F377702

General Info

Members Datasets Scaffolds Average Seq Length
271 161 542 311

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10459765|Ga0207706_104597652
Length 326
Sequence MSRPKSAPPAAPRTVAPRTALGPVARAGEGHRPRPTVSFEFSPPKTPEAEESLWEAIRRLEPLNPSFVSVTYGAGGSTRDRTHRTVLRMLRETGLKPAAHLTCVEASREQVDEVIREYWDAGVRHIVALRGDPPGQIGGRYTPRADGYNNATELTEAIRGIAPFEVSVGLYPQVHPESPSIEHDIDVLKAKVDAGATRAITQFFFDIDGFLRFMERVRKAGVTIPICPGIMPVTNYKGLKKMAGPIGIQLPGWLENLFGGLDKDPETRRLISASVATEMCARLAEEGFTDFHFYTLNRAELVYAICRVLGVREPDSPPDTVKEAAA

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
137 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
138 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
144 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
145 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
148 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
149 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
150 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
156 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
157 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
158 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
159 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
160 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
161 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0
Rhizoplane 3.32
Rhizosphere 74.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10459765 3300025933 Bacteria 1100
2 Ga0055530_10004142 3300003791 Bacteria 7674
3 Ga0055531_10012502 3300003794 Bacteria 3987
4 Ga0065165_1001137 3300005262 Bacteria 31235
5 Ga0070658_10013198 3300005327 Bacteria 6627
6 Ga0070658_10195468 3300005327 Bacteria 1706
7 Ga0070658_10329457 3300005327 Bacteria 1304
8 Ga0070658_10477526 3300005327 Bacteria 1076
9 Ga0070676_10239005 3300005328 Bacteria 1207
10 Ga0070680_100006144 3300005336 Bacteria 9107
11 Ga0070680_100120446 3300005336 Bacteria 2190
12 Ga0068868_100147262 3300005338 Bacteria 1937
13 Ga0070668_100001655 3300005347 Bacteria 16171
14 Ga0070668_100001821 3300005347 Bacteria 15511
15 Ga0070668_100011127 3300005347 Bacteria 6699
16 Ga0070668_100144225 3300005347 Bacteria 1921
17 Ga0070669_100056026 3300005353 Bacteria 2890
18 Ga0070671_100008156 3300005355 Bacteria 8385
19 Ga0070659_100001826 3300005366 Bacteria 15326
20 Ga0070659_100009547 3300005366 Bacteria 7131
21 Ga0070667_100000711 3300005367 Bacteria 32094
22 Ga0070667_100018029 3300005367 Bacteria 5851
23 Ga0070667_100026433 3300005367 Bacteria 4828
24 Ga0070678_100130585 3300005456 Bacteria 1995
25 Ga0070681_10015581 3300005458 Bacteria 7571
26 Ga0070681_10017488 3300005458 Bacteria 7166
27 Ga0070681_10085404 3300005458 Bacteria 3108
28 Ga0070679_100077076 3300005530 Bacteria 3322
29 Ga0068853_100057486 3300005539 Bacteria 3357
30 Ga0070665_100000015 3300005548 Bacteria 462744
31 Ga0070665_100002042 3300005548 Bacteria 22721
32 Ga0070665_100002102 3300005548 Bacteria 22306
33 Ga0070665_100039616 3300005548 Bacteria 4738
34 Ga0070665_100141536 3300005548 Bacteria 2409
35 Ga0068855_100027157 3300005563 Bacteria 6849
36 Ga0068855_100032277 3300005563 Bacteria 6253
37 Ga0068852_100039987 3300005616 Bacteria 3952
38 Ga0068859_100000078 3300005617 Bacteria 91430
39 Ga0068859_100028260 3300005617 Bacteria 5622
40 Ga0068864_100000102 3300005618 Bacteria 82743
41 Ga0068864_100000165 3300005618 Bacteria 60874
42 Ga0068864_100010601 3300005618 Bacteria 7620
43 Ga0068864_100527871 3300005618 Bacteria 1139
44 Ga0068861_100096217 3300005719 Bacteria 2346
45 Ga0068863_100000128 3300005841 Bacteria 79841
46 Ga0068863_100000958 3300005841 Bacteria 28976
47 Ga0068863_100003725 3300005841 Bacteria 15079
48 Ga0068858_100000117 3300005842 Bacteria 83778
49 Ga0068858_100021608 3300005842 Bacteria 6015
50 Ga0068858_100036337 3300005842 Bacteria 4568
51 Ga0068858_100094410 3300005842 Bacteria 2786
52 Ga0068858_100348211 3300005842 Bacteria 1419
53 Ga0068860_100000157 3300005843 Bacteria 110717
54 Ga0068860_100001015 3300005843 Bacteria 31089
55 Ga0068860_100016004 3300005843 Bacteria 7318
56 Ga0068862_100001338 3300005844 Bacteria 22879
57 Ga0068862_100011191 3300005844 Bacteria 7409
58 Ga0068862_100047015 3300005844 Bacteria 3682
59 Ga0068862_100120828 3300005844 Bacteria 2309
60 Ga0097620_100000078 3300006931 Bacteria 91430
61 Ga0097620_100028260 3300006931 Bacteria 5622
62 Ga0105250_10036745 3300009092 Bacteria 1965
63 Ga0105240_10015659 3300009093 Bacteria 10298
64 Ga0105240_10023137 3300009093 Bacteria 8227
65 Ga0105240_10036370 3300009093 Bacteria 6336
66 Ga0105240_10053296 3300009093 Bacteria 5078
67 Ga0105240_10273454 3300009093 Bacteria 1944
68 Ga0105248_10005436 3300009177 Bacteria 14002
69 Ga0105248_10007805 3300009177 Bacteria 11749
70 Ga0105248_10052857 3300009177 Bacteria 4559
71 Ga0105248_10220005 3300009177 Bacteria 2138
72 Ga0105238_10011979 3300009551 Bacteria 8736
73 Ga0105249_10002493 3300009553 Bacteria 15949
74 Ga0105249_10021596 3300009553 Bacteria 5764
75 Ga0105239_10253353 3300010375 Bacteria 1977
76 Ga0105239_10501157 3300010375 Bacteria 1380
77 Ga0157370_10085484 3300013104 Bacteria 2963
78 Ga0157374_10471200 3300013296 Bacteria 1258
79 Ga0163162_10180540 3300013306 Bacteria 2237
80 Ga0157372_10313921 3300013307 Bacteria 1825
81 Ga0163163_10035588 3300014325 Bacteria 4831
82 Ga0157380_10427710 3300014326 Bacteria 1265
83 Ga0157379_10003132 3300014968 Bacteria 13995
84 Ga0157379_10013076 3300014968 Bacteria 7270
85 Ga0213876_10000543 3300021384 Bacteria 28405
86 Ga0213875_10046081 3300021388 Bacteria 2047
87 Ga0213875_10119157 3300021388 Bacteria 1233
88 Ga0209026_1001842 3300025250 Bacteria 8685
89 Ga0209148_1006262 3300025254 Bacteria 2597
90 Ga0209455_1019865 3300025272 Bacteria 1346
91 Ga0209758_1003342 3300025297 Bacteria 14734
92 Ga0209050_1000098 3300025298 Bacteria 236717
93 Ga0209257_1000235 3300025304 Bacteria 129620
94 Ga0209257_1003640 3300025304 Bacteria 12958
95 Ga0207707_10040877 3300025912 Bacteria 4049
96 Ga0207695_10003280 3300025913 Bacteria 22994
97 Ga0207695_10004414 3300025913 Bacteria 19216
98 Ga0207695_10010191 3300025913 Bacteria 11528
99 Ga0207695_10016464 3300025913 Bacteria 8647
100 Ga0207660_10000234 3300025917 Bacteria 35837
101 Ga0207657_10009443 3300025919 Bacteria 9799
102 Ga0207657_10154472 3300025919 Bacteria 1867
103 Ga0207649_10090049 3300025920 Bacteria 2007
104 Ga0207652_10001742 3300025921 Bacteria 18984
105 Ga0207681_10007368 3300025923 Bacteria 6739
106 Ga0207694_10092483 3300025924 Bacteria 2387
107 Ga0207694_10278806 3300025924 Bacteria 1373
108 Ga0207650_10000327 3300025925 Bacteria 46298
109 Ga0207687_10064763 3300025927 Bacteria 2593
110 Ga0207644_10026863 3300025931 Bacteria 3973
111 Ga0207690_10000250 3300025932 Bacteria 39031
112 Ga0207704_10000847 3300025938 Bacteria 13552
113 Ga0207711_10000743 3300025941 Bacteria 31975
114 Ga0207711_10003708 3300025941 Bacteria 13166
115 Ga0207711_10025907 3300025941 Bacteria 4918
116 Ga0207711_10035268 3300025941 Bacteria 4240
117 Ga0207711_10089896 3300025941 Bacteria 2699
118 Ga0207711_10487172 3300025941 Bacteria 1149
119 Ga0207679_10043946 3300025945 Bacteria 3220
120 Ga0207667_10004533 3300025949 Bacteria 17018
121 Ga0207667_10093649 3300025949 Bacteria 3102
122 Ga0207712_10001490 3300025961 Bacteria 15892
123 Ga0207668_10000025 3300025972 Bacteria 131733
124 Ga0207668_10002641 3300025972 Bacteria 10485
125 Ga0207668_10003119 3300025972 Bacteria 9706
126 Ga0207668_10010423 3300025972 Bacteria 5614
127 Ga0207668_10022437 3300025972 Bacteria 4041
128 Ga0207658_10000144 3300025986 Bacteria 74430
129 Ga0207658_10003134 3300025986 Bacteria 11830
130 Ga0207658_10040222 3300025986 Bacteria 3378
131 Ga0207677_10116951 3300026023 Bacteria 1997
132 Ga0207703_10000087 3300026035 Bacteria 106113
133 Ga0207703_10014922 3300026035 Bacteria 6063
134 Ga0207703_10064789 3300026035 Bacteria 3001
135 Ga0207703_10086510 3300026035 Bacteria 2626
136 Ga0207703_10211878 3300026035 Bacteria 1728
137 Ga0207639_10040297 3300026041 Bacteria 3485
138 Ga0207678_10358589 3300026067 Bacteria 1258
139 Ga0207702_10529312 3300026078 Bacteria 1151
140 Ga0207641_10000005 3300026088 Bacteria 470841
141 Ga0207641_10000777 3300026088 Bacteria 34097
142 Ga0207641_10000994 3300026088 Bacteria 29003
143 Ga0207641_10034728 3300026088 Bacteria 4196
144 Ga0207641_10044225 3300026088 Bacteria 3745
145 Ga0207676_10000066 3300026095 Bacteria 105425
146 Ga0207676_10000145 3300026095 Bacteria 61785
147 Ga0207676_10036531 3300026095 Bacteria 3738
148 Ga0207674_10211823 3300026116 Bacteria 1887
149 Ga0207675_100040392 3300026118 Bacteria 4357
150 Ga0207675_100074456 3300026118 Bacteria 3177
151 Ga0207683_10088580 3300026121 Bacteria 2754
152 Ga0209981_1009749 3300027378 Bacteria 1315
153 Ga0268266_10000005 3300028379 Bacteria 1448194
154 Ga0268266_10000814 3300028379 Bacteria 41101
155 Ga0268266_10000815 3300028379 Bacteria 40979
156 Ga0268266_10025024 3300028379 Bacteria 5082
157 Ga0268265_10030617 3300028380 Bacteria 3878
158 Ga0268265_10103850 3300028380 Bacteria 2302
159 Ga0268265_10118650 3300028380 Bacteria 2175
160 Ga0268264_10000055 3300028381 Bacteria 314947
161 Ga0268264_10000211 3300028381 Bacteria 117108
162 Ga0268264_10006264 3300028381 Bacteria 10038
163 Ga0268264_10034502 3300028381 Bacteria 4162
164 Ga0265337_1032753 3300028556 Bacteria 1536
165 Ga0265334_10104869 3300028573 Bacteria 1020
166 Ga0307517_10001826 3300028786 Bacteria 34938
167 Ga0307511_10007114 3300030521 Bacteria 11272
168 Ga0265327_10000276 3300031251 Bacteria 101172
169 Ga0265327_10000677 3300031251 Bacteria 54772
170 Ga0265327_10095609 3300031251 Bacteria 1442
171 Ga0307513_10011121 3300031456 Bacteria 11218
172 Ga0307513_10034817 3300031456 Bacteria 5643
173 Ga0307513_10093055 3300031456 Bacteria 3065
174 Ga0307516_10000020 3300031730 Bacteria 195931
175 Ga0307510_10004829 3300033180 Bacteria 15936
176 Ga0307510_10180092 3300033180 Bacteria 1678
177 Ga0373944_0008688 3300035089 Bacteria 2745
178 Ga0373935_0032727 3300035692 Bacteria 3232
179 Ga0373927_0000369 3300035695 Bacteria 34872
180 Ga0373925_0000111 3300037068 Bacteria 87426
181 Ga0373925_0062823 3300037068 Bacteria 2793
182 Ga0395899_0000125 3300037312 Bacteria 120964
183 Ga0395899_0002949 3300037312 Bacteria 13636
184 Ga0395900_0000006 3300037418 Bacteria 495364
185 Ga0395900_0266449 3300037418 Bacteria 1709
186 Ga0395900_0297104 3300037418 Bacteria 1602
187 Ga0395898_0013281 3300037466 Bacteria 8481
188 Ga0395898_0303711 3300037466 Bacteria 1522
189 Ga0395905_0019260 3300037471 Bacteria 6470
190 Ga0395905_0066727 3300037471 Bacteria 3370
191 Ga0395905_0079492 3300037471 Bacteria 3074
192 Ga0395905_0095234 3300037471 Bacteria 2794
193 Ga0395905_0310868 3300037471 Bacteria 1464
194 Ga0436364_0131289 3300037853 Bacteria 1447
195 Ga0436364_0843196 3300037853 Bacteria 1568
196 Ga0395901_0000001 3300038443 Bacteria 800383
197 Ga0436365_0209892 3300039437 Bacteria 72774
198 Ga0436365_1722614 3300039437 Bacteria 9005
199 Ga0436363_0197519 3300039450 Bacteria 2725
200 Ga0451833_1413896 3300041491 Bacteria 1163
201 Ga0466966_0159285 3300044684 Bacteria 1375
202 Ga0495629_0033649 3300046459 Bacteria 3625
203 Ga0495650_0040783 3300046471 Bacteria 1990
204 Ga0495583_0042265 3300046506 Bacteria 2130
205 Ga0495620_0022037 3300046515 Bacteria 3079
206 Ga0495643_0006415 3300046522 Bacteria 7760
207 Ga0495642_0005226 3300046528 Bacteria 4994
208 Ga0495642_0013561 3300046528 Bacteria 3155
209 Ga0495597_0003405 3300046542 Bacteria 9307
210 Ga0495622_0003888 3300046557 Bacteria 6978
211 Ga0495668_0218246 3300046616 Bacteria 1044
212 Ga0495669_0000008 3300046684 Bacteria 177295
213 Ga0495669_0000527 3300046684 Bacteria 17271
214 Ga0495669_0016831 3300046684 Bacteria 3134
215 Ga0495613_0353957 3300046689 Bacteria 1008
216 Ga0495672_0016059 3300047320 Bacteria 5063
217 Ga0495687_025980 3300047443 Bacteria 2761
218 Ga0495677_0018530 3300047445 Bacteria 2523
219 Ga0495686_0014458 3300047472 Bacteria 5429
220 Ga0495686_0142586 3300047472 Bacteria 1413
221 Ga0495686_0202593 3300047472 Bacteria 1138
222 Ga0496102_0084975 3300048905 Bacteria 2921
223 Ga0496102_0118883 3300048905 Bacteria 2467
224 Ga0496106_0176111 3300048909 Bacteria 1697
225 Ga0496107_0077289 3300048910 Bacteria 2425
226 Ga0496108_0127352 3300048911 Bacteria 2187
227 Ga0496109_0011740 3300048912 Bacteria 7537
228 Ga0496112_0015979 3300048915 Bacteria 7017
229 Ga0496115_0001846 3300048918 Bacteria 15154
230 Ga0496115_0008062 3300048918 Bacteria 7778
231 Ga0496117_0027961 3300048920 Bacteria 4375
232 Ga0496118_0069038 3300048921 Bacteria 2562
233 Ga0496119_0038076 3300048922 Bacteria 3113
234 Ga0496121_0000059 3300048924 Bacteria 278177
235 Ga0496121_0000701 3300048924 Bacteria 62310
236 Ga0496125_0123229 3300048928 Bacteria 1843
237 Ga0495682_0023062 3300049460 Bacteria 2326
238 Ga0501033_0034096 3300049570 Bacteria 3820
239 Ga0501047_0023953 3300049581 Bacteria 5862
240 Ga0501047_0138374 3300049581 Bacteria 2314
241 Ga0501047_0280450 3300049581 Bacteria 1511
242 Ga0501047_0427323 3300049581 Bacteria 1156
243 Ga0501044_0028308 3300049823 Bacteria 5914
244 Ga0500635_0000048 3300053080 Bacteria 80957
245 Ga0500583_0014462 3300053092 Bacteria 3092
246 Ga0500566_0022580 3300053094 Bacteria 3696
247 Ga0500641_0023149 3300053096 Bacteria 2386
248 Ga0500555_002006 3300053103 Bacteria 6005
249 Ga0500556_0007136 3300053104 Bacteria 3194
250 Ga0500562_000502 3300053108 Bacteria 9529
251 Ga0500562_001481 3300053108 Bacteria 5788
252 Ga0500595_000954 3300053119 Bacteria 16317
253 Ga0500595_015686 3300053119 Bacteria 2839
254 Ga0500608_001889 3300053122 Bacteria 7469
255 Ga0500614_001998 3300053123 Bacteria 4664
256 Ga0500658_0067745 3300053134 Bacteria 1499
257 Ga0500590_026805 3300053148 Bacteria 2988
258 Ga0500603_005511 3300053150 Bacteria 2726
259 Ga0500619_008826 3300053154 Bacteria 2470
260 Ga0500638_028593 3300053162 Bacteria 2680
261 Ga0500636_0028878 3300053177 Bacteria 3275
262 Ga0500637_0018661 3300053178 Bacteria 3730
263 Ga0500576_027123 3300053725 Bacteria 2611
264 Ga0500645_003442 3300053730 Bacteria 6420
265 Ga0500596_003376 3300053735 Bacteria 3043
266 Ga0500601_001752 3300053737 Bacteria 2333
267 2643999484 2643221598 Bacteria 4578346
268 2644086501 2643221614 Bacteria 4260023
269 2644341455 2643221661 Bacteria 4267604
270 2644367742 2643221666 Bacteria 4265935
271 2739790629 2739367756 Bacteria 4553612
272 Ga0207706_10459765
273 Ga0055530_10004142
274 Ga0055531_10012502
275 Ga0065165_1001137
276 Ga0070658_10013198
277 Ga0070658_10195468
278 Ga0070658_10329457
279 Ga0070658_10477526
280 Ga0070676_10239005
281 Ga0070680_100006144
282 Ga0070680_100120446
283 Ga0068868_100147262
284 Ga0070668_100001655
285 Ga0070668_100001821
286 Ga0070668_100011127
287 Ga0070668_100144225
288 Ga0070669_100056026
289 Ga0070671_100008156
290 Ga0070659_100001826
291 Ga0070659_100009547
292 Ga0070667_100000711
293 Ga0070667_100018029
294 Ga0070667_100026433
295 Ga0070678_100130585
296 Ga0070681_10015581
297 Ga0070681_10017488
298 Ga0070681_10085404
299 Ga0070679_100077076
300 Ga0068853_100057486
301 Ga0070665_100000015
302 Ga0070665_100002042
303 Ga0070665_100002102
304 Ga0070665_100039616
305 Ga0070665_100141536
306 Ga0068855_100027157
307 Ga0068855_100032277
308 Ga0068852_100039987
309 Ga0068859_100000078
310 Ga0068859_100028260
311 Ga0068864_100000102
312 Ga0068864_100000165
313 Ga0068864_100010601
314 Ga0068864_100527871
315 Ga0068861_100096217
316 Ga0068863_100000128
317 Ga0068863_100000958
318 Ga0068863_100003725
319 Ga0068858_100000117
320 Ga0068858_100021608
321 Ga0068858_100036337
322 Ga0068858_100094410
323 Ga0068858_100348211
324 Ga0068860_100000157
325 Ga0068860_100001015
326 Ga0068860_100016004
327 Ga0068862_100001338
328 Ga0068862_100011191
329 Ga0068862_100047015
330 Ga0068862_100120828
331 Ga0097620_100000078
332 Ga0097620_100028260
333 Ga0105250_10036745
334 Ga0105240_10015659
335 Ga0105240_10023137
336 Ga0105240_10036370
337 Ga0105240_10053296
338 Ga0105240_10273454
339 Ga0105248_10005436
340 Ga0105248_10007805
341 Ga0105248_10052857
342 Ga0105248_10220005
343 Ga0105238_10011979
344 Ga0105249_10002493
345 Ga0105249_10021596
346 Ga0105239_10253353
347 Ga0105239_10501157
348 Ga0157370_10085484
349 Ga0157374_10471200
350 Ga0163162_10180540
351 Ga0157372_10313921
352 Ga0163163_10035588
353 Ga0157380_10427710
354 Ga0157379_10003132
355 Ga0157379_10013076
356 Ga0213876_10000543
357 Ga0213875_10046081
358 Ga0213875_10119157
359 Ga0209026_1001842
360 Ga0209148_1006262
361 Ga0209455_1019865
362 Ga0209758_1003342
363 Ga0209050_1000098
364 Ga0209257_1000235
365 Ga0209257_1003640
366 Ga0207707_10040877
367 Ga0207695_10003280
368 Ga0207695_10004414
369 Ga0207695_10010191
370 Ga0207695_10016464
371 Ga0207660_10000234
372 Ga0207657_10009443
373 Ga0207657_10154472
374 Ga0207649_10090049
375 Ga0207652_10001742
376 Ga0207681_10007368
377 Ga0207694_10092483
378 Ga0207694_10278806
379 Ga0207650_10000327
380 Ga0207687_10064763
381 Ga0207644_10026863
382 Ga0207690_10000250
383 Ga0207704_10000847
384 Ga0207711_10000743
385 Ga0207711_10003708
386 Ga0207711_10025907
387 Ga0207711_10035268
388 Ga0207711_10089896
389 Ga0207711_10487172
390 Ga0207679_10043946
391 Ga0207667_10004533
392 Ga0207667_10093649
393 Ga0207712_10001490
394 Ga0207668_10000025
395 Ga0207668_10002641
396 Ga0207668_10003119
397 Ga0207668_10010423
398 Ga0207668_10022437
399 Ga0207658_10000144
400 Ga0207658_10003134
401 Ga0207658_10040222
402 Ga0207677_10116951
403 Ga0207703_10000087
404 Ga0207703_10014922
405 Ga0207703_10064789
406 Ga0207703_10086510
407 Ga0207703_10211878
408 Ga0207639_10040297
409 Ga0207678_10358589
410 Ga0207702_10529312
411 Ga0207641_10000005
412 Ga0207641_10000777
413 Ga0207641_10000994
414 Ga0207641_10034728
415 Ga0207641_10044225
416 Ga0207676_10000066
417 Ga0207676_10000145
418 Ga0207676_10036531
419 Ga0207674_10211823
420 Ga0207675_100040392
421 Ga0207675_100074456
422 Ga0207683_10088580
423 Ga0209981_1009749
424 Ga0268266_10000005
425 Ga0268266_10000814
426 Ga0268266_10000815
427 Ga0268266_10025024
428 Ga0268265_10030617
429 Ga0268265_10103850
430 Ga0268265_10118650
431 Ga0268264_10000055
432 Ga0268264_10000211
433 Ga0268264_10006264
434 Ga0268264_10034502
435 Ga0265337_1032753
436 Ga0265334_10104869
437 Ga0307517_10001826
438 Ga0307511_10007114
439 Ga0265327_10000276
440 Ga0265327_10000677
441 Ga0265327_10095609
442 Ga0307513_10011121
443 Ga0307513_10034817
444 Ga0307513_10093055
445 Ga0307516_10000020
446 Ga0307510_10004829
447 Ga0307510_10180092
448 Ga0373944_0008688
449 Ga0373935_0032727
450 Ga0373927_0000369
451 Ga0373925_0000111
452 Ga0373925_0062823
453 Ga0395899_0000125
454 Ga0395899_0002949
455 Ga0395900_0000006
456 Ga0395900_0266449
457 Ga0395900_0297104
458 Ga0395898_0013281
459 Ga0395898_0303711
460 Ga0395905_0019260
461 Ga0395905_0066727
462 Ga0395905_0079492
463 Ga0395905_0095234
464 Ga0395905_0310868
465 Ga0436364_0131289
466 Ga0436364_0843196
467 Ga0395901_0000001
468 Ga0436365_0209892
469 Ga0436365_1722614
470 Ga0436363_0197519
471 Ga0451833_1413896
472 Ga0466966_0159285
473 Ga0495629_0033649
474 Ga0495650_0040783
475 Ga0495583_0042265
476 Ga0495620_0022037
477 Ga0495643_0006415
478 Ga0495642_0005226
479 Ga0495642_0013561
480 Ga0495597_0003405
481 Ga0495622_0003888
482 Ga0495668_0218246
483 Ga0495669_0000008
484 Ga0495669_0000527
485 Ga0495669_0016831
486 Ga0495613_0353957
487 Ga0495672_0016059
488 Ga0495687_025980
489 Ga0495677_0018530
490 Ga0495686_0014458
491 Ga0495686_0142586
492 Ga0495686_0202593
493 Ga0496102_0084975
494 Ga0496102_0118883
495 Ga0496106_0176111
496 Ga0496107_0077289
497 Ga0496108_0127352
498 Ga0496109_0011740
499 Ga0496112_0015979
500 Ga0496115_0001846
501 Ga0496115_0008062
502 Ga0496117_0027961
503 Ga0496118_0069038
504 Ga0496119_0038076
505 Ga0496121_0000059
506 Ga0496121_0000701
507 Ga0496125_0123229
508 Ga0495682_0023062
509 Ga0501033_0034096
510 Ga0501047_0023953
511 Ga0501047_0138374
512 Ga0501047_0280450
513 Ga0501047_0427323
514 Ga0501044_0028308
515 Ga0500635_0000048
516 Ga0500583_0014462
517 Ga0500566_0022580
518 Ga0500641_0023149
519 Ga0500555_002006
520 Ga0500556_0007136
521 Ga0500562_000502
522 Ga0500562_001481
523 Ga0500595_000954
524 Ga0500595_015686
525 Ga0500608_001889
526 Ga0500614_001998
527 Ga0500658_0067745
528 Ga0500590_026805
529 Ga0500603_005511
530 Ga0500619_008826
531 Ga0500638_028593
532 Ga0500636_0028878
533 Ga0500637_0018661
534 Ga0500576_027123
535 Ga0500645_003442
536 Ga0500596_003376
537 Ga0500601_001752
538 2643999484
539 2644086501
540 2644341455
541 2644367742
542 2739790629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

28

310

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b5t-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase 0.979 22 302
3fsu-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase double mutant phe223leuglu28gln complexed with methyltetrahydrofolate 0.9765 22 300
3fst-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9761 22 300
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.9759 22 300
1b5t-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase 0.9754 22 302
ID Description Score Start End Superfamily
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9587 12 300 3.20.20.220
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9286 94 297 3.20.20.220
af_Q9WU20_42_335_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9268 23 296 3.20.20.220
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9233 12 300 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9065 9 302 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A2J4RD57-F1-model_v4 Methylenetetrahydrofolate reductase 0.979 139 302 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A800A416-F1-model_v4 Methylenetetrahydrofolate reductase 0.9758 24 177 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-Q0BVP8-F1-model_v4 Methylenetetrahydrofolate reductase (EC 1.5.1.54) 0.9742 20 307 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A6C1T477-F1-model_v4 Methylenetetrahydrofolate reductase 0.9722 23 221 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A520J8B6-F1-model_v4 Methylenetetrahydrofolate reductase 0.9716 24 212 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Map