F377744

General Info

Members Datasets Scaffolds Average Seq Length
271 195 542 262

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100452318|Ga0307408_1004523181
Length 235
Sequence MLACGLIWLGPAPGLKAEVLDVPALIAVESPAEPFGLPASILSGGGVLQKWLGLQRRLDDELVQLALCDGDRDGCVSPAALKLLAIVDAARAREGRARYGEINRAINLDVWASPLLTFSRGAGDCEDYAIAKLVALRLAGIAPGDLRIVIVHDFVRGEDHAIAAAKLDGRWLTLDNRRMAMVEDVDARHYRPIFVIDRDHAKRYEAAPLLAAMPRPVPPATLSIALAPGFIAPAN

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
180 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
181 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
182 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
185 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
186 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
187 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
188 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
189 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
190 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
191 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
192 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
193 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
194 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
195 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.02
Nodule 3.69
Rhizoplane 9.23
Rhizosphere 66.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100452318 3300031548 Bacteria 1114
2 rootH2_10021614 3300003320 Bacteria 2265
3 rootL2_10044177 3300003322 Bacteria 2994
4 rootL2_10108614 3300003322 Bacteria 1837
5 rootH1_10193052 3300003323 Bacteria 2331
6 Ga0068869_100335364 3300005334 Bacteria 1229
7 Ga0070682_100131500 3300005337 Bacteria 1694
8 Ga0070682_100180012 3300005337 Bacteria 1476
9 Ga0070682_100345745 3300005337 Bacteria 1107
10 Ga0070687_100224370 3300005343 Bacteria 1153
11 Ga0070661_100071388 3300005344 Bacteria 2555
12 Ga0070668_100055027 3300005347 Bacteria 3070
13 Ga0070668_100275971 3300005347 Bacteria 1402
14 Ga0070669_100187608 3300005353 Bacteria 1621
15 Ga0070671_100074177 3300005355 Bacteria 2842
16 Ga0070674_100237397 3300005356 Bacteria 1425
17 Ga0070688_100024184 3300005365 Bacteria 3580
18 Ga0070659_100262698 3300005366 Bacteria 1432
19 Ga0070667_100107245 3300005367 Bacteria 2418
20 Ga0070667_100207979 3300005367 Bacteria 1738
21 Ga0070708_100308206 3300005445 Bacteria 1491
22 Ga0070663_100003662 3300005455 Bacteria 8901
23 Ga0070663_100046207 3300005455 Bacteria 3080
24 Ga0070663_100052829 3300005455 Bacteria 2899
25 Ga0070706_100302578 3300005467 Bacteria 1492
26 Ga0070698_100095294 3300005471 Bacteria 2954
27 Ga0070699_100250708 3300005518 Bacteria 1581
28 Ga0070684_100045285 3300005535 Bacteria 3810
29 Ga0070697_100277392 3300005536 Bacteria 1438
30 Ga0068853_100531486 3300005539 Bacteria 1112
31 Ga0070695_100055766 3300005545 Bacteria 2548
32 Ga0070665_100006516 3300005548 Bacteria 11868
33 Ga0070665_100029032 3300005548 Bacteria 5567
34 Ga0070665_100029422 3300005548 Bacteria 5529
35 Ga0070665_100076396 3300005548 Bacteria 3356
36 Ga0070665_100150857 3300005548 Bacteria 2327
37 Ga0070664_100099604 3300005564 Bacteria 2526
38 Ga0070664_100120306 3300005564 Bacteria 2298
39 Ga0070664_100472400 3300005564 Bacteria 1153
40 Ga0068857_100058176 3300005577 Bacteria 3432
41 Ga0068856_100007648 3300005614 Bacteria 10544
42 Ga0068856_100145701 3300005614 Bacteria 2376
43 Ga0070702_100154400 3300005615 Bacteria 1477
44 Ga0068852_100056790 3300005616 Bacteria 3385
45 Ga0068859_100017338 3300005617 Bacteria 7233
46 Ga0068859_100130974 3300005617 Bacteria 2579
47 Ga0068859_100193652 3300005617 Bacteria 2117
48 Ga0068866_10064118 3300005718 Bacteria 1917
49 Ga0068861_100064938 3300005719 Bacteria 2809
50 Ga0068858_100089362 3300005842 Bacteria 2866
51 Ga0068862_100058024 3300005844 Bacteria 3320
52 Ga0068862_100208644 3300005844 Bacteria 1764
53 Ga0081455_10027193 3300005937 Bacteria 5244
54 Ga0081455_10125339 3300005937 Bacteria 2017
55 Ga0081538_10141726 3300005981 Bacteria 1107
56 Ga0081540_1001660 3300005983 Bacteria 18929
57 Ga0081540_1007986 3300005983 Bacteria 7452
58 Ga0081540_1011467 3300005983 Bacteria 5920
59 Ga0081540_1038460 3300005983 Bacteria 2522
60 Ga0081539_10072883 3300005985 Bacteria 1834
61 Ga0075365_10060892 3300006038 Bacteria 2519
62 Ga0075365_10094407 3300006038 Bacteria 2042
63 Ga0075365_10133107 3300006038 Bacteria 1721
64 Ga0075368_10014177 3300006042 Bacteria 2940
65 Ga0075363_100008062 3300006048 Bacteria 4885
66 Ga0075364_10068464 3300006051 Bacteria 2334
67 Ga0075364_10220634 3300006051 Bacteria 1287
68 Ga0075367_10106409 3300006178 Bacteria 1719
69 Ga0075367_10115529 3300006178 Bacteria 1650
70 Ga0075367_10157535 3300006178 Bacteria 1411
71 Ga0075369_10004431 3300006186 Bacteria 5185
72 Ga0075369_10016152 3300006186 Bacteria 3007
73 Ga0097621_100054190 3300006237 Bacteria 3270
74 Ga0075370_10003353 3300006353 Bacteria 7611
75 Ga0075370_10135141 3300006353 Bacteria 1440
76 Ga0068871_100187617 3300006358 Bacteria 1779
77 Ga0075428_100090532 3300006844 Bacteria 3337
78 Ga0075433_10221918 3300006852 Bacteria 1679
79 Ga0068865_100064386 3300006881 Bacteria 2580
80 Ga0097620_100017338 3300006931 Bacteria 7233
81 Ga0097620_100130971 3300006931 Bacteria 2579
82 Ga0097620_100193645 3300006931 Bacteria 2117
83 Ga0075435_100089252 3300007076 Bacteria 2541
84 Ga0105247_10203604 3300009101 Bacteria 1331
85 Ga0105243_10172425 3300009148 Bacteria 1875
86 Ga0105237_10084801 3300009545 Bacteria 3158
87 Ga0105249_10112984 3300009553 Bacteria 2570
88 Ga0105249_10668608 3300009553 Bacteria 1097
89 Ga0105239_10276259 3300010375 Bacteria 1890
90 Ga0105246_10022840 3300011119 Bacteria 4042
91 Ga0157369_10008694 3300013105 Bacteria 11643
92 Ga0157374_10008523 3300013296 Bacteria 8772
93 Ga0157374_10008566 3300013296 Bacteria 8748
94 Ga0157378_10085205 3300013297 Bacteria 2862
95 Ga0163162_10030803 3300013306 Bacteria 5316
96 Ga0163162_10089003 3300013306 Bacteria 3167
97 Ga0163162_10213425 3300013306 Bacteria 2060
98 Ga0157375_10034471 3300013308 Bacteria 4823
99 Ga0157375_10090606 3300013308 Bacteria 3117
100 Ga0163163_10041667 3300014325 Bacteria 4492
101 Ga0163163_10073127 3300014325 Bacteria 3419
102 Ga0163163_10091335 3300014325 Bacteria 3059
103 Ga0157380_10143480 3300014326 Bacteria 2055
104 Ga0157380_10176149 3300014326 Bacteria 1874
105 Ga0157380_10411605 3300014326 Bacteria 1286
106 Ga0157376_10025469 3300014969 Bacteria 4660
107 Ga0157376_10504568 3300014969 Bacteria 1189
108 Ga0209758_1006556 3300025297 Bacteria 8286
109 Ga0207710_10032301 3300025900 Bacteria 2293
110 Ga0207688_10008370 3300025901 Bacteria 5624
111 Ga0207680_10160840 3300025903 Bacteria 1505
112 Ga0207643_10051195 3300025908 Bacteria 2344
113 Ga0207684_10289631 3300025910 Bacteria 1412
114 Ga0207695_10047538 3300025913 Bacteria 4540
115 Ga0207693_10364468 3300025915 Bacteria 1131
116 Ga0207662_10083924 3300025918 Bacteria 1948
117 Ga0207657_10201878 3300025919 Bacteria 1599
118 Ga0207649_10040750 3300025920 Bacteria 2825
119 Ga0207681_10168325 3300025923 Bacteria 1659
120 Ga0207650_10028309 3300025925 Bacteria 4017
121 Ga0207659_10178823 3300025926 Bacteria 1679
122 Ga0207687_10012552 3300025927 Bacteria 5534
123 Ga0207687_10022316 3300025927 Bacteria 4211
124 Ga0207644_10242155 3300025931 Bacteria 1436
125 Ga0207644_10406909 3300025931 Bacteria 1113
126 Ga0207706_10086660 3300025933 Bacteria 2753
127 Ga0207706_10130977 3300025933 Bacteria 2206
128 Ga0207709_10305427 3300025935 Bacteria 1185
129 Ga0207670_10279659 3300025936 Bacteria 1300
130 Ga0207704_10015393 3300025938 Bacteria 3896
131 Ga0207704_10125017 3300025938 Bacteria 1769
132 Ga0207689_10021786 3300025942 Bacteria 5388
133 Ga0207661_10190048 3300025944 Bacteria 1800
134 Ga0207679_10017696 3300025945 Bacteria 4759
135 Ga0207679_10326961 3300025945 Bacteria 1329
136 Ga0207667_10022463 3300025949 Bacteria 6968
137 Ga0207712_10249936 3300025961 Bacteria 1433
138 Ga0207668_10086317 3300025972 Bacteria 2292
139 Ga0207668_10113506 3300025972 Bacteria 2037
140 Ga0207658_10116144 3300025986 Bacteria 2125
141 Ga0207703_10056481 3300026035 Bacteria 3198
142 Ga0207703_10125729 3300026035 Bacteria 2207
143 Ga0207639_10569729 3300026041 Bacteria 1041
144 Ga0207678_10038329 3300026067 Bacteria 4164
145 Ga0207678_10047801 3300026067 Bacteria 3699
146 Ga0207702_10027234 3300026078 Bacteria 4747
147 Ga0207702_10247841 3300026078 Bacteria 1671
148 Ga0207676_10121399 3300026095 Bacteria 2204
149 Ga0207674_10082042 3300026116 Bacteria 3226
150 Ga0207675_100010311 3300026118 Bacteria 8756
151 Ga0207683_10007661 3300026121 Bacteria 9244
152 Ga0207683_10059533 3300026121 Bacteria 3355
153 Ga0207698_10017989 3300026142 Bacteria 4807
154 Ga0268266_10000466 3300028379 Bacteria 58721
155 Ga0268266_10012380 3300028379 Bacteria 7373
156 Ga0268266_10012467 3300028379 Bacteria 7346
157 Ga0268266_10128884 3300028379 Bacteria 2261
158 Ga0268265_10031314 3300028380 Bacteria 3840
159 Ga0268265_10170155 3300028380 Bacteria 1861
160 Ga0268264_10191557 3300028381 Bacteria 1864
161 Ga0307517_10156364 3300028786 Bacteria 1545
162 Ga0307515_10169819 3300028794 Bacteria 2180
163 Ga0307509_10069771 3300031507 Bacteria 3672
164 Ga0307508_10245536 3300031616 Bacteria 1387
165 Ga0307413_10161581 3300031824 Bacteria 1574
166 Ga0307410_10304343 3300031852 Bacteria 1259
167 Ga0307406_10068110 3300031901 Bacteria 2323
168 Ga0307409_100069248 3300031995 Bacteria 2794
169 Ga0307416_100231161 3300032002 Bacteria 1783
170 Ga0307416_100573074 3300032002 Bacteria 1205
171 Ga0307414_10317306 3300032004 Bacteria 1325
172 Ga0307510_10063501 3300033180 Bacteria 3761
173 Ga0373954_0081724 3300035118 Bacteria 1544
174 Ga0373955_0079218 3300035172 Bacteria 1853
175 Ga0373933_0173774 3300035724 Bacteria 1372
176 Ga0395900_0006713 3300037418 Bacteria 11948
177 Ga0395901_0429794 3300038443 Bacteria 1353
178 Ga0436365_0564081 3300039437 Bacteria 4250
179 Ga0436365_0577047 3300039437 Bacteria 3262
180 Ga0439465_0016408 3300041413 Bacteria 2310
181 Ga0439465_0195031 3300041413 Bacteria 736
182 Ga0451793_1508630 3300041452 Bacteria 1733
183 Ga0451853_2017883 3300041512 Bacteria 920
184 Ga0439445_0074713 3300042004 Bacteria 942
185 Ga0439459_0008039 3300042438 Bacteria 1794
186 Ga0495627_094506 3300046453 Bacteria 858
187 Ga0495603_0009571 3300046455 Bacteria 5857
188 Ga0495650_0022390 3300046471 Bacteria 3031
189 Ga0495580_0036064 3300046472 Bacteria 3553
190 Ga0495585_0103611 3300046492 Bacteria 1519
191 Ga0495594_0039722 3300046499 Bacteria 2574
192 Ga0495631_0053184 3300046518 Bacteria 1767
193 Ga0495632_0050537 3300046519 Bacteria 2049
194 Ga0495637_0115160 3300046520 Bacteria 1039
195 Ga0495663_0022301 3300046525 Bacteria 1828
196 Ga0495668_0087861 3300046616 Bacteria 1704
197 Ga0495588_0001310 3300046674 Bacteria 10640
198 Ga0495647_0027460 3300046681 Bacteria 2092
199 Ga0495669_0007926 3300046684 Bacteria 4458
200 Ga0495672_0105131 3300047320 Bacteria 1524
201 Ga0495676_0020250 3300047321 Bacteria 5842
202 Ga0495686_0131085 3300047472 Bacteria 1486
203 Ga0496100_0107099 3300048903 Bacteria 1936
204 Ga0496101_0000986 3300048904 Bacteria 16839
205 Ga0496102_0000549 3300048905 Bacteria 40435
206 Ga0496102_0215465 3300048905 Bacteria 1810
207 Ga0496102_0321248 3300048905 Bacteria 1458
208 Ga0496102_0546454 3300048905 Bacteria 1081
209 Ga0496104_0048618 3300048907 Bacteria 3998
210 Ga0496104_0184291 3300048907 Bacteria 1998
211 Ga0496105_0007635 3300048908 Bacteria 8381
212 Ga0496106_0020086 3300048909 Bacteria 4955
213 Ga0496106_0147830 3300048909 Bacteria 1852
214 Ga0496107_0020117 3300048910 Bacteria 4713
215 Ga0496108_0041305 3300048911 Bacteria 3850
216 Ga0496108_0174314 3300048911 Bacteria 1861
217 Ga0496109_0089381 3300048912 Bacteria 2847
218 Ga0496109_0123864 3300048912 Bacteria 2409
219 Ga0496110_0090035 3300048913 Bacteria 2743
220 Ga0496111_0020206 3300048914 Bacteria 4634
221 Ga0496112_0285584 3300048915 Bacteria 1596
222 Ga0496113_0012665 3300048916 Bacteria 5676
223 Ga0496113_0433542 3300048916 Bacteria 1056
224 Ga0496114_0077440 3300048917 Bacteria 2804
225 Ga0496115_0002310 3300048918 Bacteria 13659
226 Ga0496115_0077385 3300048918 Bacteria 2705
227 Ga0496119_0068907 3300048922 Bacteria 2081
228 Ga0496119_0180804 3300048922 Bacteria 1106
229 Ga0496124_0127212 3300048927 Bacteria 2028
230 Ga0501038_0284805 3300049574 Bacteria 1300
231 Ga0501040_0405937 3300049576 Bacteria 979
232 Ga0501067_0270911 3300049583 Bacteria 945
233 nmdc:mga03683_73391_c1 3300050489 Bacteria 1467
234 nmdc:mga03n38_194652_c1 3300050490 Bacteria 1046
235 nmdc:mga03n38_52740_c1 3300050490 Bacteria 1822
236 nmdc:mga00v17_245993_c1 3300050491 Bacteria 1160
237 nmdc:mga00v17_53881_c1 3300050491 Bacteria 2453
238 nmdc:mga0yw44_103636_c1 3300050492 Bacteria 1815
239 nmdc:mga0yw44_285911_c1 3300050492 Bacteria 1103
240 nmdc:mga0yw44_29097_c1 3300050492 Bacteria 3186
241 nmdc:mga0yw44_95972_c1 3300050492 Bacteria 1882
242 nmdc:mga0k408_40185_c1 3300050493 Bacteria 2690
243 nmdc:mga0k408_73659_c1 3300050493 Bacteria 1995
244 nmdc:mga06z11_174301_c1 3300050494 Bacteria 1237
245 nmdc:mga06z11_285665_c1 3300050494 Bacteria 978
246 nmdc:mga04h51_20945_c1 3300050495 Bacteria 1961
247 nmdc:mga04h51_44415_c1 3300050495 Bacteria 1465
248 nmdc:mga07m45_2944_c1 3300050496 Bacteria 8089
249 nmdc:mga07m45_41054_c1 3300050496 Bacteria 2591
250 nmdc:mga05p37_234961_c1 3300050507 Bacteria 2207
251 nmdc:mga0n895_368538_c1 3300050512 Bacteria 1454
252 nmdc:mga0rr50_166238_c1 3300050513 Bacteria 1794
253 Ga0500641_0047424 3300053096 Bacteria 1757
254 Ga0500595_000781 3300053119 Bacteria 18598
255 Ga0500617_197327 3300053124 Bacteria 742
256 Ga0500638_071494 3300053162 Bacteria 1658
257 Ga0500611_010638 3300053727 Bacteria 1498
258 Ga0500609_008952 3300053731 Bacteria 1351
259 Ga0530510_0525563 3300061734 Bacteria 898
260 2513694777 2513237101 Bacteria 7952346
261 2723842189 2721755755 Bacteria 8322773
262 2874610224 2874604998 Bacteria 7834745
263 2876809248 2876808645 Bacteria 8824342
264 2879112494 2879110137 Bacteria 8907982
265 2922366818 2922361189 Bacteria 7436256
266 2922389283 2922386360 Bacteria 7017218
267 8006966416 8006964411 Bacteria 8966052
268 8006990618 8006984368 Bacteria 9651211
269 8006997079 8006994254 Bacteria 8309700
270 8056678275 8056673599 Bacteria 7871253
271 8056690896 8056689827 Bacteria 6712655
272 Ga0307408_100452318
273 rootH2_10021614
274 rootL2_10044177
275 rootL2_10108614
276 rootH1_10193052
277 Ga0068869_100335364
278 Ga0070682_100131500
279 Ga0070682_100180012
280 Ga0070682_100345745
281 Ga0070687_100224370
282 Ga0070661_100071388
283 Ga0070668_100055027
284 Ga0070668_100275971
285 Ga0070669_100187608
286 Ga0070671_100074177
287 Ga0070674_100237397
288 Ga0070688_100024184
289 Ga0070659_100262698
290 Ga0070667_100107245
291 Ga0070667_100207979
292 Ga0070708_100308206
293 Ga0070663_100003662
294 Ga0070663_100046207
295 Ga0070663_100052829
296 Ga0070706_100302578
297 Ga0070698_100095294
298 Ga0070699_100250708
299 Ga0070684_100045285
300 Ga0070697_100277392
301 Ga0068853_100531486
302 Ga0070695_100055766
303 Ga0070665_100006516
304 Ga0070665_100029032
305 Ga0070665_100029422
306 Ga0070665_100076396
307 Ga0070665_100150857
308 Ga0070664_100099604
309 Ga0070664_100120306
310 Ga0070664_100472400
311 Ga0068857_100058176
312 Ga0068856_100007648
313 Ga0068856_100145701
314 Ga0070702_100154400
315 Ga0068852_100056790
316 Ga0068859_100017338
317 Ga0068859_100130974
318 Ga0068859_100193652
319 Ga0068866_10064118
320 Ga0068861_100064938
321 Ga0068858_100089362
322 Ga0068862_100058024
323 Ga0068862_100208644
324 Ga0081455_10027193
325 Ga0081455_10125339
326 Ga0081538_10141726
327 Ga0081540_1001660
328 Ga0081540_1007986
329 Ga0081540_1011467
330 Ga0081540_1038460
331 Ga0081539_10072883
332 Ga0075365_10060892
333 Ga0075365_10094407
334 Ga0075365_10133107
335 Ga0075368_10014177
336 Ga0075363_100008062
337 Ga0075364_10068464
338 Ga0075364_10220634
339 Ga0075367_10106409
340 Ga0075367_10115529
341 Ga0075367_10157535
342 Ga0075369_10004431
343 Ga0075369_10016152
344 Ga0097621_100054190
345 Ga0075370_10003353
346 Ga0075370_10135141
347 Ga0068871_100187617
348 Ga0075428_100090532
349 Ga0075433_10221918
350 Ga0068865_100064386
351 Ga0097620_100017338
352 Ga0097620_100130971
353 Ga0097620_100193645
354 Ga0075435_100089252
355 Ga0105247_10203604
356 Ga0105243_10172425
357 Ga0105237_10084801
358 Ga0105249_10112984
359 Ga0105249_10668608
360 Ga0105239_10276259
361 Ga0105246_10022840
362 Ga0157369_10008694
363 Ga0157374_10008523
364 Ga0157374_10008566
365 Ga0157378_10085205
366 Ga0163162_10030803
367 Ga0163162_10089003
368 Ga0163162_10213425
369 Ga0157375_10034471
370 Ga0157375_10090606
371 Ga0163163_10041667
372 Ga0163163_10073127
373 Ga0163163_10091335
374 Ga0157380_10143480
375 Ga0157380_10176149
376 Ga0157380_10411605
377 Ga0157376_10025469
378 Ga0157376_10504568
379 Ga0209758_1006556
380 Ga0207710_10032301
381 Ga0207688_10008370
382 Ga0207680_10160840
383 Ga0207643_10051195
384 Ga0207684_10289631
385 Ga0207695_10047538
386 Ga0207693_10364468
387 Ga0207662_10083924
388 Ga0207657_10201878
389 Ga0207649_10040750
390 Ga0207681_10168325
391 Ga0207650_10028309
392 Ga0207659_10178823
393 Ga0207687_10012552
394 Ga0207687_10022316
395 Ga0207644_10242155
396 Ga0207644_10406909
397 Ga0207706_10086660
398 Ga0207706_10130977
399 Ga0207709_10305427
400 Ga0207670_10279659
401 Ga0207704_10015393
402 Ga0207704_10125017
403 Ga0207689_10021786
404 Ga0207661_10190048
405 Ga0207679_10017696
406 Ga0207679_10326961
407 Ga0207667_10022463
408 Ga0207712_10249936
409 Ga0207668_10086317
410 Ga0207668_10113506
411 Ga0207658_10116144
412 Ga0207703_10056481
413 Ga0207703_10125729
414 Ga0207639_10569729
415 Ga0207678_10038329
416 Ga0207678_10047801
417 Ga0207702_10027234
418 Ga0207702_10247841
419 Ga0207676_10121399
420 Ga0207674_10082042
421 Ga0207675_100010311
422 Ga0207683_10007661
423 Ga0207683_10059533
424 Ga0207698_10017989
425 Ga0268266_10000466
426 Ga0268266_10012380
427 Ga0268266_10012467
428 Ga0268266_10128884
429 Ga0268265_10031314
430 Ga0268265_10170155
431 Ga0268264_10191557
432 Ga0307517_10156364
433 Ga0307515_10169819
434 Ga0307509_10069771
435 Ga0307508_10245536
436 Ga0307413_10161581
437 Ga0307410_10304343
438 Ga0307406_10068110
439 Ga0307409_100069248
440 Ga0307416_100231161
441 Ga0307416_100573074
442 Ga0307414_10317306
443 Ga0307510_10063501
444 Ga0373954_0081724
445 Ga0373955_0079218
446 Ga0373933_0173774
447 Ga0395900_0006713
448 Ga0395901_0429794
449 Ga0436365_0564081
450 Ga0436365_0577047
451 Ga0439465_0016408
452 Ga0439465_0195031
453 Ga0451793_1508630
454 Ga0451853_2017883
455 Ga0439445_0074713
456 Ga0439459_0008039
457 Ga0495627_094506
458 Ga0495603_0009571
459 Ga0495650_0022390
460 Ga0495580_0036064
461 Ga0495585_0103611
462 Ga0495594_0039722
463 Ga0495631_0053184
464 Ga0495632_0050537
465 Ga0495637_0115160
466 Ga0495663_0022301
467 Ga0495668_0087861
468 Ga0495588_0001310
469 Ga0495647_0027460
470 Ga0495669_0007926
471 Ga0495672_0105131
472 Ga0495676_0020250
473 Ga0495686_0131085
474 Ga0496100_0107099
475 Ga0496101_0000986
476 Ga0496102_0000549
477 Ga0496102_0215465
478 Ga0496102_0321248
479 Ga0496102_0546454
480 Ga0496104_0048618
481 Ga0496104_0184291
482 Ga0496105_0007635
483 Ga0496106_0020086
484 Ga0496106_0147830
485 Ga0496107_0020117
486 Ga0496108_0041305
487 Ga0496108_0174314
488 Ga0496109_0089381
489 Ga0496109_0123864
490 Ga0496110_0090035
491 Ga0496111_0020206
492 Ga0496112_0285584
493 Ga0496113_0012665
494 Ga0496113_0433542
495 Ga0496114_0077440
496 Ga0496115_0002310
497 Ga0496115_0077385
498 Ga0496119_0068907
499 Ga0496119_0180804
500 Ga0496124_0127212
501 Ga0501038_0284805
502 Ga0501040_0405937
503 Ga0501067_0270911
504 nmdc:mga03683_73391_c1
505 nmdc:mga03n38_194652_c1
506 nmdc:mga03n38_52740_c1
507 nmdc:mga00v17_245993_c1
508 nmdc:mga00v17_53881_c1
509 nmdc:mga0yw44_103636_c1
510 nmdc:mga0yw44_285911_c1
511 nmdc:mga0yw44_29097_c1
512 nmdc:mga0yw44_95972_c1
513 nmdc:mga0k408_40185_c1
514 nmdc:mga0k408_73659_c1
515 nmdc:mga06z11_174301_c1
516 nmdc:mga06z11_285665_c1
517 nmdc:mga04h51_20945_c1
518 nmdc:mga04h51_44415_c1
519 nmdc:mga07m45_2944_c1
520 nmdc:mga07m45_41054_c1
521 nmdc:mga05p37_234961_c1
522 nmdc:mga0n895_368538_c1
523 nmdc:mga0rr50_166238_c1
524 Ga0500641_0047424
525 Ga0500595_000781
526 Ga0500617_197327
527 Ga0500638_071494
528 Ga0500611_010638
529 Ga0500609_008952
530 Ga0530510_0525563
531 2513694777
532 2723842189
533 2874610224
534 2876809248
535 2879112494
536 2922366818
537 2922389283
538 8006966416
539 8006990618
540 8006997079
541 8056678275
542 8056690896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06035

Peptidase_C93

Bacterial transglutaminase-like cysteine proteinase BTLCP

90

206

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w2x-assembly2.cif.gz_C complex of rac2 and plcg2 spph domain 0.811 177 202
2w2x-assembly1.cif.gz_D complex of rac2 and plcg2 spph domain 0.8061 177 202
4fgo-assembly1.cif.gz_A legionella pneumophila lapg (calcium-bound) 0.8046 77 234
4fgq-assembly2.cif.gz_B legionella pneumophila lapg 0.8037 77 232
4fgp-assembly2.cif.gz_B legionella pneumophila lapg (egta-treated) 0.8027 77 232
ID Description Score Start End Superfamily
af_A4HRJ6_1964_2102_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8243 114 232 3.10.620.30
2w2xC00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.811 177 202 2.30.29.30
af_A0A0G2K9D9_1213_1631_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8049 99 232 3.10.620.30
4fgoA00 Alpha Beta;Roll;C8orf32 fold; 0.8038 77 234 3.10.620.30
af_A7E2V1_331_437_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.786 114 212 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A1B7W520-F1-model_v4 Transglutaminase 0.951 98 230 GO:0016020
AF-A0A7Z9VH05-F1-model_v4 Transglutaminase 0.9451 154 233
AF-A0A3R9X9U3-F1-model_v4 Transglutaminase 0.9443 98 232
AF-A0A7I0KG28-F1-model_v4 deleted 0.9427 152 233
AF-A0A0B8PY14-F1-model_v4 deleted 0.9412 114 233

Map