F377806

General Info

Members Datasets Scaffolds Average Seq Length
271 182 542 400

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0207451|Ga0395901_0207451_511_1893
Length 443
Sequence MVNVRQRTDAVVDPADHASPGTRDRDEELPSASQFKETFMNPSPSSKPPRGRRAWTSNLVRGVAAVGALSSEELAGKQIFRSDTFGDEAFWTDKLKMNTVIATAVDPTTALKVGLKVDSEALPPEVVAGIQNGSIDLTKPATTVALLKLDAVVGVKGTVTTVNGVDTLTRVGITCALCHSTVDNSFAPGIGKRLDGWPNRDLNPGAIIALSPALDAATKAVYNSWGPGKYDPRFNVDGKNKPSVIPPAYGLQNVNKITVTGDGDTAHEPAGPVAYWNRYVSVTQMGGLGTFSDPRLPLTVTNGTVDLVTSKLPSLQAYQLSLAAPTPPAGSFDPAAAARGKAVFEGAGKCSTCHSGPEFTDANTTLHPVADSMAEPENPSYASRSATKQYRTAPLKGVWQHAPYFHDGSAPTLEAVVQTYNTKRALGLTPQQIADVAQYLRSL

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0.37
Rhizoplane 2.95
Rhizosphere 92.25
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0207451 3300038443 Bacteria 2052
2 Ga0065704_10001704 3300005289 Bacteria 11453
3 Ga0070658_10011685 3300005327 Bacteria 7043
4 Ga0070658_10069953 3300005327 Bacteria 2872
5 Ga0070658_10252271 3300005327 Bacteria 1497
6 Ga0070676_10003158 3300005328 Bacteria 8524
7 Ga0070683_100004847 3300005329 Bacteria 11140
8 Ga0070690_100002937 3300005330 Bacteria 9215
9 Ga0070670_100115687 3300005331 Bacteria 2312
10 Ga0070670_100123431 3300005331 Bacteria 2234
11 Ga0070677_10036287 3300005333 Bacteria 1917
12 Ga0068869_100006826 3300005334 Bacteria 7261
13 Ga0070666_10000556 3300005335 Bacteria 22523
14 Ga0070666_10010667 3300005335 Bacteria 5752
15 Ga0068868_100069870 3300005338 Bacteria 2799
16 Ga0068868_100070838 3300005338 Bacteria 2780
17 Ga0070660_100000102 3300005339 Bacteria 52335
18 Ga0070660_100098382 3300005339 Bacteria 2315
19 Ga0070689_100063563 3300005340 Bacteria 2872
20 Ga0070687_100000173 3300005343 Bacteria 22262
21 Ga0070661_100000688 3300005344 Bacteria 24837
22 Ga0070668_100000754 3300005347 Bacteria 22207
23 Ga0070668_100101269 3300005347 Bacteria 2283
24 Ga0070669_100002879 3300005353 Bacteria 12412
25 Ga0070669_100125842 3300005353 Bacteria 1961
26 Ga0070675_100083253 3300005354 Bacteria 2670
27 Ga0070671_100026348 3300005355 Bacteria 4777
28 Ga0070671_100047171 3300005355 Bacteria 3583
29 Ga0070673_100004902 3300005364 Bacteria 8524
30 Ga0070688_100001173 3300005365 Bacteria 13043
31 Ga0070659_100006270 3300005366 Bacteria 8593
32 Ga0070659_100053658 3300005366 Bacteria 3173
33 Ga0070667_100028229 3300005367 Bacteria 4671
34 Ga0070667_100054279 3300005367 Bacteria 3383
35 Ga0070701_10020233 3300005438 Bacteria 3157
36 Ga0070700_100034809 3300005441 Bacteria 3043
37 Ga0070663_100000748 3300005455 Bacteria 17566
38 Ga0070678_100056442 3300005456 Bacteria 2872
39 Ga0070685_10010207 3300005466 Bacteria 4875
40 Ga0070679_100025306 3300005530 Bacteria 5823
41 Ga0070672_100009669 3300005543 Bacteria 6658
42 Ga0070672_100067027 3300005543 Bacteria 2843
43 Ga0070686_100000227 3300005544 Bacteria 38558
44 Ga0070695_100013994 3300005545 Bacteria 4831
45 Ga0070693_100016848 3300005547 Bacteria 3788
46 Ga0070704_100218816 3300005549 Bacteria 1547
47 Ga0068855_100018378 3300005563 Bacteria 8398
48 Ga0068855_100051556 3300005563 Bacteria 4847
49 Ga0070664_100054814 3300005564 Bacteria 3384
50 Ga0070664_100162717 3300005564 Bacteria 1975
51 Ga0070664_100276537 3300005564 Bacteria 1513
52 Ga0068857_100192135 3300005577 Bacteria 1859
53 Ga0068857_100317984 3300005577 Bacteria 1437
54 Ga0068854_100009752 3300005578 Bacteria 6208
55 Ga0068856_100019520 3300005614 Bacteria 6579
56 Ga0068856_100027961 3300005614 Bacteria 5502
57 Ga0068856_100178342 3300005614 Bacteria 2137
58 Ga0070702_100019718 3300005615 Bacteria 3523
59 Ga0068852_100000760 3300005616 Bacteria 21251
60 Ga0068852_100030904 3300005616 Bacteria 4413
61 Ga0068852_100261508 3300005616 Bacteria 1662
62 Ga0068859_100031172 3300005617 Bacteria 5352
63 Ga0068859_100143420 3300005617 Unclassified 2462
64 Ga0068859_100327711 3300005617 Bacteria 1625
65 Ga0068864_100007450 3300005618 Bacteria 9012
66 Ga0068864_100134758 3300005618 Bacteria 2223
67 Ga0068866_10000481 3300005718 Bacteria 18279
68 Ga0068861_100010979 3300005719 Bacteria 6294
69 Ga0068861_100020130 3300005719 Bacteria 4773
70 Ga0068851_10000300 3300005834 Bacteria 22603
71 Ga0068851_10003675 3300005834 Bacteria 6846
72 Ga0068870_10000200 3300005840 Bacteria 21426
73 Ga0068863_100185098 3300005841 Bacteria 2000
74 Ga0068858_100021444 3300005842 Bacteria 6036
75 Ga0068858_100038819 3300005842 Bacteria 4417
76 Ga0068858_100083970 3300005842 Bacteria 2962
77 Ga0068858_100099362 3300005842 Bacteria 2713
78 Ga0068860_100097614 3300005843 Bacteria 2801
79 Ga0068860_100151897 3300005843 Unclassified 2230
80 Ga0068860_100367673 3300005843 Bacteria 1418
81 Ga0068862_100031246 3300005844 Bacteria 4493
82 Ga0068862_100256047 3300005844 Bacteria 1596
83 Ga0081540_1000349 3300005983 Bacteria 46658
84 Ga0081540_1006608 3300005983 Bacteria 8414
85 Ga0075366_10055960 3300006195 Bacteria 2343
86 Ga0097621_100002751 3300006237 Bacteria 12025
87 Ga0075370_10010608 3300006353 Bacteria 4826
88 Ga0068871_100007485 3300006358 Bacteria 7810
89 Ga0068871_100129008 3300006358 Bacteria 2142
90 Ga0075429_100001373 3300006880 Bacteria 19922
91 Ga0075429_100095988 3300006880 Bacteria 2586
92 Ga0068865_100000065 3300006881 Bacteria 55308
93 Ga0097620_100031171 3300006931 Bacteria 5352
94 Ga0097620_100143422 3300006931 Unclassified 2462
95 Ga0097620_100327678 3300006931 Bacteria 1625
96 Ga0105240_10002590 3300009093 Bacteria 28960
97 Ga0105247_10000106 3300009101 Bacteria 87195
98 Ga0105243_10235395 3300009148 Bacteria 1627
99 Ga0105241_10001952 3300009174 Bacteria 15614
100 Ga0105242_10004790 3300009176 Bacteria 10469
101 Ga0105242_10041633 3300009176 Bacteria 3706
102 Ga0105242_10095909 3300009176 Bacteria 2505
103 Ga0105248_10066541 3300009177 Bacteria 4046
104 Ga0105248_10083907 3300009177 Bacteria 3584
105 Ga0105248_10180865 3300009177 Bacteria 2376
106 Ga0105238_10080949 3300009551 Bacteria 3237
107 Ga0105238_10108339 3300009551 Bacteria 2759
108 Ga0105246_10009975 3300011119 Bacteria 5861
109 Ga0157371_10000796 3300013102 Bacteria 36186
110 Ga0157369_10311100 3300013105 Bacteria 1638
111 Ga0163162_10046440 3300013306 Bacteria 4353
112 Ga0157372_10001693 3300013307 Bacteria 23859
113 Ga0157372_10128628 3300013307 Bacteria 2913
114 Ga0157377_10051560 3300014745 Bacteria 2321
115 Ga0157379_10125338 3300014968 Bacteria 2311
116 Ga0157379_10251263 3300014968 Bacteria 1605
117 Ga0157376_10004328 3300014969 Bacteria 9868
118 Ga0163161_10017720 3300017792 Bacteria 4990
119 Ga0209051_1001065 3300025303 Bacteria 25522
120 Ga0209051_1021639 3300025303 Bacteria 2729
121 Ga0207697_10006180 3300025315 Bacteria 5459
122 Ga0207656_10002830 3300025321 Bacteria 5906
123 Ga0207656_10003538 3300025321 Bacteria 5379
124 Ga0207682_10000030 3300025893 Bacteria 57869
125 Ga0207682_10011620 3300025893 Bacteria 3440
126 Ga0207642_10000543 3300025899 Bacteria 11530
127 Ga0207710_10003405 3300025900 Bacteria 7108
128 Ga0207688_10002176 3300025901 Bacteria 10554
129 Ga0207647_10019090 3300025904 Bacteria 4617
130 Ga0207645_10000130 3300025907 Bacteria 57335
131 Ga0207645_10037431 3300025907 Bacteria 3113
132 Ga0207645_10095839 3300025907 Bacteria 1911
133 Ga0207643_10000658 3300025908 Bacteria 21565
134 Ga0207707_10233156 3300025912 Bacteria 1601
135 Ga0207695_10020087 3300025913 Bacteria 7663
136 Ga0207671_10015291 3300025914 Bacteria 6019
137 Ga0207660_10042301 3300025917 Bacteria 3197
138 Ga0207662_10002836 3300025918 Bacteria 8764
139 Ga0207657_10000249 3300025919 Bacteria 57335
140 Ga0207657_10013514 3300025919 Bacteria 8007
141 Ga0207652_10054204 3300025921 Bacteria 3447
142 Ga0207681_10010936 3300025923 Bacteria 5574
143 Ga0207681_10114196 3300025923 Bacteria 1970
144 Ga0207694_10001287 3300025924 Bacteria 21623
145 Ga0207694_10172172 3300025924 Bacteria 1753
146 Ga0207650_10000932 3300025925 Bacteria 22024
147 Ga0207659_10000569 3300025926 Bacteria 22193
148 Ga0207687_10014474 3300025927 Bacteria 5162
149 Ga0207644_10002645 3300025931 Bacteria 11531
150 Ga0207644_10089467 3300025931 Bacteria 2291
151 Ga0207690_10006351 3300025932 Bacteria 7004
152 Ga0207706_10000260 3300025933 Bacteria 57556
153 Ga0207686_10023633 3300025934 Bacteria 3553
154 Ga0207686_10047459 3300025934 Bacteria 2655
155 Ga0207670_10002013 3300025936 Bacteria 10665
156 Ga0207704_10021835 3300025938 Bacteria 3417
157 Ga0207691_10000202 3300025940 Bacteria 57335
158 Ga0207691_10018104 3300025940 Bacteria 6672
159 Ga0207691_10094330 3300025940 Bacteria 2678
160 Ga0207711_10000239 3300025941 Bacteria 58814
161 Ga0207689_10000164 3300025942 Bacteria 57615
162 Ga0207689_10001694 3300025942 Bacteria 20950
163 Ga0207689_10043503 3300025942 Bacteria 3713
164 Ga0207679_10000729 3300025945 Bacteria 21867
165 Ga0207667_10005283 3300025949 Bacteria 15753
166 Ga0207651_10002697 3300025960 Bacteria 8504
167 Ga0207668_10002730 3300025972 Bacteria 10324
168 Ga0207668_10089329 3300025972 Bacteria 2259
169 Ga0207640_10024217 3300025981 Bacteria 3660
170 Ga0207658_10000932 3300025986 Bacteria 24154
171 Ga0207658_10091798 3300025986 Bacteria 2357
172 Ga0207677_10008497 3300026023 Bacteria 5741
173 Ga0207677_10047087 3300026023 Bacteria 2893
174 Ga0207703_10000270 3300026035 Bacteria 57472
175 Ga0207639_10003305 3300026041 Bacteria 10853
176 Ga0207678_10002421 3300026067 Bacteria 16965
177 Ga0207678_10004682 3300026067 Bacteria 12285
178 Ga0207708_10028777 3300026075 Bacteria 4207
179 Ga0207702_10063625 3300026078 Bacteria 3155
180 Ga0207702_10065878 3300026078 Bacteria 3103
181 Ga0207702_10210831 3300026078 Bacteria 1806
182 Ga0207641_10014340 3300026088 Bacteria 6495
183 Ga0207648_10000261 3300026089 Bacteria 57250
184 Ga0207648_10347686 3300026089 Bacteria 1336
185 Ga0207676_10045618 3300026095 Bacteria 3387
186 Ga0207676_10059403 3300026095 Bacteria 3019
187 Ga0207674_10002602 3300026116 Bacteria 22673
188 Ga0207674_10145695 3300026116 Bacteria 2327
189 Ga0207674_10244468 3300026116 Bacteria 1741
190 Ga0207675_100000003 3300026118 Bacteria 262542
191 Ga0207675_100003605 3300026118 Bacteria 15089
192 Ga0207675_100234431 3300026118 Bacteria 1772
193 Ga0207683_10016901 3300026121 Bacteria 6208
194 Ga0207683_10032596 3300026121 Bacteria 4526
195 Ga0207698_10007669 3300026142 Bacteria 6769
196 Ga0207698_10032219 3300026142 Bacteria 3794
197 Ga0207698_10120352 3300026142 Bacteria 2220
198 Ga0209974_10001755 3300027876 Bacteria 7895
199 Ga0207428_10043549 3300027907 Bacteria 3624
200 Ga0268266_10002186 3300028379 Bacteria 21405
201 Ga0268265_10016534 3300028380 Bacteria 5071
202 Ga0268264_10001386 3300028381 Bacteria 22703
203 Ga0307515_10009727 3300028794 Bacteria 18528
204 Ga0307408_100007663 3300031548 Bacteria 7140
205 Ga0307408_100128324 3300031548 Bacteria 1975
206 Ga0307516_10002917 3300031730 Bacteria 22401
207 Ga0307405_10077236 3300031731 Bacteria 2163
208 Ga0307406_10117814 3300031901 Bacteria 1840
209 Ga0307409_100234299 3300031995 Bacteria 1666
210 Ga0307416_100065044 3300032002 Bacteria 2994
211 Ga0307416_100543008 3300032002 Bacteria 1234
212 Ga0307414_10010479 3300032004 Bacteria 5382
213 Ga0307415_100009614 3300032126 Bacteria 5433
214 Ga0307415_100010991 3300032126 Bacteria 5156
215 Ga0373946_0012115 3300035171 Bacteria 3226
216 Ga0373931_0014994 3300035691 Bacteria 3798
217 Ga0373927_0089339 3300035695 Bacteria 2001
218 Ga0373947_0112656 3300035725 Bacteria 1721
219 Ga0395900_0007738 3300037418 Bacteria 11084
220 Ga0395900_0042643 3300037418 Bacteria 4675
221 Ga0395900_0205646 3300037418 Bacteria 1990
222 Ga0395898_0004720 3300037466 Bacteria 14832
223 Ga0395905_0000290 3300037471 Bacteria 73649
224 Ga0395905_0000597 3300037471 Bacteria 48243
225 Ga0395905_0001286 3300037471 Bacteria 30908
226 Ga0395905_0003318 3300037471 Bacteria 17272
227 Ga0395905_0017834 3300037471 Bacteria 6744
228 Ga0395905_0027953 3300037471 Bacteria 5318
229 Ga0395901_0089729 3300038443 Bacteria 3216
230 Ga0451839_1560006 3300041496 Bacteria 1752
231 Ga0450918_003564 3300042531 Bacteria 2886
232 Ga0450893_0002987 3300042532 Bacteria 2665
233 Ga0451577_0030394 3300042876 Bacteria 4881
234 Ga0451577_0051677 3300042876 Bacteria 3669
235 Ga0466966_0133529 3300044684 Bacteria 1519
236 Ga0453684_0050671 3300044712 Bacteria 5457
237 Ga0453684_0069198 3300044712 Bacteria 4478
238 Ga0451576_0066216 3300045051 Bacteria 3761
239 Ga0466967_0073637 3300045976 Bacteria 3065
240 Ga0495639_0009927 3300046475 Bacteria 4090
241 Ga0495606_0007734 3300046507 Bacteria 9519
242 Ga0495618_0199531 3300046514 Bacteria 1266
243 Ga0495620_0031348 3300046515 Bacteria 2437
244 Ga0495642_0029164 3300046528 Bacteria 2201
245 Ga0495621_0001382 3300046539 Bacteria 6290
246 Ga0495656_0010275 3300046615 Bacteria 3397
247 Ga0495668_0019161 3300046616 Bacteria 3948
248 Ga0495625_0005918 3300046660 Bacteria 11001
249 Ga0495671_0034523 3300046692 Bacteria 2571
250 Ga0495671_0062000 3300046692 Bacteria 1843
251 Ga0495600_0011430 3300046809 Bacteria 5530
252 Ga0495674_0039530 3300047319 Bacteria 4227
253 Ga0495680_0049453 3300047322 Bacteria 3292
254 Ga0496102_0363812 3300048905 Bacteria 1362
255 Ga0496104_0058974 3300048907 Bacteria 3634
256 Ga0496107_0047153 3300048910 Bacteria 3103
257 Ga0496109_0036271 3300048912 Bacteria 4450
258 Ga0496110_0041927 3300048913 Bacteria 3995
259 Ga0496110_0292093 3300048913 Bacteria 1485
260 Ga0496112_0000305 3300048915 Bacteria 31639
261 Ga0496112_0062744 3300048915 Bacteria 3666
262 Ga0501067_0035189 3300049583 Bacteria 2781
263 Ga0501072_0122931 3300049588 Bacteria 2068
264 Ga0501265_002747 3300049762 Bacteria 1996
265 nmdc:mga03683_1809_c1 3300050489 Bacteria 6485
266 nmdc:mga0k408_19611_c1 3300050493 Bacteria 3782
267 nmdc:mga07m45_47396_c1 3300050496 Bacteria 2416
268 nmdc:mga07m45_84327_c1 3300050496 Bacteria 1817
269 nmdc:mga08y16_299911_c1 3300050511 Bacteria 1656
270 Ga0500658_0077950 3300053134 Bacteria 1412
271 2514040510 2513237165 Bacteria 6771773
272 Ga0395901_0207451
273 Ga0065704_10001704
274 Ga0070658_10011685
275 Ga0070658_10069953
276 Ga0070658_10252271
277 Ga0070676_10003158
278 Ga0070683_100004847
279 Ga0070690_100002937
280 Ga0070670_100115687
281 Ga0070670_100123431
282 Ga0070677_10036287
283 Ga0068869_100006826
284 Ga0070666_10000556
285 Ga0070666_10010667
286 Ga0068868_100069870
287 Ga0068868_100070838
288 Ga0070660_100000102
289 Ga0070660_100098382
290 Ga0070689_100063563
291 Ga0070687_100000173
292 Ga0070661_100000688
293 Ga0070668_100000754
294 Ga0070668_100101269
295 Ga0070669_100002879
296 Ga0070669_100125842
297 Ga0070675_100083253
298 Ga0070671_100026348
299 Ga0070671_100047171
300 Ga0070673_100004902
301 Ga0070688_100001173
302 Ga0070659_100006270
303 Ga0070659_100053658
304 Ga0070667_100028229
305 Ga0070667_100054279
306 Ga0070701_10020233
307 Ga0070700_100034809
308 Ga0070663_100000748
309 Ga0070678_100056442
310 Ga0070685_10010207
311 Ga0070679_100025306
312 Ga0070672_100009669
313 Ga0070672_100067027
314 Ga0070686_100000227
315 Ga0070695_100013994
316 Ga0070693_100016848
317 Ga0070704_100218816
318 Ga0068855_100018378
319 Ga0068855_100051556
320 Ga0070664_100054814
321 Ga0070664_100162717
322 Ga0070664_100276537
323 Ga0068857_100192135
324 Ga0068857_100317984
325 Ga0068854_100009752
326 Ga0068856_100019520
327 Ga0068856_100027961
328 Ga0068856_100178342
329 Ga0070702_100019718
330 Ga0068852_100000760
331 Ga0068852_100030904
332 Ga0068852_100261508
333 Ga0068859_100031172
334 Ga0068859_100143420
335 Ga0068859_100327711
336 Ga0068864_100007450
337 Ga0068864_100134758
338 Ga0068866_10000481
339 Ga0068861_100010979
340 Ga0068861_100020130
341 Ga0068851_10000300
342 Ga0068851_10003675
343 Ga0068870_10000200
344 Ga0068863_100185098
345 Ga0068858_100021444
346 Ga0068858_100038819
347 Ga0068858_100083970
348 Ga0068858_100099362
349 Ga0068860_100097614
350 Ga0068860_100151897
351 Ga0068860_100367673
352 Ga0068862_100031246
353 Ga0068862_100256047
354 Ga0081540_1000349
355 Ga0081540_1006608
356 Ga0075366_10055960
357 Ga0097621_100002751
358 Ga0075370_10010608
359 Ga0068871_100007485
360 Ga0068871_100129008
361 Ga0075429_100001373
362 Ga0075429_100095988
363 Ga0068865_100000065
364 Ga0097620_100031171
365 Ga0097620_100143422
366 Ga0097620_100327678
367 Ga0105240_10002590
368 Ga0105247_10000106
369 Ga0105243_10235395
370 Ga0105241_10001952
371 Ga0105242_10004790
372 Ga0105242_10041633
373 Ga0105242_10095909
374 Ga0105248_10066541
375 Ga0105248_10083907
376 Ga0105248_10180865
377 Ga0105238_10080949
378 Ga0105238_10108339
379 Ga0105246_10009975
380 Ga0157371_10000796
381 Ga0157369_10311100
382 Ga0163162_10046440
383 Ga0157372_10001693
384 Ga0157372_10128628
385 Ga0157377_10051560
386 Ga0157379_10125338
387 Ga0157379_10251263
388 Ga0157376_10004328
389 Ga0163161_10017720
390 Ga0209051_1001065
391 Ga0209051_1021639
392 Ga0207697_10006180
393 Ga0207656_10002830
394 Ga0207656_10003538
395 Ga0207682_10000030
396 Ga0207682_10011620
397 Ga0207642_10000543
398 Ga0207710_10003405
399 Ga0207688_10002176
400 Ga0207647_10019090
401 Ga0207645_10000130
402 Ga0207645_10037431
403 Ga0207645_10095839
404 Ga0207643_10000658
405 Ga0207707_10233156
406 Ga0207695_10020087
407 Ga0207671_10015291
408 Ga0207660_10042301
409 Ga0207662_10002836
410 Ga0207657_10000249
411 Ga0207657_10013514
412 Ga0207652_10054204
413 Ga0207681_10010936
414 Ga0207681_10114196
415 Ga0207694_10001287
416 Ga0207694_10172172
417 Ga0207650_10000932
418 Ga0207659_10000569
419 Ga0207687_10014474
420 Ga0207644_10002645
421 Ga0207644_10089467
422 Ga0207690_10006351
423 Ga0207706_10000260
424 Ga0207686_10023633
425 Ga0207686_10047459
426 Ga0207670_10002013
427 Ga0207704_10021835
428 Ga0207691_10000202
429 Ga0207691_10018104
430 Ga0207691_10094330
431 Ga0207711_10000239
432 Ga0207689_10000164
433 Ga0207689_10001694
434 Ga0207689_10043503
435 Ga0207679_10000729
436 Ga0207667_10005283
437 Ga0207651_10002697
438 Ga0207668_10002730
439 Ga0207668_10089329
440 Ga0207640_10024217
441 Ga0207658_10000932
442 Ga0207658_10091798
443 Ga0207677_10008497
444 Ga0207677_10047087
445 Ga0207703_10000270
446 Ga0207639_10003305
447 Ga0207678_10002421
448 Ga0207678_10004682
449 Ga0207708_10028777
450 Ga0207702_10063625
451 Ga0207702_10065878
452 Ga0207702_10210831
453 Ga0207641_10014340
454 Ga0207648_10000261
455 Ga0207648_10347686
456 Ga0207676_10045618
457 Ga0207676_10059403
458 Ga0207674_10002602
459 Ga0207674_10145695
460 Ga0207674_10244468
461 Ga0207675_100000003
462 Ga0207675_100003605
463 Ga0207675_100234431
464 Ga0207683_10016901
465 Ga0207683_10032596
466 Ga0207698_10007669
467 Ga0207698_10032219
468 Ga0207698_10120352
469 Ga0209974_10001755
470 Ga0207428_10043549
471 Ga0268266_10002186
472 Ga0268265_10016534
473 Ga0268264_10001386
474 Ga0307515_10009727
475 Ga0307408_100007663
476 Ga0307408_100128324
477 Ga0307516_10002917
478 Ga0307405_10077236
479 Ga0307406_10117814
480 Ga0307409_100234299
481 Ga0307416_100065044
482 Ga0307416_100543008
483 Ga0307414_10010479
484 Ga0307415_100009614
485 Ga0307415_100010991
486 Ga0373946_0012115
487 Ga0373931_0014994
488 Ga0373927_0089339
489 Ga0373947_0112656
490 Ga0395900_0007738
491 Ga0395900_0042643
492 Ga0395900_0205646
493 Ga0395898_0004720
494 Ga0395905_0000290
495 Ga0395905_0000597
496 Ga0395905_0001286
497 Ga0395905_0003318
498 Ga0395905_0017834
499 Ga0395905_0027953
500 Ga0395901_0089729
501 Ga0451839_1560006
502 Ga0450918_003564
503 Ga0450893_0002987
504 Ga0451577_0030394
505 Ga0451577_0051677
506 Ga0466966_0133529
507 Ga0453684_0050671
508 Ga0453684_0069198
509 Ga0451576_0066216
510 Ga0466967_0073637
511 Ga0495639_0009927
512 Ga0495606_0007734
513 Ga0495618_0199531
514 Ga0495620_0031348
515 Ga0495642_0029164
516 Ga0495621_0001382
517 Ga0495656_0010275
518 Ga0495668_0019161
519 Ga0495625_0005918
520 Ga0495671_0034523
521 Ga0495671_0062000
522 Ga0495600_0011430
523 Ga0495674_0039530
524 Ga0495680_0049453
525 Ga0496102_0363812
526 Ga0496104_0058974
527 Ga0496107_0047153
528 Ga0496109_0036271
529 Ga0496110_0041927
530 Ga0496110_0292093
531 Ga0496112_0000305
532 Ga0496112_0062744
533 Ga0501067_0035189
534 Ga0501072_0122931
535 Ga0501265_002747
536 nmdc:mga03683_1809_c1
537 nmdc:mga0k408_19611_c1
538 nmdc:mga07m45_47396_c1
539 nmdc:mga07m45_84327_c1
540 nmdc:mga08y16_299911_c1
541 Ga0500658_0077950
542 2514040510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21419

RoxA-like_Cyt-c

RoxA-like, cytochrome c-like

389

425

0.9

PF00034

Cytochrom_C

Cytochrome c

337

443

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o5c-assembly2.cif.gz_C cytochrome c peroxidase bccp of shewanella oneidensis 0.7076 221 413
2c1v-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - mixed valence form 0.6988 217 413
3o5c-assembly2.cif.gz_D cytochrome c peroxidase bccp of shewanella oneidensis 0.6944 221 413
6e1c-assembly2.cif.gz_B crystal structure of a maug-like protein associated with microbial copper homeostasis 0.692 275 414
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.6891 214 414
ID Description Score Start End Superfamily
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.68 293 413 1.10.760.10
1zzhC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6441 299 414 1.10.760.10
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5554 293 413 1.10.760.10
1zzhC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.506 299 414 1.10.760.10
af_A0A0R0L707_3_129_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3103 362 410 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1D2TPE8-F1-model_v4 deleted 0.9902 71 414
AF-A0A1D2TPE8-F1-model_v4 deleted 0.9873 71 414
AF-A0A0G3BWF4-F1-model_v4 Lipoprotein 0.9867 52 414 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A5C7JDW7-F1-model_v4 C-type cytochrome 0.9847 47 414 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A0G3BWF4-F1-model_v4 Lipoprotein 0.9813 52 414 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Map