F377805

General Info

Members Datasets Scaffolds Average Seq Length
271 176 542 127

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0867071|Ga0436364_0867071_1285_1752
Length 155
Sequence MPRDAAATNTAEEESAMDALAQIKAEMLPFAELLGIEFTAAAPDRVVAELTVRVDLCTRPAVLHGGAIMAFADTLGATGTILNLPEGAGTTTIESKTNFIAAAPLGARLVGEATPVHRGRRTMVWQTRIATAEGRLVALVTQTQLVLPPASSRTR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0
Rhizoplane 1.85
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 12.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0867071 3300037853 Bacteria 1981
2 Ga0068868_100520529 3300005338 Bacteria 1044
3 Ga0070660_100264164 3300005339 Bacteria 1406
4 Ga0070661_100061043 3300005344 Bacteria 2766
5 Ga0070692_10346393 3300005345 Bacteria 922
6 Ga0070674_100039573 3300005356 Bacteria 3185
7 Ga0070673_100391086 3300005364 Bacteria 1242
8 Ga0070709_10016171 3300005434 Bacteria 4254
9 Ga0070709_10041434 3300005434 Bacteria 2837
10 Ga0070714_100020252 3300005435 Bacteria 5429
11 Ga0070714_100064801 3300005435 Bacteria 3146
12 Ga0070714_100311488 3300005435 Bacteria 1470
13 Ga0070714_100341903 3300005435 Bacteria 1404
14 Ga0070714_100592172 3300005435 Bacteria 1064
15 Ga0070714_100957495 3300005435 Unclassified 832
16 Ga0070713_101355875 3300005436 Bacteria 689
17 Ga0070710_10005055 3300005437 Bacteria 6243
18 Ga0070710_10069760 3300005437 Bacteria 2023
19 Ga0070711_100009062 3300005439 Bacteria 6113
20 Ga0070711_100087992 3300005439 Bacteria 2231
21 Ga0070711_101036442 3300005439 Bacteria 705
22 Ga0070705_100307027 3300005440 Bacteria 1139
23 Ga0070705_100311494 3300005440 Bacteria 1132
24 Ga0070694_101296650 3300005444 Bacteria 612
25 Ga0070708_100119276 3300005445 Bacteria 2431
26 Ga0070681_10250936 3300005458 Bacteria 1682
27 Ga0070706_100618125 3300005467 Bacteria 1006
28 Ga0070707_100009632 3300005468 Bacteria 8976
29 Ga0070698_100016164 3300005471 Bacteria 7880
30 Ga0070699_100433037 3300005518 Bacteria 1191
31 Ga0070699_100955753 3300005518 Unclassified 785
32 Ga0070679_100140159 3300005530 Bacteria 2398
33 Ga0070684_100008456 3300005535 Bacteria 8047
34 Ga0070672_101285614 3300005543 Bacteria 653
35 Ga0070695_100082898 3300005545 Bacteria 2124
36 Ga0070696_101603129 3300005546 Bacteria 559
37 Ga0070665_100390300 3300005548 Bacteria 1400
38 Ga0068855_100143620 3300005563 Bacteria 2718
39 Ga0068855_100418324 3300005563 Bacteria 1466
40 Ga0070664_100011370 3300005564 Bacteria 7221
41 Ga0068857_101557701 3300005577 Bacteria 645
42 Ga0068856_100293628 3300005614 Bacteria 1642
43 Ga0068856_101724455 3300005614 Unclassified 638
44 Ga0068852_101307676 3300005616 Bacteria 747
45 Ga0068859_101060059 3300005617 Unclassified 891
46 Ga0081455_10596218 3300005937 Bacteria 721
47 Ga0070717_10177175 3300006028 Unclassified 1857
48 Ga0070717_10807376 3300006028 Bacteria 853
49 Ga0075364_10214950 3300006051 Bacteria 1304
50 Ga0070715_10011350 3300006163 Unclassified 3207
51 Ga0070715_10286853 3300006163 Bacteria 875
52 Ga0070716_100140169 3300006173 Bacteria 1541
53 Ga0070712_100015820 3300006175 Bacteria 4864
54 Ga0070712_100026072 3300006175 Bacteria 3890
55 Ga0070712_100046383 3300006175 Bacteria 3004
56 Ga0070712_100089066 3300006175 Bacteria 2256
57 Ga0075362_10026678 3300006177 Bacteria 2469
58 Ga0075366_10078705 3300006195 Bacteria 1967
59 Ga0068871_100767877 3300006358 Bacteria 887
60 Ga0075428_100998251 3300006844 Unclassified 886
61 Ga0075430_100844661 3300006846 Bacteria 754
62 Ga0075431_100354726 3300006847 Bacteria 1474
63 Ga0075431_100482449 3300006847 Unclassified 1232
64 Ga0075431_101550256 3300006847 Bacteria 621
65 Ga0075429_100269994 3300006880 Bacteria 1490
66 Ga0075436_100013634 3300006914 Bacteria 5568
67 Ga0097620_101060130 3300006931 Unclassified 891
68 Ga0099795_10041964 3300007788 Bacteria 1631
69 Ga0099795_10436046 3300007788 Bacteria 601
70 Ga0105240_10409563 3300009093 Bacteria 1525
71 Ga0105245_10311102 3300009098 Bacteria 1549
72 Ga0114129_10959099 3300009147 Bacteria 1080
73 Ga0105237_10712312 3300009545 Bacteria 1010
74 Ga0105238_10046791 3300009551 Bacteria 4363
75 Ga0099796_10027272 3300010159 Bacteria 1823
76 Ga0099796_10130547 3300010159 Bacteria 974
77 Ga0105239_10081620 3300010375 Bacteria 3559
78 Ga0105246_10708082 3300011119 Bacteria 883
79 Ga0157373_10663057 3300013100 Bacteria 762
80 Ga0157371_10164289 3300013102 Bacteria 1586
81 Ga0157370_10677179 3300013104 Bacteria 942
82 Ga0157369_10179731 3300013105 Bacteria 2226
83 Ga0157378_11925322 3300013297 Bacteria 640
84 Ga0157372_10022245 3300013307 Bacteria 6860
85 Ga0163163_10045701 3300014325 Bacteria 4299
86 Ga0182008_10030066 3300014497 Bacteria 2740
87 Ga0163161_10294995 3300017792 Bacteria 1275
88 Ga0206356_10558163 3300020070 Bacteria 1209
89 Ga0206354_11623965 3300020081 Bacteria 882
90 Ga0206353_10700955 3300020082 Bacteria 637
91 Ga0213873_10002665 3300021358 Bacteria 3115
92 Ga0213874_10131062 3300021377 Bacteria 861
93 Ga0213876_10077222 3300021384 Bacteria 1759
94 Ga0213876_10527924 3300021384 Bacteria 628
95 Ga0213876_10572565 3300021384 Bacteria 601
96 Ga0213875_10000613 3300021388 Bacteria 28847
97 Ga0213875_10001159 3300021388 Bacteria 18080
98 Ga0213875_10016365 3300021388 Bacteria 3596
99 Ga0213875_10038410 3300021388 Bacteria 2256
100 Ga0213875_10095315 3300021388 Bacteria 1388
101 Ga0213875_10169427 3300021388 Bacteria 1025
102 Ga0213871_10005821 3300021441 Bacteria 2574
103 Ga0213871_10049009 3300021441 Unclassified 1153
104 Ga0228598_1026386 3300024227 Bacteria 1143
105 Ga0207426_1035115 3300025302 Bacteria 1602
106 Ga0207692_10021601 3300025898 Bacteria 2947
107 Ga0207692_10236609 3300025898 Bacteria 1089
108 Ga0207692_10270629 3300025898 Bacteria 1024
109 Ga0207647_10084257 3300025904 Bacteria 1903
110 Ga0207685_10200342 3300025905 Bacteria 937
111 Ga0207699_10015462 3300025906 Bacteria 3965
112 Ga0207684_10815202 3300025910 Bacteria 788
113 Ga0207707_10194400 3300025912 Bacteria 1770
114 Ga0207671_10291794 3300025914 Bacteria 1288
115 Ga0207693_10004350 3300025915 Bacteria 11982
116 Ga0207693_10020486 3300025915 Bacteria 5259
117 Ga0207693_10031502 3300025915 Bacteria 4189
118 Ga0207663_10012301 3300025916 Bacteria 4624
119 Ga0207663_10055437 3300025916 Bacteria 2487
120 Ga0207663_10177441 3300025916 Bacteria 1518
121 Ga0207663_10435807 3300025916 Bacteria 1008
122 Ga0207652_10160255 3300025921 Bacteria 2017
123 Ga0207646_10003603 3300025922 Bacteria 17364
124 Ga0207646_10418711 3300025922 Bacteria 1209
125 Ga0207694_10053024 3300025924 Bacteria 3144
126 Ga0207700_10440999 3300025928 Bacteria 1146
127 Ga0207664_10142310 3300025929 Bacteria 2030
128 Ga0207664_10169059 3300025929 Bacteria 1870
129 Ga0207664_10216950 3300025929 Bacteria 1657
130 Ga0207664_10249900 3300025929 Unclassified 1547
131 Ga0207664_10646687 3300025929 Unclassified 950
132 Ga0207669_10268538 3300025937 Bacteria 1280
133 Ga0207665_10021392 3300025939 Bacteria 4253
134 Ga0207661_10043595 3300025944 Bacteria 3541
135 Ga0207667_10293326 3300025949 Bacteria 1662
136 Ga0207667_10395489 3300025949 Bacteria 1407
137 Ga0207651_10666514 3300025960 Bacteria 914
138 Ga0207658_10814066 3300025986 Bacteria 848
139 Ga0207677_10667824 3300026023 Bacteria 919
140 Ga0207639_10174297 3300026041 Bacteria 1824
141 Ga0207678_10592393 3300026067 Bacteria 972
142 Ga0207702_10003721 3300026078 Bacteria 13788
143 Ga0207702_10045626 3300026078 Bacteria 3687
144 Ga0207648_10251729 3300026089 Bacteria 1575
145 Ga0207674_10229635 3300026116 Bacteria 1803
146 Ga0207698_10368548 3300026142 Bacteria 1362
147 Ga0207698_10924315 3300026142 Bacteria 880
148 Ga0268266_11081374 3300028379 Bacteria 776
149 Ga0268264_10000045 3300028381 Bacteria 364764
150 Ga0307415_102344993 3300032126 Unclassified 524
151 Ga0373926_0082527 3300035083 Bacteria 1190
152 Ga0373934_0096186 3300035086 Bacteria 1196
153 Ga0373934_0103831 3300035086 Bacteria 1150
154 Ga0373944_0082120 3300035089 Bacteria 1066
155 Ga0373923_0206717 3300035111 Bacteria 909
156 Ga0373945_0167947 3300035116 Bacteria 898
157 Ga0373953_0121332 3300035117 Bacteria 1110
158 Ga0373954_0125744 3300035118 Bacteria 1246
159 Ga0373957_0005733 3300035120 Bacteria 3870
160 Ga0373943_0290101 3300035170 Bacteria 927
161 Ga0373943_0493803 3300035170 Bacteria 715
162 Ga0373955_0130750 3300035172 Bacteria 1465
163 Ga0373962_0401153 3300035242 Unclassified 504
164 Ga0373931_0117160 3300035691 Bacteria 1518
165 Ga0373935_0006694 3300035692 Bacteria 6887
166 Ga0373935_0330892 3300035692 Bacteria 1083
167 Ga0373927_0155653 3300035695 Bacteria 1497
168 Ga0373927_0244108 3300035695 Bacteria 1180
169 Ga0373933_0144671 3300035724 Viruses 1503
170 Ga0373933_0361912 3300035724 Bacteria 943
171 Ga0373947_0084671 3300035725 Unclassified 1968
172 Ga0373947_0114101 3300035725 Bacteria 1710
173 Ga0373947_0279685 3300035725 Bacteria 1109
174 Ga0373937_0002733 3300036401 Bacteria 14719
175 Ga0373937_0076604 3300036401 Bacteria 3089
176 Ga0373937_0207218 3300036401 Unclassified 1844
177 Ga0373937_0594896 3300036401 Unclassified 1050
178 Ga0373925_0381090 3300037068 Bacteria 1148
179 Ga0373925_0804014 3300037068 Unclassified 775
180 Ga0395899_0331614 3300037312 Bacteria 1022
181 Ga0395899_0693146 3300037312 Bacteria 639
182 Ga0395900_0003356 3300037418 Bacteria 17304
183 Ga0395900_0116673 3300037418 Bacteria 2739
184 Ga0395898_1157743 3300037466 Bacteria 705
185 Ga0436364_0282094 3300037853 Bacteria 646
186 Ga0436364_0328145 3300037853 Bacteria 88179
187 Ga0436364_0534191 3300037853 Bacteria 1368
188 Ga0436364_0550031 3300037853 Bacteria 2454
189 Ga0436364_0596178 3300037853 Bacteria 2170
190 Ga0436364_0685371 3300037853 Bacteria 68284
191 Ga0436364_0799589 3300037853 Bacteria 815
192 Ga0395901_0022208 3300038443 Bacteria 6502
193 Ga0395901_0034035 3300038443 Bacteria 5260
194 Ga0436365_0502500 3300039437 Bacteria 1046
195 Ga0436365_0546134 3300039437 Bacteria 662
196 Ga0436365_0629889 3300039437 Bacteria 11786
197 Ga0436365_0932213 3300039437 Bacteria 2900
198 Ga0436365_1474955 3300039437 Bacteria 1715
199 Ga0436365_1526366 3300039437 Bacteria 4078
200 Ga0436360_1000867 3300039438 Bacteria 2253
201 Ga0436360_1105861 3300039438 Bacteria 1429
202 Ga0436360_1129418 3300039438 Unclassified 864
203 Ga0436361_0148313 3300039447 Bacteria 1821
204 Ga0436361_0219682 3300039447 Bacteria 1836
205 Ga0436361_0504206 3300039447 Bacteria 1599
206 Ga0436363_0475971 3300039450 Unclassified 1217
207 Ga0436363_0509966 3300039450 Bacteria 2454
208 Ga0436363_0554054 3300039450 Bacteria 712
209 Ga0436363_0979580 3300039450 Bacteria 1666
210 Ga0436363_1333750 3300039450 Bacteria 763
211 Ga0436363_1508018 3300039450 Unclassified 548
212 Ga0436362_0423642 3300039453 Bacteria 2354
213 Ga0436362_0520070 3300039453 Unclassified 606
214 Ga0436362_0717766 3300039453 Unclassified 595
215 Ga0436362_0918564 3300039453 Bacteria 736
216 Ga0436362_1091657 3300039453 Bacteria 7827
217 Ga0436362_1203671 3300039453 Unclassified 556
218 Ga0436362_1252691 3300039453 Bacteria 930
219 Ga0436362_1288841 3300039453 Bacteria 2296
220 Ga0451577_0371874 3300042876 Bacteria 1297
221 Ga0466971_0311586 3300044719 Unclassified 757
222 Ga0466959_0553249 3300045049 Unclassified 776
223 Ga0466967_1128279 3300045976 Bacteria 781
224 Ga0495653_0223867 3300046463 Unclassified 1263
225 Ga0495653_0351579 3300046463 Bacteria 948
226 Ga0495580_0004486 3300046472 Bacteria 11730
227 Ga0495662_0087740 3300046476 Bacteria 1515
228 Ga0495662_0651804 3300046476 Bacteria 514
229 Ga0495618_0030543 3300046514 Bacteria 3366
230 Ga0495630_0572237 3300046517 Unclassified 866
231 Ga0495665_0632360 3300046531 Bacteria 533
232 Ga0495667_0089074 3300046559 Unclassified 2001
233 Ga0495667_0098822 3300046559 Bacteria 1890
234 Ga0495656_0076766 3300046615 Bacteria 1497
235 Ga0495635_0088870 3300046663 Bacteria 2114
236 Ga0495674_0719891 3300047319 Viruses 782
237 Ga0495684_0010113 3300047471 Bacteria 7295
238 Ga0495593_0560432 3300047673 Unclassified 573
239 Ga0495602_0215396 3300048088 Bacteria 1454
240 Ga0496104_0129315 3300048907 Bacteria 2425
241 Ga0496108_1173032 3300048911 Bacteria 650
242 Ga0496110_0131583 3300048913 Bacteria 2260
243 Ga0496112_0542415 3300048915 Bacteria 1097
244 Ga0496113_0022880 3300048916 Bacteria 4427
245 Ga0501032_1027087 3300049569 Bacteria 518
246 Ga0501034_0019464 3300049571 Bacteria 6943
247 Ga0501034_0161018 3300049571 Bacteria 2215
248 Ga0501036_1240133 3300049572 Bacteria 607
249 Ga0501046_0071962 3300049580 Bacteria 2685
250 Ga0501047_0371463 3300049581 Bacteria 1265
251 Ga0501048_1113537 3300049582 Bacteria 568
252 Ga0501070_0332951 3300049586 Bacteria 1234
253 Ga0501077_0428768 3300049593 Bacteria 846
254 Ga0501035_0480106 3300049822 Bacteria 1025
255 Ga0501044_0173240 3300049823 Bacteria 2128
256 Ga0501044_0198690 3300049823 Bacteria 1964
257 nmdc:mga03683_37840_c1 3300050489 Bacteria 1968
258 nmdc:mga0k408_12548_c1 3300050493 Bacteria 4634
259 nmdc:mga05p37_1006522_c1 3300050507 Unclassified 884
260 nmdc:mga09592_242775_c1 3300050508 Bacteria 1561
261 nmdc:mga0qj67_1535619_c1 3300050509 Bacteria 512
262 nmdc:mga06r32_186611_c1 3300050510 Bacteria 2060
263 nmdc:mga06r32_531777_c1 3300050510 Unclassified 1151
264 nmdc:mga08y16_884560_c1 3300050511 Unclassified 880
265 Ga0495601_0180456 3300053077 Bacteria 1380
266 Ga0495595_0015623 3300053084 Bacteria 3239
267 Ga0495595_0103529 3300053084 Bacteria 1375
268 Ga0495619_0022240 3300053085 Bacteria 4055
269 Ga0495619_0058378 3300053085 Bacteria 2561
270 Ga0500646_0206585 3300053090 Bacteria 676
271 Ga0501082_0069280 3300060353 Bacteria 3037
272 Ga0436364_0867071
273 Ga0068868_100520529
274 Ga0070660_100264164
275 Ga0070661_100061043
276 Ga0070692_10346393
277 Ga0070674_100039573
278 Ga0070673_100391086
279 Ga0070709_10016171
280 Ga0070709_10041434
281 Ga0070714_100020252
282 Ga0070714_100064801
283 Ga0070714_100311488
284 Ga0070714_100341903
285 Ga0070714_100592172
286 Ga0070714_100957495
287 Ga0070713_101355875
288 Ga0070710_10005055
289 Ga0070710_10069760
290 Ga0070711_100009062
291 Ga0070711_100087992
292 Ga0070711_101036442
293 Ga0070705_100307027
294 Ga0070705_100311494
295 Ga0070694_101296650
296 Ga0070708_100119276
297 Ga0070681_10250936
298 Ga0070706_100618125
299 Ga0070707_100009632
300 Ga0070698_100016164
301 Ga0070699_100433037
302 Ga0070699_100955753
303 Ga0070679_100140159
304 Ga0070684_100008456
305 Ga0070672_101285614
306 Ga0070695_100082898
307 Ga0070696_101603129
308 Ga0070665_100390300
309 Ga0068855_100143620
310 Ga0068855_100418324
311 Ga0070664_100011370
312 Ga0068857_101557701
313 Ga0068856_100293628
314 Ga0068856_101724455
315 Ga0068852_101307676
316 Ga0068859_101060059
317 Ga0081455_10596218
318 Ga0070717_10177175
319 Ga0070717_10807376
320 Ga0075364_10214950
321 Ga0070715_10011350
322 Ga0070715_10286853
323 Ga0070716_100140169
324 Ga0070712_100015820
325 Ga0070712_100026072
326 Ga0070712_100046383
327 Ga0070712_100089066
328 Ga0075362_10026678
329 Ga0075366_10078705
330 Ga0068871_100767877
331 Ga0075428_100998251
332 Ga0075430_100844661
333 Ga0075431_100354726
334 Ga0075431_100482449
335 Ga0075431_101550256
336 Ga0075429_100269994
337 Ga0075436_100013634
338 Ga0097620_101060130
339 Ga0099795_10041964
340 Ga0099795_10436046
341 Ga0105240_10409563
342 Ga0105245_10311102
343 Ga0114129_10959099
344 Ga0105237_10712312
345 Ga0105238_10046791
346 Ga0099796_10027272
347 Ga0099796_10130547
348 Ga0105239_10081620
349 Ga0105246_10708082
350 Ga0157373_10663057
351 Ga0157371_10164289
352 Ga0157370_10677179
353 Ga0157369_10179731
354 Ga0157378_11925322
355 Ga0157372_10022245
356 Ga0163163_10045701
357 Ga0182008_10030066
358 Ga0163161_10294995
359 Ga0206356_10558163
360 Ga0206354_11623965
361 Ga0206353_10700955
362 Ga0213873_10002665
363 Ga0213874_10131062
364 Ga0213876_10077222
365 Ga0213876_10527924
366 Ga0213876_10572565
367 Ga0213875_10000613
368 Ga0213875_10001159
369 Ga0213875_10016365
370 Ga0213875_10038410
371 Ga0213875_10095315
372 Ga0213875_10169427
373 Ga0213871_10005821
374 Ga0213871_10049009
375 Ga0228598_1026386
376 Ga0207426_1035115
377 Ga0207692_10021601
378 Ga0207692_10236609
379 Ga0207692_10270629
380 Ga0207647_10084257
381 Ga0207685_10200342
382 Ga0207699_10015462
383 Ga0207684_10815202
384 Ga0207707_10194400
385 Ga0207671_10291794
386 Ga0207693_10004350
387 Ga0207693_10020486
388 Ga0207693_10031502
389 Ga0207663_10012301
390 Ga0207663_10055437
391 Ga0207663_10177441
392 Ga0207663_10435807
393 Ga0207652_10160255
394 Ga0207646_10003603
395 Ga0207646_10418711
396 Ga0207694_10053024
397 Ga0207700_10440999
398 Ga0207664_10142310
399 Ga0207664_10169059
400 Ga0207664_10216950
401 Ga0207664_10249900
402 Ga0207664_10646687
403 Ga0207669_10268538
404 Ga0207665_10021392
405 Ga0207661_10043595
406 Ga0207667_10293326
407 Ga0207667_10395489
408 Ga0207651_10666514
409 Ga0207658_10814066
410 Ga0207677_10667824
411 Ga0207639_10174297
412 Ga0207678_10592393
413 Ga0207702_10003721
414 Ga0207702_10045626
415 Ga0207648_10251729
416 Ga0207674_10229635
417 Ga0207698_10368548
418 Ga0207698_10924315
419 Ga0268266_11081374
420 Ga0268264_10000045
421 Ga0307415_102344993
422 Ga0373926_0082527
423 Ga0373934_0096186
424 Ga0373934_0103831
425 Ga0373944_0082120
426 Ga0373923_0206717
427 Ga0373945_0167947
428 Ga0373953_0121332
429 Ga0373954_0125744
430 Ga0373957_0005733
431 Ga0373943_0290101
432 Ga0373943_0493803
433 Ga0373955_0130750
434 Ga0373962_0401153
435 Ga0373931_0117160
436 Ga0373935_0006694
437 Ga0373935_0330892
438 Ga0373927_0155653
439 Ga0373927_0244108
440 Ga0373933_0144671
441 Ga0373933_0361912
442 Ga0373947_0084671
443 Ga0373947_0114101
444 Ga0373947_0279685
445 Ga0373937_0002733
446 Ga0373937_0076604
447 Ga0373937_0207218
448 Ga0373937_0594896
449 Ga0373925_0381090
450 Ga0373925_0804014
451 Ga0395899_0331614
452 Ga0395899_0693146
453 Ga0395900_0003356
454 Ga0395900_0116673
455 Ga0395898_1157743
456 Ga0436364_0282094
457 Ga0436364_0328145
458 Ga0436364_0534191
459 Ga0436364_0550031
460 Ga0436364_0596178
461 Ga0436364_0685371
462 Ga0436364_0799589
463 Ga0395901_0022208
464 Ga0395901_0034035
465 Ga0436365_0502500
466 Ga0436365_0546134
467 Ga0436365_0629889
468 Ga0436365_0932213
469 Ga0436365_1474955
470 Ga0436365_1526366
471 Ga0436360_1000867
472 Ga0436360_1105861
473 Ga0436360_1129418
474 Ga0436361_0148313
475 Ga0436361_0219682
476 Ga0436361_0504206
477 Ga0436363_0475971
478 Ga0436363_0509966
479 Ga0436363_0554054
480 Ga0436363_0979580
481 Ga0436363_1333750
482 Ga0436363_1508018
483 Ga0436362_0423642
484 Ga0436362_0520070
485 Ga0436362_0717766
486 Ga0436362_0918564
487 Ga0436362_1091657
488 Ga0436362_1203671
489 Ga0436362_1252691
490 Ga0436362_1288841
491 Ga0451577_0371874
492 Ga0466971_0311586
493 Ga0466959_0553249
494 Ga0466967_1128279
495 Ga0495653_0223867
496 Ga0495653_0351579
497 Ga0495580_0004486
498 Ga0495662_0087740
499 Ga0495662_0651804
500 Ga0495618_0030543
501 Ga0495630_0572237
502 Ga0495665_0632360
503 Ga0495667_0089074
504 Ga0495667_0098822
505 Ga0495656_0076766
506 Ga0495635_0088870
507 Ga0495674_0719891
508 Ga0495684_0010113
509 Ga0495593_0560432
510 Ga0495602_0215396
511 Ga0496104_0129315
512 Ga0496108_1173032
513 Ga0496110_0131583
514 Ga0496112_0542415
515 Ga0496113_0022880
516 Ga0501032_1027087
517 Ga0501034_0019464
518 Ga0501034_0161018
519 Ga0501036_1240133
520 Ga0501046_0071962
521 Ga0501047_0371463
522 Ga0501048_1113537
523 Ga0501070_0332951
524 Ga0501077_0428768
525 Ga0501035_0480106
526 Ga0501044_0173240
527 Ga0501044_0198690
528 nmdc:mga03683_37840_c1
529 nmdc:mga0k408_12548_c1
530 nmdc:mga05p37_1006522_c1
531 nmdc:mga09592_242775_c1
532 nmdc:mga0qj67_1535619_c1
533 nmdc:mga06r32_186611_c1
534 nmdc:mga06r32_531777_c1
535 nmdc:mga08y16_884560_c1
536 Ga0495601_0180456
537 Ga0495595_0015623
538 Ga0495595_0103529
539 Ga0495619_0022240
540 Ga0495619_0058378
541 Ga0500646_0206585
542 Ga0501082_0069280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

61

138

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9502 14 125
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9413 12 124
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9365 12 123
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.9302 4 125
2cwz-assembly2.cif.gz_D crystal structure of the thermus thermophilus hypothetical protein ttha0967, a thioesterase superfamily member 0.9263 29 125
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.94 12 124 3.10.129.10
af_I1N3I1_40_174_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9341 14 125 3.10.129.10
af_Q9W440_48_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9299 66 124 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9231 8 125 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.908 11 125 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1Q3LHB0-F1-model_v4 Phenylacetic acid degradation protein 0.9909 2 125 GO:0005829
GO:0061522
AF-A0A2H5YHT7-F1-model_v4 Esterase (EC 3.1.2.-) 0.9864 34 125 GO:0047617
AF-A0A521MF99-F1-model_v4 PaaI family thioesterase 0.9812 1 125 GO:0005829
GO:0061522
AF-A0A2E8PCW4-F1-model_v4 deleted 0.9805 12 125
AF-A0A099FGE6-F1-model_v4 Phenylacetic acid degradation protein 0.9798 11 125 GO:0005829
GO:0061522

Map