F377884

General Info

Members Datasets Scaffolds Average Seq Length
271 221 267 322

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0106728|Ga0495645_0106728_183_1346
Length 387
Sequence MFHWLLFRMFGRDLVHRTLSFIPKARSESFVDSALPLPLDLTARFDQEPVQNKTGIREIEMTAPRFALALAAILIATPNPAAPCFAQDYPTRSIRIIVPFGAGGPADVAARLIGNVLQEKFHQAIVVENRTGAGGVIGTQEVVKSQPDGYTLLMMSNTQTANESLMPQAQRKYELMRDLVPIAPVNSSDLVIVVHPQVAAKTLQEFIALAKSQPGKLNYASSGTGTPYHMAGELFKSMAGIDVVHVPYRNSGEARSGVIGGQVQMMIDAVPAMAPNVSAGQVRALATTGKTRSNVLPEVPTAGEAGVPGYEATIWLGLMAPTGTPRPVIDQLNAAVNEVVKRPDIVKLWKEQGAVPMSMTPEEFDKYLRGDIVKWAEVVKKFPDKPQ

Samples

Sample ID Description Type Environment
1 2855730933 Achromobacter sp. HZ28 Isolate Nodule
2 2855767633 Achromobacter sp. HZ34 Isolate Nodule
3 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
4 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.92
Nodule 1.11
Rhizoplane 5.17
Rhizosphere 76.38
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000437 3300003187 Bacteria 41251
2 JGI25405J52794_10004828 3300003911 Bacteria 2417
3 Ga0065712_10031784 3300005290 Bacteria 1270
4 Ga0070690_100208512 3300005330 Bacteria 1363
5 Ga0070670_100015688 3300005331 Bacteria 6503
6 Ga0070680_100143303 3300005336 Bacteria 2004
7 Ga0070660_100391666 3300005339 Bacteria 1148
8 Ga0070689_100039983 3300005340 Bacteria 3593
9 Ga0070689_100239839 3300005340 Bacteria 1493
10 Ga0070668_100032053 3300005347 Bacteria 3999
11 Ga0070669_100034220 3300005353 Bacteria 3679
12 Ga0070675_100040283 3300005354 Bacteria 3813
13 Ga0070671_100160074 3300005355 Bacteria 1903
14 Ga0070674_100043738 3300005356 Bacteria 3049
15 Ga0070674_100050001 3300005356 Bacteria 2877
16 Ga0070674_100055193 3300005356 Bacteria 2750
17 Ga0070673_100028753 3300005364 Bacteria 4138
18 Ga0070688_100044523 3300005365 Bacteria 2739
19 Ga0070714_100076457 3300005435 Bacteria 2907
20 Ga0070714_100200302 3300005435 Bacteria 1826
21 Ga0070713_100033349 3300005436 Bacteria 4123
22 Ga0070711_100139613 3300005439 Bacteria 1815
23 Ga0070700_100199654 3300005441 Bacteria 1404
24 Ga0070694_100037687 3300005444 Bacteria 3207
25 Ga0070708_100143020 3300005445 Bacteria 2219
26 Ga0070678_100263477 3300005456 Bacteria 1450
27 Ga0070662_100239846 3300005457 Bacteria 1454
28 Ga0068867_100089091 3300005459 Bacteria 2339
29 Ga0070699_100075113 3300005518 Bacteria 2941
30 Ga0070684_100038796 3300005535 Bacteria 4094
31 Ga0070684_100169166 3300005535 Bacteria 1985
32 Ga0068853_100120251 3300005539 Bacteria 2342
33 Ga0070672_100045659 3300005543 Bacteria 3390
34 Ga0070686_100180147 3300005544 Bacteria 1501
35 Ga0070695_100045362 3300005545 Bacteria 2802
36 Ga0070695_100073077 3300005545 Bacteria 2250
37 Ga0070696_100206200 3300005546 Bacteria 1470
38 Ga0068855_100066189 3300005563 Bacteria 4213
39 Ga0068856_100168650 3300005614 Bacteria 2201
40 Ga0068859_100138721 3300005617 Bacteria 2505
41 Ga0068861_100253045 3300005719 Bacteria 1504
42 Ga0068861_100520672 3300005719 Bacteria 1078
43 Ga0068851_10032350 3300005834 Bacteria 2603
44 Ga0068863_100066797 3300005841 Bacteria 3401
45 Ga0068862_100017677 3300005844 Bacteria 5936
46 Ga0081455_10013134 3300005937 Bacteria 8209
47 Ga0081538_10022446 3300005981 Bacteria 4571
48 Ga0070717_10014297 3300006028 Bacteria 6104
49 Ga0075365_10018500 3300006038 Bacteria 4285
50 Ga0075365_10021831 3300006038 Bacteria 3999
51 Ga0075365_10111204 3300006038 Bacteria 1882
52 Ga0075368_10091907 3300006042 Bacteria 1241
53 Ga0070712_100050038 3300006175 Bacteria 2905
54 Ga0075362_10026448 3300006177 Bacteria 2478
55 Ga0075369_10016128 3300006186 Bacteria 3008
56 Ga0068871_100098681 3300006358 Bacteria 2444
57 Ga0075428_100420490 3300006844 Bacteria 1432
58 Ga0075430_100026770 3300006846 Bacteria 4904
59 Ga0075431_100199426 3300006847 Bacteria 2048
60 Ga0075433_10131837 3300006852 Bacteria 2220
61 Ga0075434_100027191 3300006871 Bacteria 5614
62 Ga0075434_100106953 3300006871 Bacteria 2807
63 Ga0075429_100045659 3300006880 Bacteria 3811
64 Ga0075436_100146940 3300006914 Bacteria 1658
65 Ga0097620_100138718 3300006931 Bacteria 2505
66 Ga0099794_10113849 3300007265 Bacteria 1357
67 Ga0099795_10019345 3300007788 Bacteria 2202
68 Ga0111539_10048125 3300009094 Bacteria 5092
69 Ga0105247_10016019 3300009101 Bacteria 4492
70 Ga0114129_10143709 3300009147 Bacteria 3269
71 Ga0114129_10634067 3300009147 Bacteria 1381
72 Ga0105242_10022905 3300009176 Bacteria 4919
73 Ga0105248_10173043 3300009177 Bacteria 2434
74 Ga0105238_10022461 3300009551 Bacteria 6429
75 Ga0105238_10247837 3300009551 Bacteria 1759
76 Ga0105249_10371359 3300009553 Bacteria 1454
77 Ga0105239_10028484 3300010375 Bacteria 6142
78 Ga0163163_10011189 3300014325 Bacteria 8127
79 Ga0163163_10116427 3300014325 Bacteria 2704
80 Ga0209675_1005109 3300025291 Bacteria 5595
81 Ga0209025_1000027 3300025294 Bacteria 505882
82 Ga0209025_1015951 3300025294 Bacteria 4479
83 Ga0209050_1009700 3300025298 Bacteria 4879
84 Ga0207682_10002089 3300025893 Bacteria 9046
85 Ga0207710_10072089 3300025900 Bacteria 1586
86 Ga0207685_10069456 3300025905 Bacteria 1423
87 Ga0207705_10155944 3300025909 Bacteria 1713
88 Ga0207684_10288456 3300025910 Bacteria 1415
89 Ga0207695_10069675 3300025913 Bacteria 3598
90 Ga0207693_10020784 3300025915 Bacteria 5220
91 Ga0207662_10011517 3300025918 Bacteria 4908
92 Ga0207652_10079005 3300025921 Bacteria 2874
93 Ga0207652_10149314 3300025921 Bacteria 2092
94 Ga0207681_10178605 3300025923 Bacteria 1615
95 Ga0207650_10051891 3300025925 Bacteria 3036
96 Ga0207687_10061606 3300025927 Bacteria 2650
97 Ga0207700_10027040 3300025928 Bacteria 4011
98 Ga0207644_10184328 3300025931 Bacteria 1638
99 Ga0207706_10124436 3300025933 Bacteria 2268
100 Ga0207669_10088168 3300025937 Bacteria 2011
101 Ga0207691_10033766 3300025940 Bacteria 4763
102 Ga0207661_10001465 3300025944 Bacteria 15950
103 Ga0207661_10135560 3300025944 Bacteria 2114
104 Ga0207651_10258018 3300025960 Bacteria 1429
105 Ga0207668_10034537 3300025972 Bacteria 3359
106 Ga0207639_10118046 3300026041 Bacteria 2175
107 Ga0207708_10069329 3300026075 Bacteria 2700
108 Ga0207641_10233303 3300026088 Bacteria 1711
109 Ga0207648_10017559 3300026089 Bacteria 6502
110 Ga0207674_10040259 3300026116 Bacteria 4842
111 Ga0207674_10374447 3300026116 Bacteria 1376
112 Ga0207674_10528384 3300026116 Bacteria 1140
113 Ga0207675_100121205 3300026118 Bacteria 2474
114 Ga0207683_10008669 3300026121 Bacteria 8695
115 Ga0207698_10066867 3300026142 Bacteria 2831
116 Ga0207428_10149736 3300027907 Bacteria 1777
117 Ga0268265_10015909 3300028380 Bacteria 5160
118 Ga0307511_10000043 3300030521 Bacteria 101232
119 Ga0265330_10011349 3300031235 Bacteria 4181
120 Ga0265330_10022268 3300031235 Bacteria 2885
121 Ga0265330_10109766 3300031235 Bacteria 1179
122 Ga0265325_10004901 3300031241 Bacteria 8362
123 Ga0265340_10006039 3300031247 Bacteria 6681
124 Ga0265339_10002416 3300031249 Bacteria 13392
125 Ga0265339_10069609 3300031249 Bacteria 1878
126 Ga0265331_10012929 3300031250 Bacteria 4500
127 Ga0265327_10000773 3300031251 Bacteria 49324
128 Ga0265313_10056184 3300031595 Bacteria 1862
129 Ga0265342_10132153 3300031712 Bacteria 1397
130 Ga0307412_10228655 3300031911 Bacteria 1431
131 Ga0307416_100217703 3300032002 Bacteria 1828
132 Ga0316215_1000553 3300033544 Bacteria 4080
133 Ga0373950_0002622 3300034818 Bacteria 2493
134 Ga0373944_0067459 3300035089 Bacteria 1159
135 Ga0373923_0024210 3300035111 Bacteria 2395
136 Ga0373953_0014503 3300035117 Bacteria 2836
137 Ga0373954_0088943 3300035118 Bacteria 1481
138 Ga0373956_0095378 3300035119 Bacteria 1375
139 Ga0373955_0041471 3300035172 Bacteria 2467
140 Ga0373955_0196051 3300035172 Bacteria 1202
141 Ga0373924_0018260 3300035410 Bacteria 2700
142 Ga0373931_0103628 3300035691 Bacteria 1604
143 Ga0373935_0059784 3300035692 Bacteria 2437
144 Ga0373933_0000052 3300035724 Bacteria 70592
145 Ga0373933_0024091 3300035724 Bacteria 3484
146 Ga0373947_0155889 3300035725 Bacteria 1474
147 Ga0373925_0079448 3300037068 Bacteria 2492
148 Ga0373925_0084851 3300037068 Bacteria 2414
149 Ga0373925_0361708 3300037068 Bacteria 1180
150 Ga0395900_0028985 3300037418 Bacteria 5676
151 Ga0395898_0269684 3300037466 Bacteria 1623
152 Ga0395898_0308154 3300037466 Bacteria 1510
153 Ga0395898_0658321 3300037466 Bacteria 990
154 Ga0395901_0188870 3300038443 Bacteria 2161
155 Ga0466966_0146758 3300044684 Bacteria 1440
156 Ga0466959_0085275 3300045049 Bacteria 2273
157 Ga0466967_0525626 3300045976 Bacteria 1163
158 Ga0495592_0076171 3300046454 Bacteria 2434
159 Ga0495629_0228924 3300046459 Bacteria 1281
160 Ga0495641_0115047 3300046461 Bacteria 1200
161 Ga0495653_0095649 3300046463 Bacteria 2161
162 Ga0495605_0023676 3300046474 Bacteria 3225
163 Ga0495584_0189198 3300046491 Bacteria 1046
164 Ga0495618_0128799 3300046514 Bacteria 1620
165 Ga0495628_0035207 3300046516 Bacteria 4025
166 Ga0495663_0072877 3300046525 Bacteria 1096
167 Ga0495640_0069576 3300046533 Bacteria 2367
168 Ga0495640_0131920 3300046533 Bacteria 1616
169 Ga0495598_0046769 3300046537 Bacteria 1287
170 Ga0495621_0016122 3300046539 Bacteria 2393
171 Ga0495645_0106728 3300046543 Bacteria 1986
172 Ga0495667_0031950 3300046559 Bacteria 3530
173 Ga0495656_0051965 3300046615 Bacteria 1756
174 Ga0495634_0055327 3300046642 Bacteria 2653
175 Ga0495635_0082313 3300046663 Bacteria 2202
176 Ga0495588_0201541 3300046674 Bacteria 1051
177 Ga0495599_0042922 3300046678 Bacteria 2838
178 Ga0495646_0092124 3300046680 Bacteria 1748
179 Ga0495670_0108888 3300046691 Bacteria 1432
180 Ga0495600_0058688 3300046809 Bacteria 2513
181 Ga0495604_0071651 3300047317 Bacteria 2620
182 Ga0495674_0228987 3300047319 Bacteria 1534
183 Ga0495676_0131378 3300047321 Bacteria 1807
184 Ga0495680_0040955 3300047322 Bacteria 3686
185 Ga0495680_0114294 3300047322 Bacteria 1998
186 Ga0495684_0115535 3300047471 Bacteria 2023
187 Ga0495593_0029901 3300047673 Bacteria 2984
188 Ga0495593_0073333 3300047673 Bacteria 1776
189 Ga0496100_0465681 3300048903 Bacteria 970
190 Ga0496105_0003830 3300048908 Bacteria 11224
191 Ga0496106_0019354 3300048909 Bacteria 5048
192 Ga0496107_0262777 3300048910 Bacteria 1284
193 Ga0496108_0006587 3300048911 Bacteria 9421
194 Ga0496110_0063201 3300048913 Bacteria 3271
195 Ga0496110_0154432 3300048913 Bacteria 2079
196 Ga0496111_0004597 3300048914 Bacteria 8737
197 Ga0496112_0009460 3300048915 Bacteria 8783
198 Ga0496112_0146942 3300048915 Bacteria 2326
199 Ga0496112_0287971 3300048915 Bacteria 1589
200 Ga0496113_0012037 3300048916 Bacteria 5801
201 Ga0496114_0046072 3300048917 Bacteria 3623
202 Ga0496115_0167452 3300048918 Bacteria 1817
203 Ga0496116_0107006 3300048919 Bacteria 1654
204 Ga0496121_0016690 3300048924 Bacteria 7557
205 Ga0496121_0016954 3300048924 Bacteria 7482
206 Ga0496121_0020752 3300048924 Bacteria 6478
207 Ga0496122_0195864 3300048925 Bacteria 1187
208 Ga0496123_0059866 3300048926 Bacteria 2459
209 Ga0496124_0000007 3300048927 Bacteria 883534
210 Ga0496126_0003871 3300048929 Bacteria 18451
211 Ga0496126_0354471 3300048929 Bacteria 1199
212 Ga0501033_0019147 3300049570 Bacteria 5176
213 Ga0501034_0417539 3300049571 Bacteria 1263
214 Ga0501037_0035824 3300049573 Bacteria 3657
215 Ga0501039_0081286 3300049575 Bacteria 2523
216 Ga0501047_0035427 3300049581 Bacteria 4822
217 Ga0501072_0000783 3300049588 Bacteria 23295
218 Ga0501072_0135236 3300049588 Bacteria 1965
219 Ga0501073_0251942 3300049589 Bacteria 1219
220 Ga0501076_0440268 3300049592 Unclassified 1073
221 Ga0501083_0009210 3300049744 Bacteria 6974
222 Ga0501035_0013156 3300049822 Bacteria 7638
223 Ga0501044_0002569 3300049823 Bacteria 20676
224 Ga0501045_0248975 3300049824 Bacteria 1323
225 nmdc:mga03683_38693_c1 3300050489 Bacteria 1949
226 nmdc:mga03n38_17736_c1 3300050490 Bacteria 2794
227 nmdc:mga00v17_40487_c1 3300050491 Bacteria 2795
228 nmdc:mga0yw44_104104_c1 3300050492 Bacteria 1811
229 nmdc:mga0yw44_14737_c1 3300050492 Bacteria 4162
230 nmdc:mga0yw44_67673_c1 3300050492 Bacteria 2208
231 nmdc:mga0yw44_75533_c1 3300050492 Bacteria 2101
232 nmdc:mga06z11_82810_c1 3300050494 Bacteria 1726
233 nmdc:mga07m45_20827_c1 3300050496 Bacteria 3565
234 nmdc:mga07m45_4981_c1 3300050496 Bacteria 6558
235 nmdc:mga05p37_20453_c1 3300050507 Bacteria 8005
236 nmdc:mga05p37_224966_c1 3300050507 Bacteria 2263
237 nmdc:mga05p37_67891_c1 3300050507 Bacteria 4386
238 nmdc:mga09592_100792_c1 3300050508 Bacteria 2473
239 nmdc:mga0qj67_108798_c1 3300050509 Bacteria 2237
240 nmdc:mga06r32_536640_c1 3300050510 Bacteria 1145
241 nmdc:mga08y16_721538_c1 3300050511 Bacteria 995
242 nmdc:mga0n895_128545_c1 3300050512 Bacteria 2558
243 nmdc:mga0n895_260_c1 3300050512 Bacteria 34195
244 nmdc:mga0n895_283212_c1 3300050512 Bacteria 1681
245 nmdc:mga0rr50_192615_c1 3300050513 Bacteria 1672
246 nmdc:mga08x19_41384_c1 3300050514 Bacteria 2934
247 nmdc:mga0a205_131583_c1 3300050515 Bacteria 2402
248 nmdc:mga0a205_79473_c1 3300050515 Bacteria 3169
249 nmdc:mga0sz30_86142_c1 3300050516 Bacteria 1364
250 Ga0495619_0068109 3300053085 Bacteria 2377
251 Ga0495619_0068774 3300053085 Bacteria 2366
252 Ga0495619_0323222 3300053085 Bacteria 1068
253 Ga0500643_003827 3300053087 Bacteria 7015
254 Ga0500644_0019969 3300053088 Bacteria 1985
255 Ga0500644_0028815 3300053088 Bacteria 1740
256 Ga0500646_0004583 3300053090 Bacteria 3497
257 Ga0500583_0018524 3300053092 Bacteria 2833
258 Ga0500651_0078920 3300053093 Bacteria 2041
259 Ga0500594_0018709 3300053118 Bacteria 1710
260 Ga0500595_000016 3300053119 Bacteria 211397
261 Ga0500655_004952 3300053133 Bacteria 2394
262 Ga0500616_0000006 3300053153 Bacteria 944738
263 Ga0500616_0107530 3300053153 Bacteria 1353
264 Ga0500634_0027431 3300053161 Bacteria 3103
265 Ga0500645_000033 3300053730 Bacteria 119279
266 Ga0501084_0313069 3300054114 Unclassified 1326
267 Ga0501082_0010342 3300060353 Bacteria 8032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0440268 Ga0501076_0440268_26_820 261
2 3300048903 Ga0496100_0465681 Ga0496100_0465681_129_938 269
3 3300048915 Ga0496112_0009460 Ga0496112_0009460_7942_8751 269
4 3300048916 Ga0496113_0012037 Ga0496113_0012037_4960_5769 269
5 3300049575 Ga0501039_0081286 Ga0501039_0081286_43_918 288
6 3300053093 Ga0500651_0078920 Ga0500651_0078920_84_1049 293
7 3300006042 Ga0075368_10091907 Ga0075368_100919072 295
8 3300050494 nmdc:mga06z11_82810_c1 nmdc:mga06z11_82810_c1_529_1533 295
9 3300050496 nmdc:mga07m45_20827_c1 nmdc:mga07m45_20827_c1_1233_2237 296
10 3300050516 nmdc:mga0sz30_86142_c1 nmdc:mga0sz30_86142_c1_243_1247 296
11 3300044684 Ga0466966_0146758 Ga0466966_0146758_386_1357 302
12 3300048924 Ga0496121_0020752 Ga0496121_0020752_5045_6025 303
13 3300005439 Ga0070711_100139613 Ga0070711_1001396132 304
14 3300053087 Ga0500643_003827 Ga0500643_003827_5391_6356 305
15 3300053119 Ga0500595_000016 Ga0500595_000016_70102_71067 305
16 3300050511 nmdc:mga08y16_721538_c1 nmdc:mga08y16_721538_c1_16_951 306
17 3300035089 Ga0373944_0067459 Ga0373944_0067459_122_1078 307
18 3300045976 Ga0466967_0525626 Ga0466967_0525626_16_942 308
19 3300047321 Ga0495676_0131378 Ga0495676_0131378_586_1518 309
20 3300031251 Ga0265327_10000773 Ga0265327_1000077332 311
21 3300050513 nmdc:mga0rr50_192615_c1 nmdc:mga0rr50_192615_c1_659_1594 311
22 3300050515 nmdc:mga0a205_79473_c1 nmdc:mga0a205_79473_c1_175_1110 311
23 3300053092 Ga0500583_0018524 Ga0500583_0018524_1242_2213 312
24 3300054114 Ga0501084_0313069 Ga0501084_0313069_215_1171 312
25 3300050514 nmdc:mga08x19_41384_c1 nmdc:mga08x19_41384_c1_736_1677 313
26 3300035692 Ga0373935_0059784 Ga0373935_0059784_1161_2105 314
27 3300037068 Ga0373925_0079448 Ga0373925_0079448_935_1879 314
28 3300037466 Ga0395898_0658321 Ga0395898_0658321_10_957 314
29 3300046615 Ga0495656_0051965 Ga0495656_0051965_74_1024 314
30 3300050507 nmdc:mga05p37_224966_c1 nmdc:mga05p37_224966_c1_226_1188 314
31 3300050509 nmdc:mga0qj67_108798_c1 nmdc:mga0qj67_108798_c1_391_1353 314
32 3300048929 Ga0496126_0354471 Ga0496126_0354471_176_1132 315
33 3300050512 nmdc:mga0n895_260_c1 nmdc:mga0n895_260_c1_4103_5092 315
34 3300009553 Ga0105249_10371359 Ga0105249_103713592 316
35 3300033544 Ga0316215_1000553 Ga0316215_10005532 316
36 3300035172 Ga0373955_0196051 Ga0373955_0196051_94_1080 316
37 3300046537 Ga0495598_0046769 Ga0495598_0046769_291_1277 316
38 3300006028 Ga0070717_10014297 Ga0070717_100142975 317
39 3300006038 Ga0075365_10018500 Ga0075365_100185002 317
40 3300006177 Ga0075362_10026448 Ga0075362_100264482 317
41 3300047322 Ga0495680_0114294 Ga0495680_0114294_327_1292 317
42 3300048913 Ga0496110_0063201 Ga0496110_0063201_1903_2865 317
43 3300050489 nmdc:mga03683_38693_c1 nmdc:mga03683_38693_c1_16_984 317
44 3300050490 nmdc:mga03n38_17736_c1 nmdc:mga03n38_17736_c1_721_1689 317
45 3300050491 nmdc:mga00v17_40487_c1 nmdc:mga00v17_40487_c1_1342_2307 317
46 3300050492 nmdc:mga0yw44_14737_c1 nmdc:mga0yw44_14737_c1_588_1553 317
47 3300050496 nmdc:mga07m45_4981_c1 nmdc:mga07m45_4981_c1_127_1095 317
48 3300053085 Ga0495619_0068109 Ga0495619_0068109_745_1722 317
49 3300053085 Ga0495619_0323222 Ga0495619_0323222_23_985 317
50 iso_pu_bacteria 2941538514 2941546750 317
51 3300005339 Ga0070660_100391666 Ga0070660_1003916662 318
52 3300005444 Ga0070694_100037687 Ga0070694_1000376872 318
53 3300005545 Ga0070695_100045362 Ga0070695_1000453624 318
54 3300005545 Ga0070695_100073077 Ga0070695_1000730773 318
55 3300005546 Ga0070696_100206200 Ga0070696_1002062002 318
56 3300005563 Ga0068855_100066189 Ga0068855_1000661893 318
57 3300005614 Ga0068856_100168650 Ga0068856_1001686503 318
58 3300006871 Ga0075434_100027191 Ga0075434_1000271914 318
59 3300006914 Ga0075436_100146940 Ga0075436_1001469401 318
60 3300009176 Ga0105242_10022905 Ga0105242_100229052 318
61 3300009551 Ga0105238_10022461 Ga0105238_100224612 318
62 3300025921 Ga0207652_10149314 Ga0207652_101493142 318
63 3300026116 Ga0207674_10374447 Ga0207674_103744471 318
64 3300026142 Ga0207698_10066867 Ga0207698_100668671 318
65 3300049589 Ga0501073_0251942 Ga0501073_0251942_39_995 318
66 3300045049 Ga0466959_0085275 Ga0466959_0085275_428_1399 319
67 3300046491 Ga0495584_0189198 Ga0495584_0189198_21_998 319
68 3300049571 Ga0501034_0417539 Ga0501034_0417539_39_1001 319
69 3300049573 Ga0501037_0035824 Ga0501037_0035824_1980_2942 319
70 3300049581 Ga0501047_0035427 Ga0501047_0035427_3730_4692 319
71 3300049744 Ga0501083_0009210 Ga0501083_0009210_4573_5535 319
72 3300060353 Ga0501082_0010342 Ga0501082_0010342_5007_5969 319
73 3300006846 Ga0075430_100026770 Ga0075430_1000267704 320
74 3300006880 Ga0075429_100045659 Ga0075429_1000456593 320
75 3300009147 Ga0114129_10143709 Ga0114129_101437093 320
76 3300048913 Ga0496110_0154432 Ga0496110_0154432_326_1336 320
77 3300048915 Ga0496112_0146942 Ga0496112_0146942_928_1938 320
78 3300050508 nmdc:mga09592_100792_c1 nmdc:mga09592_100792_c1_491_1471 320
79 3300053133 Ga0500655_004952 Ga0500655_004952_1236_2207 320
80 3300005290 Ga0065712_10031784 Ga0065712_100317842 321
81 3300005330 Ga0070690_100208512 Ga0070690_1002085122 321
82 3300005336 Ga0070680_100143303 Ga0070680_1001433032 321
83 3300005340 Ga0070689_100039983 Ga0070689_1000399833 321
84 3300005340 Ga0070689_100239839 Ga0070689_1002398391 321
85 3300005353 Ga0070669_100034220 Ga0070669_1000342203 321
86 3300005354 Ga0070675_100040283 Ga0070675_1000402833 321
87 3300005355 Ga0070671_100160074 Ga0070671_1001600742 321
88 3300005356 Ga0070674_100055193 Ga0070674_1000551933 321
89 3300005364 Ga0070673_100028753 Ga0070673_1000287534 321
90 3300005365 Ga0070688_100044523 Ga0070688_1000445232 321
91 3300005436 Ga0070713_100033349 Ga0070713_1000333495 321
92 3300005441 Ga0070700_100199654 Ga0070700_1001996542 321
93 3300005456 Ga0070678_100263477 Ga0070678_1002634771 321
94 3300005457 Ga0070662_100239846 Ga0070662_1002398461 321
95 3300005459 Ga0068867_100089091 Ga0068867_1000890912 321
96 3300005535 Ga0070684_100038796 Ga0070684_1000387962 321
97 3300005539 Ga0068853_100120251 Ga0068853_1001202513 321
98 3300005543 Ga0070672_100045659 Ga0070672_1000456593 321
99 3300005544 Ga0070686_100180147 Ga0070686_1001801471 321
100 3300005617 Ga0068859_100138721 Ga0068859_1001387213 321
101 3300005719 Ga0068861_100253045 Ga0068861_1002530452 321
102 3300005719 Ga0068861_100520672 Ga0068861_1005206721 321
103 3300005841 Ga0068863_100066797 Ga0068863_1000667974 321
104 3300006358 Ga0068871_100098681 Ga0068871_1000986812 321
105 3300006931 Ga0097620_100138718 Ga0097620_1001387181 321
106 3300007265 Ga0099794_10113849 Ga0099794_101138491 321
107 3300009101 Ga0105247_10016019 Ga0105247_100160193 321
108 3300009177 Ga0105248_10173043 Ga0105248_101730432 321
109 3300009551 Ga0105238_10247837 Ga0105238_102478372 321
110 3300014325 Ga0163163_10116427 Ga0163163_101164272 321
111 3300025893 Ga0207682_10002089 Ga0207682_100020893 321
112 3300025900 Ga0207710_10072089 Ga0207710_100720891 321
113 3300025913 Ga0207695_10069675 Ga0207695_100696752 321
114 3300025918 Ga0207662_10011517 Ga0207662_100115172 321
115 3300025921 Ga0207652_10079005 Ga0207652_100790053 321
116 3300025923 Ga0207681_10178605 Ga0207681_101786052 321
117 3300025927 Ga0207687_10061606 Ga0207687_100616062 321
118 3300025928 Ga0207700_10027040 Ga0207700_100270402 321
119 3300025931 Ga0207644_10184328 Ga0207644_101843282 321
120 3300025933 Ga0207706_10124436 Ga0207706_101244361 321
121 3300025937 Ga0207669_10088168 Ga0207669_100881682 321
122 3300025940 Ga0207691_10033766 Ga0207691_100337663 321
123 3300025944 Ga0207661_10001465 Ga0207661_1000146510 321
124 3300025960 Ga0207651_10258018 Ga0207651_102580181 321
125 3300026075 Ga0207708_10069329 Ga0207708_100693293 321
126 3300026088 Ga0207641_10233303 Ga0207641_102333031 321
127 3300026089 Ga0207648_10017559 Ga0207648_100175594 321
128 3300026116 Ga0207674_10528384 Ga0207674_105283841 321
129 3300026118 Ga0207675_100121205 Ga0207675_1001212053 321
130 3300026121 Ga0207683_10008669 Ga0207683_100086697 321
131 3300031249 Ga0265339_10002416 Ga0265339_100024165 321
132 3300031911 Ga0307412_10228655 Ga0307412_102286552 321
133 3300032002 Ga0307416_100217703 Ga0307416_1002177032 321
134 3300035724 Ga0373933_0000052 Ga0373933_0000052_47894_48871 321
135 3300037466 Ga0395898_0269684 Ga0395898_0269684_571_1548 321
136 3300037466 Ga0395898_0308154 Ga0395898_0308154_476_1453 321
137 3300046474 Ga0495605_0023676 Ga0495605_0023676_1604_2569 321
138 3300046525 Ga0495663_0072877 Ga0495663_0072877_51_1016 321
139 3300046539 Ga0495621_0016122 Ga0495621_0016122_566_1531 321
140 3300046674 Ga0495588_0201541 Ga0495588_0201541_11_976 321
141 3300046691 Ga0495670_0108888 Ga0495670_0108888_38_1015 321
142 3300050492 nmdc:mga0yw44_75533_c1 nmdc:mga0yw44_75533_c1_422_1399 321
143 3300053088 Ga0500644_0019969 Ga0500644_0019969_354_1319 321
144 3300053118 Ga0500594_0018709 Ga0500594_0018709_535_1500 321
145 3300053153 Ga0500616_0000006 Ga0500616_0000006_656239_657204 321
146 3300003911 JGI25405J52794_10004828 JGI25405J52794_100048281 322
147 3300005347 Ga0070668_100032053 Ga0070668_1000320534 322
148 3300005356 Ga0070674_100043738 Ga0070674_1000437386 322
149 3300005844 Ga0068862_100017677 Ga0068862_1000176777 322
150 3300005937 Ga0081455_10013134 Ga0081455_100131342 322
151 3300005981 Ga0081538_10022446 Ga0081538_100224462 322
152 3300006038 Ga0075365_10111204 Ga0075365_101112043 322
153 3300025972 Ga0207668_10034537 Ga0207668_100345376 322
154 3300028380 Ga0268265_10015909 Ga0268265_100159098 322
155 3300034818 Ga0373950_0002622 Ga0373950_0002622_82_1050 322
156 3300048929 Ga0496126_0003871 Ga0496126_0003871_14767_15741 322
157 3300049588 Ga0501072_0000783 Ga0501072_0000783_7923_8891 322
158 3300049588 Ga0501072_0135236 Ga0501072_0135236_64_1050 322
159 3300049824 Ga0501045_0248975 Ga0501045_0248975_103_1089 322
160 3300050492 nmdc:mga0yw44_104104_c1 nmdc:mga0yw44_104104_c1_205_1191 322
161 iso_pu_bacteria 2855730933 2855735884 322
162 iso_pu_bacteria 2855767633 2855772822 322
163 3300005331 Ga0070670_100015688 Ga0070670_1000156883 323
164 3300005435 Ga0070714_100076457 Ga0070714_1000764572 323
165 3300005535 Ga0070684_100169166 Ga0070684_1001691662 323
166 3300005834 Ga0068851_10032350 Ga0068851_100323503 323
167 3300006038 Ga0075365_10021831 Ga0075365_100218315 323
168 3300006186 Ga0075369_10016128 Ga0075369_100161283 323
169 3300006844 Ga0075428_100420490 Ga0075428_1004204902 323
170 3300006847 Ga0075431_100199426 Ga0075431_1001994262 323
171 3300009094 Ga0111539_10048125 Ga0111539_100481253 323
172 3300010375 Ga0105239_10028484 Ga0105239_100284843 323
173 3300014325 Ga0163163_10011189 Ga0163163_100111892 323
174 3300025905 Ga0207685_10069456 Ga0207685_100694562 323
175 3300025909 Ga0207705_10155944 Ga0207705_101559442 323
176 3300025925 Ga0207650_10051891 Ga0207650_100518912 323
177 3300025944 Ga0207661_10135560 Ga0207661_101355602 323
178 3300026041 Ga0207639_10118046 Ga0207639_101180462 323
179 3300026116 Ga0207674_10040259 Ga0207674_100402593 323
180 3300027907 Ga0207428_10149736 Ga0207428_101497361 323
181 3300030521 Ga0307511_10000043 Ga0307511_1000004336 323
182 3300031235 Ga0265330_10011349 Ga0265330_100113493 323
183 3300031235 Ga0265330_10022268 Ga0265330_100222682 323
184 3300031235 Ga0265330_10109766 Ga0265330_101097661 323
185 3300031241 Ga0265325_10004901 Ga0265325_100049016 323
186 3300031247 Ga0265340_10006039 Ga0265340_100060395 323
187 3300031249 Ga0265339_10069609 Ga0265339_100696093 323
188 3300031250 Ga0265331_10012929 Ga0265331_100129293 323
189 3300031595 Ga0265313_10056184 Ga0265313_100561842 323
190 3300031712 Ga0265342_10132153 Ga0265342_101321531 323
191 3300035111 Ga0373923_0024210 Ga0373923_0024210_947_1930 323
192 3300035117 Ga0373953_0014503 Ga0373953_0014503_1640_2623 323
193 3300035118 Ga0373954_0088943 Ga0373954_0088943_269_1252 323
194 3300035119 Ga0373956_0095378 Ga0373956_0095378_148_1131 323
195 3300035172 Ga0373955_0041471 Ga0373955_0041471_473_1456 323
196 3300035410 Ga0373924_0018260 Ga0373924_0018260_1385_2368 323
197 3300035691 Ga0373931_0103628 Ga0373931_0103628_154_1140 323
198 3300035724 Ga0373933_0024091 Ga0373933_0024091_596_1579 323
199 3300046454 Ga0495592_0076171 Ga0495592_0076171_1365_2348 323
200 3300046459 Ga0495629_0228924 Ga0495629_0228924_104_1087 323
201 3300046461 Ga0495641_0115047 Ga0495641_0115047_43_1029 323
202 3300046463 Ga0495653_0095649 Ga0495653_0095649_1023_2006 323
203 3300046514 Ga0495618_0128799 Ga0495618_0128799_575_1558 323
204 3300046516 Ga0495628_0035207 Ga0495628_0035207_2247_3230 323
205 3300046533 Ga0495640_0069576 Ga0495640_0069576_208_1194 323
206 3300046533 Ga0495640_0131920 Ga0495640_0131920_242_1225 323
207 3300046543 Ga0495645_0106728 Ga0495645_0106728_183_1346 323
208 3300046559 Ga0495667_0031950 Ga0495667_0031950_1824_2807 323
209 3300046642 Ga0495634_0055327 Ga0495634_0055327_403_1389 323
210 3300046663 Ga0495635_0082313 Ga0495635_0082313_365_1348 323
211 3300046678 Ga0495599_0042922 Ga0495599_0042922_894_1877 323
212 3300046680 Ga0495646_0092124 Ga0495646_0092124_751_1734 323
213 3300046809 Ga0495600_0058688 Ga0495600_0058688_150_1133 323
214 3300047317 Ga0495604_0071651 Ga0495604_0071651_460_1443 323
215 3300047319 Ga0495674_0228987 Ga0495674_0228987_465_1448 323
216 3300047322 Ga0495680_0040955 Ga0495680_0040955_636_1619 323
217 3300047471 Ga0495684_0115535 Ga0495684_0115535_18_1001 323
218 3300047673 Ga0495593_0029901 Ga0495593_0029901_540_1523 323
219 3300047673 Ga0495593_0073333 Ga0495593_0073333_771_1757 323
220 3300048908 Ga0496105_0003830 Ga0496105_0003830_2502_3488 323
221 3300048909 Ga0496106_0019354 Ga0496106_0019354_3842_4828 323
222 3300048910 Ga0496107_0262777 Ga0496107_0262777_177_1163 323
223 3300048911 Ga0496108_0006587 Ga0496108_0006587_575_1561 323
224 3300048914 Ga0496111_0004597 Ga0496111_0004597_1028_2014 323
225 3300048915 Ga0496112_0287971 Ga0496112_0287971_310_1293 323
226 3300048917 Ga0496114_0046072 Ga0496114_0046072_358_1344 323
227 3300048918 Ga0496115_0167452 Ga0496115_0167452_13_999 323
228 3300048924 Ga0496121_0016954 Ga0496121_0016954_3125_4102 323
229 3300048927 Ga0496124_0000007 Ga0496124_0000007_39700_40677 323
230 3300050492 nmdc:mga0yw44_67673_c1 nmdc:mga0yw44_67673_c1_1139_2110 323
231 3300050507 nmdc:mga05p37_20453_c1 nmdc:mga05p37_20453_c1_6294_7280 323
232 3300050510 nmdc:mga06r32_536640_c1 nmdc:mga06r32_536640_c1_83_1069 323
233 3300050512 nmdc:mga0n895_283212_c1 nmdc:mga0n895_283212_c1_491_1477 323
234 3300053085 Ga0495619_0068774 Ga0495619_0068774_563_1546 323
235 3300053088 Ga0500644_0028815 Ga0500644_0028815_40_1032 323
236 3300053090 Ga0500646_0004583 Ga0500646_0004583_1415_2407 323
237 3300053153 Ga0500616_0107530 Ga0500616_0107530_110_1102 323
238 3300053730 Ga0500645_000033 Ga0500645_000033_40225_41202 323
239 iso_pu_bacteria 2881412998 2881416346 323
240 3300005356 Ga0070674_100050001 Ga0070674_1000500012 324
241 3300007788 Ga0099795_10019345 Ga0099795_100193452 324
242 3300035725 Ga0373947_0155889 Ga0373947_0155889_466_1443 324
243 3300037068 Ga0373925_0361708 Ga0373925_0361708_88_1065 324
244 3300037418 Ga0395900_0028985 Ga0395900_0028985_3783_4763 324
245 3300038443 Ga0395901_0188870 Ga0395901_0188870_524_1504 324
246 3300049570 Ga0501033_0019147 Ga0501033_0019147_1154_2131 324
247 3300049822 Ga0501035_0013156 Ga0501035_0013156_4946_5923 324
248 3300049823 Ga0501044_0002569 Ga0501044_0002569_17812_18789 324
249 3300053161 Ga0500634_0027431 Ga0500634_0027431_677_1657 324
250 3300005435 Ga0070714_100200302 Ga0070714_1002003021 325
251 3300005445 Ga0070708_100143020 Ga0070708_1001430203 325
252 3300005518 Ga0070699_100075113 Ga0070699_1000751133 325
253 3300006175 Ga0070712_100050038 Ga0070712_1000500382 325
254 3300006852 Ga0075433_10131837 Ga0075433_101318371 325
255 3300006871 Ga0075434_100106953 Ga0075434_1001069532 325
256 3300009147 Ga0114129_10634067 Ga0114129_106340671 325
257 3300025910 Ga0207684_10288456 Ga0207684_102884561 325
258 3300025915 Ga0207693_10020784 Ga0207693_100207848 325
259 3300037068 Ga0373925_0084851 Ga0373925_0084851_1128_2141 325
260 3300050507 nmdc:mga05p37_67891_c1 nmdc:mga05p37_67891_c1_292_1278 325
261 3300050512 nmdc:mga0n895_128545_c1 nmdc:mga0n895_128545_c1_605_1651 325
262 3300050515 nmdc:mga0a205_131583_c1 nmdc:mga0a205_131583_c1_455_1465 325
263 3300003187 JGI25151J46595_10000437 JGI25151J46595_1000043713 326
264 3300025291 Ga0209675_1005109 Ga0209675_10051096 326
265 3300025294 Ga0209025_1000027 Ga0209025_1000027133 326
266 3300025294 Ga0209025_1015951 Ga0209025_10159512 326
267 3300025298 Ga0209050_1009700 Ga0209050_10097003 326
268 3300048919 Ga0496116_0107006 Ga0496116_0107006_581_1573 326
269 3300048924 Ga0496121_0016690 Ga0496121_0016690_5832_6824 326
270 3300048925 Ga0496122_0195864 Ga0496122_0195864_117_1112 326
271 3300048926 Ga0496123_0059866 Ga0496123_0059866_1251_2243 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

109

383

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9703 30 324
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9692 34 326
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.96 30 326
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.958 30 324
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9555 30 318
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9501 128 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9479 128 246 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9419 129 247 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9405 128 250 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9355 128 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.991 67 325
AF-A0A536YZ85-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.989 20 326
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9872 67 325
AF-A0A0H4WBT1-F1-model_v4 deleted 0.9791 29 320
AF-A0A317HXN3-F1-model_v4 deleted 0.979 29 326

Feature Viewer

pLDDT pTM Quality
91.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map