F377799

General Info

Members Datasets Scaffolds Average Seq Length
271 154 542 114

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1024125|Ga0395900_1024125_91_492
Length 133
Sequence VGDAQGRGGRSAGRGRVGRIDVVNLTRDAQPFTTKDGSTIRELMHTDAQSLAEATLAPGQGTERHYHALSEELYFFLEGGGEMEIDGETRAVHHGDTVLIPPGARHSIVAGKSGARFLCXXXPPYSHDDTYFD

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
66 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
67 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
68 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.8
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_1024125 3300037418 Bacteria 745
2 Ga0070683_100015094 3300005329 Bacteria 6778
3 Ga0070691_10742708 3300005341 Bacteria 593
4 Ga0070661_100265529 3300005344 Bacteria 1328
5 Ga0070661_101024678 3300005344 Unclassified 685
6 Ga0070673_101540868 3300005364 Bacteria 627
7 Ga0070659_100069553 3300005366 Bacteria 2795
8 Ga0070703_10447060 3300005406 Bacteria 572
9 Ga0070709_10037772 3300005434 Bacteria 2951
10 Ga0070709_11268229 3300005434 Unclassified 594
11 Ga0070713_100029373 3300005436 Bacteria 4354
12 Ga0070713_100305424 3300005436 Bacteria 1466
13 Ga0070711_100717045 3300005439 Bacteria 843
14 Ga0070705_100006797 3300005440 Bacteria 5626
15 Ga0070708_100644907 3300005445 Bacteria 998
16 Ga0070698_100058619 3300005471 Bacteria 3892
17 Ga0070698_100377672 3300005471 Bacteria 1350
18 Ga0070699_100131821 3300005518 Bacteria 2203
19 Ga0070679_100741791 3300005530 Bacteria 925
20 Ga0070679_101012026 3300005530 Unclassified 775
21 Ga0070684_100180835 3300005535 Bacteria 1917
22 Ga0070684_100236616 3300005535 Bacteria 1668
23 Ga0068855_100721888 3300005563 Bacteria 1065
24 Ga0070664_100520395 3300005564 Bacteria 1098
25 Ga0081455_10176968 3300005937 Bacteria 1619
26 Ga0070717_10009236 3300006028 Bacteria 7410
27 Ga0070717_11506988 3300006028 Bacteria 610
28 Ga0075428_101228217 3300006844 Bacteria 790
29 Ga0075433_10136392 3300006852 Bacteria 2181
30 Ga0075434_100131785 3300006871 Bacteria 2519
31 Ga0075436_100011959 3300006914 Bacteria 5952
32 Ga0075435_100124640 3300007076 Bacteria 2152
33 Ga0105240_10108100 3300009093 Bacteria 3370
34 Ga0111539_10045142 3300009094 Bacteria 5276
35 Ga0111539_10626179 3300009094 Bacteria 1253
36 Ga0105245_10274666 3300009098 Bacteria 1645
37 Ga0114129_10004388 3300009147 Bacteria 19896
38 Ga0114129_10181520 3300009147 Bacteria 2863
39 Ga0114129_11267972 3300009147 Bacteria 915
40 Ga0114129_11796506 3300009147 Bacteria 746
41 Ga0114129_12234411 3300009147 Bacteria 658
42 Ga0114129_13371382 3300009147 Unclassified 515
43 Ga0105239_10024265 3300010375 Bacteria 6679
44 Ga0157369_10887656 3300013105 Bacteria 914
45 Ga0157372_10289888 3300013307 Bacteria 1904
46 Ga0157380_10289564 3300014326 Bacteria 1503
47 Ga0182008_10340344 3300014497 Unclassified 793
48 Ga0197907_11476587 3300020069 Bacteria 607
49 Ga0207688_10029077 3300025901 Bacteria 3041
50 Ga0207695_10350883 3300025913 Bacteria 1363
51 Ga0207663_10986657 3300025916 Bacteria 675
52 Ga0207649_10441056 3300025920 Bacteria 981
53 Ga0207652_10651480 3300025921 Unclassified 942
54 Ga0207652_10920610 3300025921 Unclassified 771
55 Ga0207687_10353499 3300025927 Bacteria 1198
56 Ga0207700_10072096 3300025928 Bacteria 2662
57 Ga0207664_10343274 3300025929 Bacteria 1320
58 Ga0207706_10007375 3300025933 Bacteria 10165
59 Ga0207665_11134873 3300025939 Unclassified 623
60 Ga0207661_10039502 3300025944 Bacteria 3704
61 Ga0207679_10473632 3300025945 Bacteria 1114
62 Ga0207667_10241585 3300025949 Bacteria 1848
63 Ga0207651_10088387 3300025960 Bacteria 2259
64 Ga0207668_10754370 3300025972 Unclassified 859
65 Ga0207640_10422531 3300025981 Bacteria 1091
66 Ga0207428_11053317 3300027907 Bacteria 570
67 Ga0307413_10672665 3300031824 Bacteria 856
68 Ga0307414_10016313 3300032004 Bacteria 4512
69 Ga0373934_0133469 3300035086 Bacteria 1013
70 Ga0373936_0219652 3300035113 Bacteria 843
71 Ga0373953_0266150 3300035117 Bacteria 746
72 Ga0373943_0127649 3300035170 Bacteria 1358
73 Ga0373933_0150026 3300035724 Bacteria 1476
74 Ga0373937_0001174 3300036401 Bacteria 22003
75 Ga0395899_0040595 3300037312 Bacteria 3480
76 Ga0395899_0057530 3300037312 Bacteria 2870
77 Ga0395899_0098994 3300037312 Bacteria 2107
78 Ga0395899_0270400 3300037312 Bacteria 1159
79 Ga0395899_0699197 3300037312 Unclassified 636
80 Ga0395900_0021256 3300037418 Bacteria 6635
81 Ga0395900_0029564 3300037418 Bacteria 5621
82 Ga0395900_0197978 3300037418 Bacteria 2034
83 Ga0395900_0537094 3300037418 Bacteria 1115
84 Ga0395900_0755456 3300037418 Unclassified 902
85 Ga0395898_0009389 3300037466 Bacteria 10274
86 Ga0395898_0025341 3300037466 Bacteria 5977
87 Ga0395898_0032405 3300037466 Bacteria 5216
88 Ga0395898_0379692 3300037466 Bacteria 1348
89 Ga0395898_0450630 3300037466 Bacteria 1225
90 Ga0395905_0004274 3300037471 Bacteria 14898
91 Ga0395905_0179420 3300037471 Bacteria 1988
92 Ga0395905_0223639 3300037471 Unclassified 1761
93 Ga0395905_0348128 3300037471 Bacteria 1373
94 Ga0395905_0980144 3300037471 Bacteria 748
95 Ga0395905_0998528 3300037471 Unclassified 740
96 Ga0395901_0059447 3300038443 Bacteria 3976
97 Ga0395901_0085668 3300038443 Bacteria 3294
98 Ga0395901_0099884 3300038443 Bacteria 3043
99 Ga0395901_0268011 3300038443 Bacteria 1777
100 Ga0242420_071758 3300038996 Bacteria 705
101 Ga0439456_068464 3300042013 Bacteria 785
102 Ga0439463_163738 3300042016 Unclassified 577
103 Ga0439460_0127215 3300042461 Bacteria 837
104 Ga0451577_0001519 3300042876 Bacteria 30577
105 Ga0466966_0742975 3300044684 Unclassified 591
106 Ga0466963_0001079 3300044694 Bacteria 14245
107 Ga0466957_0031106 3300044842 Bacteria 3189
108 Ga0466958_0004493 3300045836 Bacteria 7367
109 Ga0466958_0804102 3300045836 Unclassified 613
110 Ga0466967_0000042 3300045976 Bacteria 45895
111 Ga0466967_0775326 3300045976 Bacteria 951
112 Ga0466967_2491438 3300045976 Unclassified 512
113 Ga0495592_0001132 3300046454 Bacteria 18548
114 Ga0495592_0562761 3300046454 Bacteria 699
115 Ga0495651_0000916 3300046462 Bacteria 22898
116 Ga0495651_0288220 3300046462 Bacteria 1106
117 Ga0495651_0379966 3300046462 Bacteria 926
118 Ga0495653_0009559 3300046463 Bacteria 7931
119 Ga0495653_0097276 3300046463 Bacteria 2139
120 Ga0495653_0221016 3300046463 Bacteria 1273
121 Ga0495664_0163887 3300046477 Bacteria 1349
122 Ga0495664_0263383 3300046477 Bacteria 1042
123 Ga0495608_0006157 3300046511 Bacteria 8518
124 Ga0495608_0316854 3300046511 Bacteria 964
125 Ga0495618_0011739 3300046514 Bacteria 5318
126 Ga0495618_0027418 3300046514 Bacteria 3546
127 Ga0495628_0001072 3300046516 Bacteria 25092
128 Ga0495630_0033952 3300046517 Bacteria 3806
129 Ga0495630_0612630 3300046517 Bacteria 834
130 Ga0495652_0007424 3300046529 Bacteria 10107
131 Ga0495587_0000220 3300046536 Bacteria 42423
132 Ga0495587_0268929 3300046536 Bacteria 957
133 Ga0495645_0000706 3300046543 Bacteria 22898
134 Ga0495667_0076056 3300046559 Bacteria 2184
135 Ga0495634_0143146 3300046642 Bacteria 1517
136 Ga0495635_0150587 3300046663 Bacteria 1584
137 Ga0495659_0063776 3300046664 Bacteria 1367
138 Ga0495657_0023558 3300046675 Bacteria 4397
139 Ga0495657_0081032 3300046675 Bacteria 2100
140 Ga0495599_0000198 3300046678 Bacteria 40015
141 Ga0495599_0352958 3300046678 Bacteria 881
142 Ga0495623_0000661 3300046679 Bacteria 22896
143 Ga0495646_0002159 3300046680 Bacteria 11967
144 Ga0495646_0595871 3300046680 Bacteria 562
145 Ga0495600_0457685 3300046809 Bacteria 788
146 Ga0495604_0006194 3300047317 Bacteria 9496
147 Ga0495674_0054086 3300047319 Bacteria 3527
148 Ga0495674_0094183 3300047319 Bacteria 2555
149 Ga0495680_0011878 3300047322 Bacteria 7684
150 Ga0495680_0052809 3300047322 Bacteria 3167
151 Ga0495675_0000397 3300047444 Bacteria 30165
152 Ga0495684_0112083 3300047471 Bacteria 2058
153 Ga0495602_0001486 3300048088 Bacteria 23321
154 Ga0495602_0825727 3300048088 Bacteria 621
155 Ga0496102_0861492 3300048905 Bacteria 828
156 Ga0496103_0348489 3300048906 Bacteria 952
157 Ga0496103_0510850 3300048906 Bacteria 768
158 Ga0496106_0003112 3300048909 Bacteria 12393
159 Ga0496107_0008188 3300048910 Bacteria 7228
160 Ga0496109_0568583 3300048912 Bacteria 1069
161 Ga0496110_0134886 3300048913 Bacteria 2230
162 Ga0496110_1867357 3300048913 Bacteria 511
163 Ga0496111_0166246 3300048914 Bacteria 1638
164 Ga0496112_1249274 3300048915 Bacteria 659
165 Ga0496112_1536100 3300048915 Unclassified 579
166 Ga0496113_0064546 3300048916 Bacteria 2769
167 Ga0496113_0215347 3300048916 Bacteria 1530
168 Ga0501031_0008673 3300049568 Bacteria 6610
169 Ga0501031_0293844 3300049568 Bacteria 1053
170 Ga0501032_0032900 3300049569 Bacteria 3553
171 Ga0501032_0101646 3300049569 Bacteria 1905
172 Ga0501032_0193207 3300049569 Bacteria 1330
173 Ga0501033_0026875 3300049570 Bacteria 4330
174 Ga0501033_0968023 3300049570 Bacteria 570
175 Ga0501034_0327530 3300049571 Bacteria 1464
176 Ga0501036_0188737 3300049572 Bacteria 1734
177 Ga0501037_0012049 3300049573 Bacteria 6367
178 Ga0501037_0057194 3300049573 Bacteria 2848
179 Ga0501037_0771551 3300049573 Bacteria 636
180 Ga0501038_0121390 3300049574 Bacteria 2154
181 Ga0501038_0280890 3300049574 Bacteria 1311
182 Ga0501038_0572341 3300049574 Bacteria 857
183 Ga0501038_0884447 3300049574 Bacteria 660
184 Ga0501039_0003980 3300049575 Bacteria 11107
185 Ga0501039_0015165 3300049575 Bacteria 5897
186 Ga0501039_0321863 3300049575 Unclassified 1215
187 Ga0501040_0004421 3300049576 Bacteria 9132
188 Ga0501040_0009456 3300049576 Bacteria 6358
189 Ga0501040_0119217 3300049576 Bacteria 1851
190 Ga0501041_0000935 3300049577 Bacteria 15818
191 Ga0501041_0003479 3300049577 Bacteria 9062
192 Ga0501041_0892907 3300049577 Bacteria 571
193 Ga0501042_0013040 3300049578 Bacteria 5649
194 Ga0501042_0209180 3300049578 Bacteria 1407
195 Ga0501042_0245247 3300049578 Bacteria 1292
196 Ga0501042_0642528 3300049578 Bacteria 771
197 Ga0501043_0017856 3300049579 Bacteria 5563
198 Ga0501046_0010019 3300049580 Bacteria 8163
199 Ga0501047_0542027 3300049581 Bacteria 988
200 Ga0501048_0026568 3300049582 Bacteria 4215
201 Ga0501048_0112759 3300049582 Bacteria 1920
202 Ga0501067_0015550 3300049583 Bacteria 4212
203 Ga0501067_0089052 3300049583 Bacteria 1713
204 Ga0501068_0002497 3300049584 Bacteria 9771
205 Ga0501068_0059132 3300049584 Bacteria 2327
206 Ga0501068_0147146 3300049584 Bacteria 1479
207 Ga0501068_0458427 3300049584 Bacteria 825
208 Ga0501069_0041385 3300049585 Bacteria 2547
209 Ga0501069_0518504 3300049585 Bacteria 712
210 Ga0501070_0056306 3300049586 Bacteria 3259
211 Ga0501070_0269867 3300049586 Unclassified 1390
212 Ga0501070_1373224 3300049586 Bacteria 538
213 Ga0501071_0001433 3300049587 Bacteria 13759
214 Ga0501071_0004587 3300049587 Bacteria 8763
215 Ga0501072_0007436 3300049588 Bacteria 8310
216 Ga0501072_0014225 3300049588 Bacteria 6097
217 Ga0501073_0020562 3300049589 Bacteria 4760
218 Ga0501073_0185668 3300049589 Bacteria 1439
219 Ga0501073_0200309 3300049589 Unclassified 1381
220 Ga0501074_0159611 3300049590 Bacteria 1610
221 Ga0501075_0008828 3300049591 Bacteria 7027
222 Ga0501075_0038564 3300049591 Bacteria 3572
223 Ga0501075_0367744 3300049591 Bacteria 1096
224 Ga0501075_0398577 3300049591 Unclassified 1049
225 Ga0501076_0005866 3300049592 Bacteria 8858
226 Ga0501076_0062248 3300049592 Bacteria 2971
227 Ga0501076_0247669 3300049592 Bacteria 1458
228 Ga0501076_0404519 3300049592 Bacteria 1122
229 Ga0501077_0001642 3300049593 Bacteria 13438
230 Ga0501077_0022005 3300049593 Bacteria 4037
231 Ga0501079_0048321 3300049741 Bacteria 3283
232 Ga0501079_0253516 3300049741 Unclassified 1375
233 Ga0501079_0777364 3300049741 Unclassified 754
234 Ga0501080_0004576 3300049742 Bacteria 12326
235 Ga0501081_0018051 3300049743 Bacteria 4680
236 Ga0501081_0118971 3300049743 Bacteria 1880
237 Ga0501081_0198760 3300049743 Bacteria 1453
238 Ga0501081_0423504 3300049743 Unclassified 987
239 Ga0501083_0087086 3300049744 Bacteria 2065
240 Ga0501035_0003699 3300049822 Bacteria 14580
241 Ga0501035_0084233 3300049822 Bacteria 2804
242 Ga0501045_0005677 3300049824 Bacteria 8636
243 Ga0501045_0008046 3300049824 Bacteria 7345
244 Ga0501045_0461986 3300049824 Unclassified 943
245 Ga0501045_0628343 3300049824 Bacteria 794
246 nmdc:mga05p37_1065247_c1 3300050507 Bacteria 851
247 nmdc:mga05p37_188898_c1 3300050507 Bacteria 2503
248 nmdc:mga05p37_71803_c2 3300050507 Bacteria 2863
249 nmdc:mga06r32_527805_c1 3300050510 Unclassified 1156
250 nmdc:mga08y16_26396_c1 3300050511 Bacteria 6124
251 nmdc:mga08y16_651603_c1 3300050511 Bacteria 1057
252 nmdc:mga08y16_82461_c1 3300050511 Bacteria 3352
253 nmdc:mga0n895_24597_c1 3300050512 Bacteria 5678
254 nmdc:mga0rr50_161701_c1 3300050513 Bacteria 1818
255 nmdc:mga08x19_83685_c1 3300050514 Bacteria 2098
256 nmdc:mga0a205_603561_c1 3300050515 Unclassified 951
257 Ga0495601_0000554 3300053077 Bacteria 19791
258 Ga0495601_0082797 3300053077 Bacteria 2060
259 Ga0495601_1027769 3300053077 Unclassified 517
260 Ga0495595_0031095 3300053084 Bacteria 2398
261 Ga0495619_0007210 3300053085 Bacteria 7043
262 Ga0495619_0034052 3300053085 Bacteria 3310
263 Ga0495619_0072725 3300053085 Bacteria 2303
264 Ga0501084_0009982 3300054114 Bacteria 7846
265 Ga0501084_0013656 3300054114 Bacteria 6721
266 Ga0501084_0205795 3300054114 Bacteria 1661
267 Ga0501082_0003891 3300060353 Bacteria 13040
268 Ga0501082_0981336 3300060353 Bacteria 739
269 Ga0530510_0023489 3300061734 Bacteria 4394
270 Ga0530510_0050144 3300061734 Bacteria 3015
271 Ga0530510_0060802 3300061734 Bacteria 2734
272 Ga0395900_1024125
273 Ga0070683_100015094
274 Ga0070691_10742708
275 Ga0070661_100265529
276 Ga0070661_101024678
277 Ga0070673_101540868
278 Ga0070659_100069553
279 Ga0070703_10447060
280 Ga0070709_10037772
281 Ga0070709_11268229
282 Ga0070713_100029373
283 Ga0070713_100305424
284 Ga0070711_100717045
285 Ga0070705_100006797
286 Ga0070708_100644907
287 Ga0070698_100058619
288 Ga0070698_100377672
289 Ga0070699_100131821
290 Ga0070679_100741791
291 Ga0070679_101012026
292 Ga0070684_100180835
293 Ga0070684_100236616
294 Ga0068855_100721888
295 Ga0070664_100520395
296 Ga0081455_10176968
297 Ga0070717_10009236
298 Ga0070717_11506988
299 Ga0075428_101228217
300 Ga0075433_10136392
301 Ga0075434_100131785
302 Ga0075436_100011959
303 Ga0075435_100124640
304 Ga0105240_10108100
305 Ga0111539_10045142
306 Ga0111539_10626179
307 Ga0105245_10274666
308 Ga0114129_10004388
309 Ga0114129_10181520
310 Ga0114129_11267972
311 Ga0114129_11796506
312 Ga0114129_12234411
313 Ga0114129_13371382
314 Ga0105239_10024265
315 Ga0157369_10887656
316 Ga0157372_10289888
317 Ga0157380_10289564
318 Ga0182008_10340344
319 Ga0197907_11476587
320 Ga0207688_10029077
321 Ga0207695_10350883
322 Ga0207663_10986657
323 Ga0207649_10441056
324 Ga0207652_10651480
325 Ga0207652_10920610
326 Ga0207687_10353499
327 Ga0207700_10072096
328 Ga0207664_10343274
329 Ga0207706_10007375
330 Ga0207665_11134873
331 Ga0207661_10039502
332 Ga0207679_10473632
333 Ga0207667_10241585
334 Ga0207651_10088387
335 Ga0207668_10754370
336 Ga0207640_10422531
337 Ga0207428_11053317
338 Ga0307413_10672665
339 Ga0307414_10016313
340 Ga0373934_0133469
341 Ga0373936_0219652
342 Ga0373953_0266150
343 Ga0373943_0127649
344 Ga0373933_0150026
345 Ga0373937_0001174
346 Ga0395899_0040595
347 Ga0395899_0057530
348 Ga0395899_0098994
349 Ga0395899_0270400
350 Ga0395899_0699197
351 Ga0395900_0021256
352 Ga0395900_0029564
353 Ga0395900_0197978
354 Ga0395900_0537094
355 Ga0395900_0755456
356 Ga0395898_0009389
357 Ga0395898_0025341
358 Ga0395898_0032405
359 Ga0395898_0379692
360 Ga0395898_0450630
361 Ga0395905_0004274
362 Ga0395905_0179420
363 Ga0395905_0223639
364 Ga0395905_0348128
365 Ga0395905_0980144
366 Ga0395905_0998528
367 Ga0395901_0059447
368 Ga0395901_0085668
369 Ga0395901_0099884
370 Ga0395901_0268011
371 Ga0242420_071758
372 Ga0439456_068464
373 Ga0439463_163738
374 Ga0439460_0127215
375 Ga0451577_0001519
376 Ga0466966_0742975
377 Ga0466963_0001079
378 Ga0466957_0031106
379 Ga0466958_0004493
380 Ga0466958_0804102
381 Ga0466967_0000042
382 Ga0466967_0775326
383 Ga0466967_2491438
384 Ga0495592_0001132
385 Ga0495592_0562761
386 Ga0495651_0000916
387 Ga0495651_0288220
388 Ga0495651_0379966
389 Ga0495653_0009559
390 Ga0495653_0097276
391 Ga0495653_0221016
392 Ga0495664_0163887
393 Ga0495664_0263383
394 Ga0495608_0006157
395 Ga0495608_0316854
396 Ga0495618_0011739
397 Ga0495618_0027418
398 Ga0495628_0001072
399 Ga0495630_0033952
400 Ga0495630_0612630
401 Ga0495652_0007424
402 Ga0495587_0000220
403 Ga0495587_0268929
404 Ga0495645_0000706
405 Ga0495667_0076056
406 Ga0495634_0143146
407 Ga0495635_0150587
408 Ga0495659_0063776
409 Ga0495657_0023558
410 Ga0495657_0081032
411 Ga0495599_0000198
412 Ga0495599_0352958
413 Ga0495623_0000661
414 Ga0495646_0002159
415 Ga0495646_0595871
416 Ga0495600_0457685
417 Ga0495604_0006194
418 Ga0495674_0054086
419 Ga0495674_0094183
420 Ga0495680_0011878
421 Ga0495680_0052809
422 Ga0495675_0000397
423 Ga0495684_0112083
424 Ga0495602_0001486
425 Ga0495602_0825727
426 Ga0496102_0861492
427 Ga0496103_0348489
428 Ga0496103_0510850
429 Ga0496106_0003112
430 Ga0496107_0008188
431 Ga0496109_0568583
432 Ga0496110_0134886
433 Ga0496110_1867357
434 Ga0496111_0166246
435 Ga0496112_1249274
436 Ga0496112_1536100
437 Ga0496113_0064546
438 Ga0496113_0215347
439 Ga0501031_0008673
440 Ga0501031_0293844
441 Ga0501032_0032900
442 Ga0501032_0101646
443 Ga0501032_0193207
444 Ga0501033_0026875
445 Ga0501033_0968023
446 Ga0501034_0327530
447 Ga0501036_0188737
448 Ga0501037_0012049
449 Ga0501037_0057194
450 Ga0501037_0771551
451 Ga0501038_0121390
452 Ga0501038_0280890
453 Ga0501038_0572341
454 Ga0501038_0884447
455 Ga0501039_0003980
456 Ga0501039_0015165
457 Ga0501039_0321863
458 Ga0501040_0004421
459 Ga0501040_0009456
460 Ga0501040_0119217
461 Ga0501041_0000935
462 Ga0501041_0003479
463 Ga0501041_0892907
464 Ga0501042_0013040
465 Ga0501042_0209180
466 Ga0501042_0245247
467 Ga0501042_0642528
468 Ga0501043_0017856
469 Ga0501046_0010019
470 Ga0501047_0542027
471 Ga0501048_0026568
472 Ga0501048_0112759
473 Ga0501067_0015550
474 Ga0501067_0089052
475 Ga0501068_0002497
476 Ga0501068_0059132
477 Ga0501068_0147146
478 Ga0501068_0458427
479 Ga0501069_0041385
480 Ga0501069_0518504
481 Ga0501070_0056306
482 Ga0501070_0269867
483 Ga0501070_1373224
484 Ga0501071_0001433
485 Ga0501071_0004587
486 Ga0501072_0007436
487 Ga0501072_0014225
488 Ga0501073_0020562
489 Ga0501073_0185668
490 Ga0501073_0200309
491 Ga0501074_0159611
492 Ga0501075_0008828
493 Ga0501075_0038564
494 Ga0501075_0367744
495 Ga0501075_0398577
496 Ga0501076_0005866
497 Ga0501076_0062248
498 Ga0501076_0247669
499 Ga0501076_0404519
500 Ga0501077_0001642
501 Ga0501077_0022005
502 Ga0501079_0048321
503 Ga0501079_0253516
504 Ga0501079_0777364
505 Ga0501080_0004576
506 Ga0501081_0018051
507 Ga0501081_0118971
508 Ga0501081_0198760
509 Ga0501081_0423504
510 Ga0501083_0087086
511 Ga0501035_0003699
512 Ga0501035_0084233
513 Ga0501045_0005677
514 Ga0501045_0008046
515 Ga0501045_0461986
516 Ga0501045_0628343
517 nmdc:mga05p37_1065247_c1
518 nmdc:mga05p37_188898_c1
519 nmdc:mga05p37_71803_c2
520 nmdc:mga06r32_527805_c1
521 nmdc:mga08y16_26396_c1
522 nmdc:mga08y16_651603_c1
523 nmdc:mga08y16_82461_c1
524 nmdc:mga0n895_24597_c1
525 nmdc:mga0rr50_161701_c1
526 nmdc:mga08x19_83685_c1
527 nmdc:mga0a205_603561_c1
528 Ga0495601_0000554
529 Ga0495601_0082797
530 Ga0495601_1027769
531 Ga0495595_0031095
532 Ga0495619_0007210
533 Ga0495619_0034052
534 Ga0495619_0072725
535 Ga0501084_0009982
536 Ga0501084_0013656
537 Ga0501084_0205795
538 Ga0501082_0003891
539 Ga0501082_0981336
540 Ga0530510_0023489
541 Ga0530510_0050144
542 Ga0530510_0060802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

52

121

0.91

PF02311

AraC_binding

AraC-like ligand binding domain

48

125

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9807 23 110
7x85-assembly2.cif.gz_C crystal structure of chicken cenp-c cupin domain 0.9346 13 106
5efu-assembly1.cif.gz_A resting state of rat cysteine dioxygenase h155q variant 0.933 30 109
4q0u-assembly1.cif.gz_A crystal structure of acinetobacter sp. dl28 l-ribose isomerase mutant e204q in complex with l-ribose 0.9315 21 106
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.9313 8 106
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9751 21 106 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9726 23 117 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9633 4 116 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9629 1 117 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.955 1 117 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V5NF80-F1-model_v4 Cupin type-2 domain-containing protein 0.9954 25 117
AF-A0A0S7WRK2-F1-model_v4 Cupin type-2 domain-containing protein 0.995 4 117
AF-B8GQI5-F1-model_v4 Conserved hypothetical phosphomannose protein 0.9933 5 117
AF-A0A3L7RFQ8-F1-model_v4 Cupin domain-containing protein 0.9932 4 117
AF-A0A4Q5NX05-F1-model_v4 Cupin domain-containing protein 0.9901 23 117

Map