300025949 Ga0207667_10125900 Ga0207667_101259003 350
194 3300026078 Ga0207702_10149807 Ga0207702_101498072 350
195 3300049575 Ga0501039_0036908 Ga0501039_0036908_730_1791 350
196 3300049576 Ga0501040_0201690 Ga0501040_0201690_201_1262 350
197 3300049577 Ga0501041_0043224 Ga0501041_0043224_107_1168 350
198 3300049578 Ga0501042_0153428 Ga0501042_0153428_234_1295 350
199 3300049592 Ga0501076_0033997 Ga0501076_0033997_2498_3559 350
200 3300049593 Ga0501077_0061097 Ga0501077_0061097_943_2004 350
201 3300049741 Ga0501079_0013928 Ga0501079_0013928_2645_3706 350
202 3300049743 Ga0501081_0052738 Ga0501081_0052738_104_1165 350
203 3300050507 nmdc:mga05p37_38042_c1 nmdc:mga05p37_38042_c1_2527_3588 350
204 3300054114 Ga0501084_0001895 Ga0501084_0001895_9514_10575 350
205 3300060353 Ga0501082_0044314 Ga0501082_0044314_29_1090 350
206 3300061734 Ga0530510_0026346 Ga0530510_0026346_2973_4034 350
207 iso_pu_bacteria 2844533157 2844535587 350
208 3300009092 Ga0105250_10000002 Ga0105250_10000002101 351
209 3300009551 Ga0105238_10072890 Ga0105238_100728904 351
210 3300013104 Ga0157370_10002482 Ga0157370_100024828 351
211 3300014325 Ga0163163_10042044 Ga0163163_100420443 351
212 3300025711 Ga0207696_1000239 Ga0207696_100023914 351
213 3300028379 Ga0268266_10002132 Ga0268266_100021327 351
214 3300032002 Ga0307416_100229345 Ga0307416_1002293452 351
215 3300046513 Ga0495616_0101371 Ga0495616_0101371_113_1174 351
216 3300048913 Ga0496110_0158943 Ga0496110_0158943_743_1804 351
217 iso_pu_bacteria 2904504865 2904508683 351
218 3300006844 Ga0075428_100293966 Ga0075428_1002939661 352
219 3300013104 Ga0157370_10403170 Ga0157370_104031701 352
220 3300039062 Ga0400483_249130 Ga0400483_249130_9405_10469 352
221 3300049568 Ga0501031_0014111 Ga0501031_0014111_3796_4863 352
222 3300049569 Ga0501032_0003313 Ga0501032_0003313_10669_11736 352
223 3300049570 Ga0501033_0000509 Ga0501033_0000509_4784_5851 352
224 3300049573 Ga0501037_0000253 Ga0501037_0000253_37780_38847 352
225 3300049574 Ga0501038_0258856 Ga0501038_0258856_61_1128 352
226 3300049579 Ga0501043_0000100 Ga0501043_0000100_23106_24173 352
227 3300049584 Ga0501068_0225805 Ga0501068_0225805_107_1174 352
228 3300049585 Ga0501069_0000020 Ga0501069_0000020_83890_84957 352
229 3300049586 Ga0501070_0000193 Ga0501070_0000193_47366_48433 352
230 3300049586 Ga0501070_0160008 Ga0501070_0160008_764_1831 352
231 3300049590 Ga0501074_0000063 Ga0501074_0000063_43984_45051 352
232 3300049590 Ga0501074_0116053 Ga0501074_0116053_232_1299 352
233 3300049742 Ga0501080_0013423 Ga0501080_0013423_2864_3931 352
234 3300049742 Ga0501080_0028111 Ga0501080_0028111_3695_4762 352
235 3300049742 Ga0501080_0031668 Ga0501080_0031668_2813_3880 352
236 3300049744 Ga0501083_0000205 Ga0501083_0000205_16156_17223 352
237 3300049822 Ga0501035_0000070 Ga0501035_0000070_37639_38706 352
238 3300049822 Ga0501035_0029394 Ga0501035_0029394_1088_2155 352
239 3300049822 Ga0501035_0059552 Ga0501035_0059552_191_1258 352
240 3300049822 Ga0501035_0072015 Ga0501035_0072015_1553_2620 352
241 3300049823 Ga0501044_0000037 Ga0501044_0000037_30287_31354 352
242 3300049823 Ga0501044_0016707 Ga0501044_0016707_1350_2417 352
243 3300049823 Ga0501044_0258449 Ga0501044_0258449_528_1595 352
244 3300049823 Ga0501044_0411030 Ga0501044_0411030_122_1189 352
245 3300031824 Ga0307413_10118327 Ga0307413_101183272 353
246 3300031852 Ga0307410_10075469 Ga0307410_100754692 353
247 3300031852 Ga0307410_10088286 Ga0307410_100882862 353
248 3300031903 Ga0307407_10043744 Ga0307407_100437442 353
249 3300032002 Ga0307416_100116181 Ga0307416_1001161813 353
250 3300046512 Ga0495610_0011125 Ga0495610_0011125_3673_4734 353
251 3300049570 Ga0501033_0162617 Ga0501033_0162617_210_1277 353
252 iso_pu_bacteria 2775507266 2778177903 353
253 3300002987 JGI25159J45721_1007977 JGI25159J45721_10079772 354
254 3300003187 JGI25151J46595_10000180 JGI25151J46595_1000018061 354
255 3300003354 JGI25160J50197_1013981 JGI25160J50197_10139813 354
256 3300025284 Ga0209130_1000579 Ga0209130_10005797 354
257 3300025294 Ga0209025_1000422 Ga0209025_100042223 354
258 3300025297 Ga0209758_1008019 Ga0209758_10080192 354
259 3300025302 Ga0207426_1000133 Ga0207426_100013328 354
260 3300049572 Ga0501036_0169471 Ga0501036_0169471_165_1313 354
261 3300049581 Ga0501047_0020369 Ga0501047_0020369_164_1321 354
262 3300049585 Ga0501069_0001304 Ga0501069_0001304_6722_7879 354
263 3300049586 Ga0501070_0000595 Ga0501070_0000595_15079_16236 354
264 3300049586 Ga0501070_0005381 Ga0501070_0005381_7831_8970 354
265 3300049590 Ga0501074_0071697 Ga0501074_0071697_888_2045 354
266 3300049742 Ga0501080_0030360 Ga0501080_0030360_3396_4553 354
267 3300049744 Ga0501083_0144032 Ga0501083_0144032_342_1490 354
268 3300049822 Ga0501035_0001992 Ga0501035_0001992_16284_17441 354
269 3300049823 Ga0501044_0272924 Ga0501044_0272924_256_1413 354
270 3300053139 Ga0500568_0074927 Ga0500568_0074927_94_1167 354
271 iso_pu_bacteria 2909042592 2909043289 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01244

Peptidase_M19

Membrane dipeptidase (Peptidase family M19)

26

381

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdg-assembly1.cif.gz_A the crystal structure of the dipeptidase ac, metallo peptidase. merops family m19 0.9794 5 354
3fdg-assembly1.cif.gz_A the crystal structure of the dipeptidase ac, metallo peptidase. merops family m19 0.9765 5 354
3ly0-assembly1.cif.gz_A crystal structure of metallo peptidase from rhodobacter sphaeroides liganded with phosphinate mimic of dipeptide l-ala-d-ala 0.973 5 352
3fdg-assembly1.cif.gz_B the crystal structure of the dipeptidase ac, metallo peptidase. merops family m19 0.9702 5 354
3fdg-assembly1.cif.gz_B the crystal structure of the dipeptidase ac, metallo peptidase. merops family m19 0.9675 5 354
ID Description Score Start End Superfamily
3fdgA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9794 5 354 3.20.20.140
3fdgA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9765 5 354 3.20.20.140
3nehA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8913 5 348 3.20.20.140
5nruA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8862 7 351 3.20.20.140
3nehA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.883 5 348 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A352SPU9-F1-model_v4 Peptidase M19 1.002 225 335 GO:0006508
GO:0070573
AF-A0A529NTV9-F1-model_v4 Peptidase 1.001 232 350 GO:0006508
GO:0070573
AF-A0A528N5T7-F1-model_v4 Peptidase 1.001 224 325 GO:0006508
GO:0070573
AF-A0A530A3Y0-F1-model_v4 deleted 1 202 351
AF-A0A531KCP2-F1-model_v4 Peptidase 0.9977 162 308 GO:0006508
GO:0070573

Feature Viewer

pLDDT pTM Quality
95.05 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map