F377697

General Info

Members Datasets Scaffolds Average Seq Length
271 150 264 475

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10031228|Ga0207687_100312282
Length 516
Sequence MRKTSSNAAIRGGTGVSPNKKHGLVAHATSRRHFLSQLGNGFGTIALTSLFQAENLLAAPPQSQIANQKSHLPHHPPKATRVIQLFMSGAASQCDTFDHKPLLQKYHGQKWDPGEKVELFQSSPGNTLASPWPWRQYGQSGKFINDCVAPLGSVVDEIAFIHNVVSKSNVHGPATFMQATGFVLPGFPSAGAWVSYGLGRLCDNLPTFVVLPDPRGFAPNGPKNWGAGFLPAEHQGTMIRPGAADPIADLFPPKNSFVKPDSEAEMQAALKLINRQHEESRAGDSRLDARIRSYELAAAMQLSAPHVLDITNEPKHIQDMYGLNTPDTKYDGPMNPGEEIRHFGRNCLVARRLLEQGVRFVQIWSGADNGFPRRNWDSHEDLRRDHWPLGLGMATGAAALIKDLKARGMLDDTLILWTTEFGRMPCSQGTTGRDHNPFVFTNWLAGGGIKPGVSFGQSDEWSFKPADPTNPTYCYDIHATLLHLLGLEHTKLTFRHNGIDRRLTDVHGHVIKELIA

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
3 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
4 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
5 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
6 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.37
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 0.74
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10083987 3300005289 Bacteria 3391
2 Ga0065712_10077811 3300005290 Bacteria 3439
3 Ga0065712_10112404 3300005290 Bacteria 1791
4 Ga0065707_10133730 3300005295 Bacteria 1876
5 Ga0070658_10002039 3300005327 Bacteria 16940
6 Ga0070658_10007248 3300005327 Bacteria 8953
7 Ga0070683_100127662 3300005329 Bacteria 2405
8 Ga0070690_100061468 3300005330 Bacteria 2420
9 Ga0070670_100025279 3300005331 Bacteria 5109
10 Ga0070689_100010030 3300005340 Bacteria 6743
11 Ga0070689_100019826 3300005340 Bacteria 4978
12 Ga0070689_100022970 3300005340 Bacteria 4664
13 Ga0070689_100034460 3300005340 Bacteria 3863
14 Ga0070689_100040283 3300005340 Bacteria 3582
15 Ga0070688_100097580 3300005365 Bacteria 1932
16 Ga0070701_10015190 3300005438 Bacteria 3549
17 Ga0070694_100004055 3300005444 Bacteria 8776
18 Ga0070681_10077648 3300005458 Bacteria 3278
19 Ga0068853_100000001 3300005539 Bacteria 715840
20 Ga0068853_100000007 3300005539 Bacteria 283307
21 Ga0068853_100043914 3300005539 Bacteria 3825
22 Ga0070686_100004872 3300005544 Bacteria 7408
23 Ga0070686_100006402 3300005544 Bacteria 6542
24 Ga0070686_100033159 3300005544 Bacteria 3171
25 Ga0070665_100003235 3300005548 Bacteria 17502
26 Ga0070704_100002198 3300005549 Bacteria 10873
27 Ga0068855_100037010 3300005563 Bacteria 5806
28 Ga0068855_100039210 3300005563 Bacteria 5624
29 Ga0068855_100056465 3300005563 Bacteria 4607
30 Ga0068855_100101577 3300005563 Unclassified 3310
31 Ga0068855_100110250 3300005563 Bacteria 3160
32 Ga0068855_100153513 3300005563 Bacteria 2617
33 Ga0068857_100001967 3300005577 Bacteria 16614
34 Ga0068859_100132347 3300005617 Bacteria 2566
35 Ga0068859_100138430 3300005617 Bacteria 2508
36 Ga0068859_100321953 3300005617 Bacteria 1640
37 Ga0068864_100158028 3300005618 Bacteria 2059
38 Ga0068863_100225991 3300005841 Bacteria 1804
39 Ga0068858_100067505 3300005842 Bacteria 3313
40 Ga0068858_100098420 3300005842 Bacteria 2727
41 Ga0068862_100110689 3300005844 Bacteria 2410
42 Ga0068862_100194591 3300005844 Bacteria 1826
43 Ga0081455_10039993 3300005937 Bacteria 4139
44 Ga0097621_100191563 3300006237 Bacteria 1771
45 Ga0097621_100224183 3300006237 Bacteria 1639
46 Ga0075428_100001355 3300006844 Bacteria 25992
47 Ga0075428_100003043 3300006844 Bacteria 18300
48 Ga0075428_100004859 3300006844 Bacteria 14912
49 Ga0075428_100009369 3300006844 Bacteria 10862
50 Ga0075428_100039346 3300006844 Bacteria 5204
51 Ga0075428_100099019 3300006844 Unclassified 3179
52 Ga0075428_100174977 3300006844 Bacteria 2325
53 Ga0075430_100076846 3300006846 Bacteria 2799
54 Ga0075431_100018874 3300006847 Bacteria 7025
55 Ga0075431_100169246 3300006847 Bacteria 2246
56 Ga0075431_100184633 3300006847 Bacteria 2139
57 Ga0075433_10002140 3300006852 Bacteria 14955
58 Ga0075429_100051376 3300006880 Bacteria 3587
59 Ga0075429_100098292 3300006880 Bacteria 2554
60 Ga0075429_100102383 3300006880 Bacteria 2500
61 Ga0075429_100155259 3300006880 Bacteria 2004
62 Ga0075429_100202229 3300006880 Bacteria 1740
63 Ga0097620_100071988 3300006931 Bacteria 3492
64 Ga0097620_100132348 3300006931 Bacteria 2566
65 Ga0097620_100138432 3300006931 Bacteria 2508
66 Ga0097620_100321916 3300006931 Bacteria 1640
67 Ga0105240_10001961 3300009093 Bacteria 34012
68 Ga0111539_10004665 3300009094 Bacteria 17916
69 Ga0111539_10017660 3300009094 Bacteria 8831
70 Ga0111539_10026272 3300009094 Bacteria 7121
71 Ga0111539_10074869 3300009094 Bacteria 3989
72 Ga0111539_10081303 3300009094 Bacteria 3811
73 Ga0114129_10089555 3300009147 Bacteria 4266
74 Ga0114129_10170019 3300009147 Bacteria 2972
75 Ga0105242_10044042 3300009176 Unclassified 3612
76 Ga0105237_10005872 3300009545 Bacteria 13767
77 Ga0105237_10017333 3300009545 Bacteria 7468
78 Ga0105237_10022345 3300009545 Bacteria 6492
79 Ga0105237_10028317 3300009545 Bacteria 5708
80 Ga0105238_10000059 3300009551 Bacteria 130110
81 Ga0105238_10000667 3300009551 Bacteria 36055
82 Ga0105249_10026081 3300009553 Bacteria 5264
83 Ga0105239_10008991 3300010375 Bacteria 11307
84 Ga0105239_10238727 3300010375 Bacteria 2040
85 Ga0157370_10123777 3300013104 Bacteria 2414
86 Ga0157369_10175101 3300013105 Unclassified 2259
87 Ga0157372_10005446 3300013307 Bacteria 13526
88 Ga0157372_10216715 3300013307 Unclassified 2219
89 Ga0157375_10000111 3300013308 Bacteria 79589
90 Ga0163163_10000133 3300014325 Bacteria 76552
91 Ga0163163_10013269 3300014325 Bacteria 7537
92 Ga0163163_10031103 3300014325 Bacteria 5150
93 Ga0163163_10115020 3300014325 Bacteria 2722
94 Ga0157379_10016060 3300014968 Bacteria 6583
95 Ga0157376_10201614 3300014969 Bacteria 1831
96 Ga0157376_10312386 3300014969 Bacteria 1491
97 Ga0209050_1000964 3300025298 Bacteria 37092
98 Ga0209050_1001986 3300025298 Bacteria 19173
99 Ga0207705_10000408 3300025909 Bacteria 37751
100 Ga0207705_10001028 3300025909 Bacteria 22682
101 Ga0207705_10003757 3300025909 Bacteria 11565
102 Ga0207707_10044230 3300025912 Bacteria 3882
103 Ga0207695_10002359 3300025913 Bacteria 28068
104 Ga0207695_10093031 3300025913 Bacteria 3024
105 Ga0207671_10014379 3300025914 Bacteria 6259
106 Ga0207671_10032609 3300025914 Bacteria 3875
107 Ga0207657_10101265 3300025919 Bacteria 2391
108 Ga0207694_10000483 3300025924 Bacteria 36260
109 Ga0207694_10009336 3300025924 Bacteria 7399
110 Ga0207650_10012395 3300025925 Bacteria 5886
111 Ga0207687_10031228 3300025927 Bacteria 3598
112 Ga0207687_10130124 3300025927 Bacteria 1895
113 Ga0207670_10002138 3300025936 Bacteria 10336
114 Ga0207670_10011351 3300025936 Bacteria 5167
115 Ga0207670_10024216 3300025936 Bacteria 3792
116 Ga0207670_10024352 3300025936 Bacteria 3782
117 Ga0207711_10177524 3300025941 Bacteria 1935
118 Ga0207667_10035503 3300025949 Bacteria 5348
119 Ga0207667_10065045 3300025949 Bacteria 3805
120 Ga0207667_10070923 3300025949 Bacteria 3625
121 Ga0207667_10129233 3300025949 Bacteria 2602
122 Ga0207703_10075464 3300026035 Bacteria 2794
123 Ga0207639_10000001 3300026041 Bacteria 1431562
124 Ga0207641_10016636 3300026088 Bacteria 6022
125 Ga0207641_10273218 3300026088 Bacteria 1586
126 Ga0207674_10003625 3300026116 Bacteria 18829
127 Ga0207674_10133224 3300026116 Bacteria 2448
128 Ga0207428_10004952 3300027907 Bacteria 12540
129 Ga0207428_10118295 3300027907 Bacteria 2033
130 Ga0268266_10002927 3300028379 Bacteria 17658
131 Ga0268264_10264594 3300028381 Bacteria 1604
132 Ga0265338_10002860 3300028800 Bacteria 25206
133 Ga0265338_10010421 3300028800 Bacteria 10905
134 Ga0265338_10107551 3300028800 Bacteria 2255
135 Ga0265760_10008992 3300031090 Bacteria 2853
136 Ga0265328_10019595 3300031239 Unclassified 2596
137 Ga0265325_10001582 3300031241 Bacteria 15864
138 Ga0265329_10010842 3300031242 Bacteria 3333
139 Ga0265339_10001491 3300031249 Bacteria 17295
140 Ga0265331_10000014 3300031250 Bacteria 294002
141 Ga0265327_10003880 3300031251 Bacteria 13772
142 Ga0265327_10006140 3300031251 Bacteria 9719
143 Ga0265313_10000332 3300031595 Bacteria 51521
144 Ga0265314_10000105 3300031711 Bacteria 126697
145 Ga0265314_10000547 3300031711 Bacteria 48148
146 Ga0265314_10014514 3300031711 Bacteria 6296
147 Ga0265314_10017896 3300031711 Bacteria 5548
148 Ga0265342_10010110 3300031712 Bacteria 6577
149 Ga0307414_10040562 3300032004 Unclassified 3146
150 Ga0373937_0033737 3300036401 Bacteria 4652
151 Ga0373937_0076480 3300036401 Unclassified 3092
152 Ga0373937_0163698 3300036401 Bacteria 2086
153 Ga0395900_0258557 3300037418 Bacteria 1740
154 Ga0395905_0014729 3300037471 Bacteria 7456
155 Ga0395905_0114992 3300037471 Bacteria 2528
156 Ga0436364_0907236 3300037853 Bacteria 1442
157 Ga0451577_0002743 3300042876 Bacteria 20409
158 Ga0451576_0140342 3300045051 Bacteria 2520
159 Ga0451576_0197044 3300045051 Bacteria 2104
160 Ga0495651_0080137 3300046462 Bacteria 2467
161 Ga0495653_0109941 3300046463 Bacteria 1983
162 Ga0495580_0001953 3300046472 Bacteria 18098
163 Ga0495580_0008003 3300046472 Bacteria 8448
164 Ga0495580_0051052 3300046472 Bacteria 2924
165 Ga0495639_0004894 3300046475 Bacteria 5747
166 Ga0495664_0020449 3300046477 Bacteria 3818
167 Ga0495664_0070111 3300046477 Bacteria 2093
168 Ga0495608_0001138 3300046511 Bacteria 18833
169 Ga0495628_0070994 3300046516 Bacteria 2715
170 Ga0495630_0002449 3300046517 Bacteria 12840
171 Ga0495643_0000125 3300046522 Bacteria 124041
172 Ga0495643_0000658 3300046522 Bacteria 40804
173 Ga0495666_0064767 3300046526 Bacteria 1744
174 Ga0495652_0066215 3300046529 Bacteria 3033
175 Ga0495665_0011431 3300046531 Bacteria 4804
176 Ga0495640_0109772 3300046533 Bacteria 1803
177 Ga0495667_0013752 3300046559 Bacteria 5467
178 Ga0495667_0055875 3300046559 Bacteria 2596
179 Ga0495635_0064038 3300046663 Bacteria 2525
180 Ga0495599_0075679 3300046678 Bacteria 2102
181 Ga0495623_0014135 3300046679 Bacteria 5170
182 Ga0495658_0007748 3300046683 Bacteria 5322
183 Ga0495658_0036197 3300046683 Bacteria 2721
184 Ga0495624_0024816 3300046690 Bacteria 3943
185 Ga0495600_0003561 3300046809 Bacteria 9163
186 Ga0495581_0002729 3300047315 Bacteria 10057
187 Ga0495604_0003985 3300047317 Bacteria 11744
188 Ga0495604_0012753 3300047317 Bacteria 6690
189 Ga0495674_0001438 3300047319 Bacteria 23327
190 Ga0495674_0004156 3300047319 Bacteria 13975
191 Ga0495674_0005234 3300047319 Bacteria 12454
192 Ga0495680_0079013 3300047322 Bacteria 2489
193 Ga0495675_0000952 3300047444 Bacteria 17600
194 Ga0495684_0000486 3300047471 Bacteria 32499
195 Ga0495684_0001283 3300047471 Bacteria 20177
196 Ga0495684_0006311 3300047471 Bacteria 9215
197 Ga0495684_0010596 3300047471 Bacteria 7126
198 Ga0495602_0001815 3300048088 Bacteria 21324
199 Ga0496104_0145160 3300048907 Bacteria 2279
200 Ga0496113_0090015 3300048916 Bacteria 2363
201 Ga0501031_0002499 3300049568 Bacteria 11713
202 Ga0501032_0000976 3300049569 Bacteria 23145
203 Ga0501033_0001872 3300049570 Bacteria 18302
204 Ga0501034_0002219 3300049571 Bacteria 23991
205 Ga0501034_0012142 3300049571 Bacteria 8904
206 Ga0501034_0014834 3300049571 Bacteria 8017
207 Ga0501034_0026264 3300049571 Bacteria 5931
208 Ga0501034_0041338 3300049571 Bacteria 4664
209 Ga0501034_0084257 3300049571 Bacteria 3181
210 Ga0501037_0027508 3300049573 Bacteria 4201
211 Ga0501038_0002417 3300049574 Bacteria 17397
212 Ga0501039_0005332 3300049575 Bacteria 9725
213 Ga0501043_0000669 3300049579 Bacteria 30237
214 Ga0501046_0007116 3300049580 Bacteria 9843
215 Ga0501046_0056659 3300049580 Bacteria 3075
216 Ga0501047_0029227 3300049581 Bacteria 5316
217 Ga0501047_0066743 3300049581 Bacteria 3468
218 Ga0501047_0072259 3300049581 Bacteria 3321
219 Ga0501047_0088392 3300049581 Bacteria 2976
220 Ga0501047_0092566 3300049581 Bacteria 2901
221 Ga0501067_0000291 3300049583 Bacteria 27391
222 Ga0501068_0003322 3300049584 Bacteria 8629
223 Ga0501069_0000904 3300049585 Bacteria 14142
224 Ga0501070_0001097 3300049586 Bacteria 24297
225 Ga0501070_0152432 3300049586 Bacteria 1907
226 Ga0501072_0000619 3300049588 Bacteria 25512
227 Ga0501073_0086240 3300049589 Bacteria 2183
228 Ga0501073_0126694 3300049589 Bacteria 1770
229 Ga0501074_0019495 3300049590 Bacteria 4925
230 Ga0501080_0000018 3300049742 Bacteria 95463
231 Ga0501080_0051178 3300049742 Bacteria 3843
232 Ga0501080_0141542 3300049742 Bacteria 2224
233 Ga0501083_0005887 3300049744 Bacteria 8675
234 Ga0501035_0162477 3300049822 Bacteria 1932
235 Ga0501044_0037399 3300049823 Bacteria 5074
236 Ga0501044_0049000 3300049823 Bacteria 4360
237 Ga0501044_0078059 3300049823 Bacteria 3356
238 Ga0501044_0124077 3300049823 Bacteria 2581
239 Ga0501044_0198210 3300049823 Bacteria 1967
240 nmdc:mga09592_17066_c1 3300050508 Bacteria 5942
241 nmdc:mga09592_44016_c1 3300050508 Bacteria 3756
242 nmdc:mga09592_91569_c1 3300050508 Bacteria 2598
243 nmdc:mga0qj67_88901_c1 3300050509 Bacteria 2480
244 nmdc:mga06r32_152608_c1 3300050510 Bacteria 2289
245 nmdc:mga06r32_23397_c1 3300050510 Bacteria 5714
246 nmdc:mga06r32_339070_c1 3300050510 Bacteria 1488
247 nmdc:mga08y16_213068_c1 3300050511 Bacteria 2000
248 nmdc:mga08y16_247987_c1 3300050511 Unclassified 1840
249 nmdc:mga08y16_33880_c1 3300050511 Bacteria 5365
250 nmdc:mga08y16_70065_c1 3300050511 Bacteria 3655
251 nmdc:mga08y16_84505_c1 3300050511 Bacteria 3308
252 nmdc:mga08y16_897_c1 3300050511 Bacteria 28774
253 nmdc:mga0a205_1947_c1 3300050515 Bacteria 12759
254 Ga0495601_0000811 3300053077 Bacteria 16914
255 Ga0495601_0144956 3300053077 Bacteria 1550
256 Ga0495619_0120914 3300053085 Bacteria 1795
257 Ga0500568_0016806 3300053139 Bacteria 3242
258 Ga0500616_0001466 3300053153 Bacteria 22489
259 Ga0500616_0002097 3300053153 Bacteria 17389
260 Ga0500616_0003278 3300053153 Bacteria 12492
261 Ga0501084_0000401 3300054114 Bacteria 33405
262 Ga0501084_0103365 3300054114 Bacteria 2392
263 Ga0501082_0000845 3300060353 Bacteria 26985
264 Ga0501082_0002852 3300060353 Bacteria 15059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0075679 Ga0495599_0075679_22_1269 402
2 3300053085 Ga0495619_0120914 Ga0495619_0120914_21_1268 402
3 3300025927 Ga0207687_10130124 Ga0207687_101301242 404
4 3300046477 Ga0495664_0070111 Ga0495664_0070111_20_1273 404
5 3300050511 nmdc:mga08y16_247987_c1 nmdc:mga08y16_247987_c1_555_1817 404
6 3300037853 Ga0436364_0907236 Ga0436364_0907236_142_1431 416
7 3300048916 Ga0496113_0090015 Ga0496113_0090015_60_1355 418
8 3300005458 Ga0070681_10077648 Ga0070681_100776482 419
9 3300005544 Ga0070686_100004872 Ga0070686_1000048725 419
10 3300006237 Ga0097621_100191563 Ga0097621_1001915631 419
11 3300025912 Ga0207707_10044230 Ga0207707_100442302 419
12 3300009551 Ga0105238_10000059 Ga0105238_1000005940 420
13 3300046472 Ga0495580_0008003 Ga0495580_0008003_4859_6274 420
14 3300060353 Ga0501082_0000845 Ga0501082_0000845_21826_23136 423
15 3300037418 Ga0395900_0258557 Ga0395900_0258557_102_1523 425
16 3300037471 Ga0395905_0114992 Ga0395905_0114992_260_1681 425
17 3300050510 nmdc:mga06r32_339070_c1 nmdc:mga06r32_339070_c1_24_1370 427
18 3300005329 Ga0070683_100127662 Ga0070683_1001276623 431
19 3300006846 Ga0075430_100076846 Ga0075430_1000768462 431
20 3300050511 nmdc:mga08y16_70065_c1 nmdc:mga08y16_70065_c1_1035_2429 431
21 3300005617 Ga0068859_100132347 Ga0068859_1001323472 433
22 3300006931 Ga0097620_100132348 Ga0097620_1001323481 433
23 3300050509 nmdc:mga0qj67_88901_c1 nmdc:mga0qj67_88901_c1_1019_2383 433
24 3300005327 Ga0070658_10007248 Ga0070658_100072482 434
25 3300025909 Ga0207705_10000408 Ga0207705_1000040825 434
26 3300005844 Ga0068862_100194591 Ga0068862_1001945912 436
27 3300006844 Ga0075428_100009369 Ga0075428_1000093697 436
28 3300049568 Ga0501031_0002499 Ga0501031_0002499_5560_6960 436
29 3300049569 Ga0501032_0000976 Ga0501032_0000976_7827_9227 436
30 3300049574 Ga0501038_0002417 Ga0501038_0002417_553_1953 436
31 3300049579 Ga0501043_0000669 Ga0501043_0000669_11658_13058 436
32 3300049581 Ga0501047_0092566 Ga0501047_0092566_841_2241 436
33 3300049583 Ga0501067_0000291 Ga0501067_0000291_6743_8143 436
34 3300049584 Ga0501068_0003322 Ga0501068_0003322_3820_5220 436
35 3300049585 Ga0501069_0000904 Ga0501069_0000904_5653_7053 436
36 3300049588 Ga0501072_0000619 Ga0501072_0000619_10165_11565 436
37 3300049589 Ga0501073_0086240 Ga0501073_0086240_134_1534 436
38 3300049590 Ga0501074_0019495 Ga0501074_0019495_2748_4148 436
39 3300049742 Ga0501080_0000018 Ga0501080_0000018_80117_81517 436
40 3300049823 Ga0501044_0049000 Ga0501044_0049000_2555_3955 436
41 3300054114 Ga0501084_0000401 Ga0501084_0000401_11686_13086 436
42 3300060353 Ga0501082_0002852 Ga0501082_0002852_13526_14926 436
43 3300005295 Ga0065707_10133730 Ga0065707_101337302 437
44 3300005539 Ga0068853_100043914 Ga0068853_1000439142 437
45 3300006880 Ga0075429_100102383 Ga0075429_1001023832 437
46 3300009094 Ga0111539_10081303 Ga0111539_100813032 437
47 3300025924 Ga0207694_10000483 Ga0207694_100004833 437
48 3300027907 Ga0207428_10118295 Ga0207428_101182952 437
49 3300031251 Ga0265327_10003880 Ga0265327_100038806 437
50 3300046522 Ga0495643_0000658 Ga0495643_0000658_26000_27352 437
51 3300049586 Ga0501070_0152432 Ga0501070_0152432_310_1722 437
52 3300050511 nmdc:mga08y16_33880_c1 nmdc:mga08y16_33880_c1_3349_4773 437
53 3300009545 Ga0105237_10005872 Ga0105237_100058727 438
54 3300025909 Ga0207705_10001028 Ga0207705_100010287 438
55 3300025914 Ga0207671_10032609 Ga0207671_100326095 438
56 3300046529 Ga0495652_0066215 Ga0495652_0066215_578_1939 438
57 3300005331 Ga0070670_100025279 Ga0070670_1000252791 439
58 3300005563 Ga0068855_100153513 Ga0068855_1001535132 439
59 3300006880 Ga0075429_100155259 Ga0075429_1001552592 439
60 3300010375 Ga0105239_10008991 Ga0105239_100089916 439
61 3300025949 Ga0207667_10129233 Ga0207667_101292332 439
62 3300005290 Ga0065712_10112404 Ga0065712_101124041 440
63 3300005340 Ga0070689_100010030 Ga0070689_1000100302 440
64 3300005340 Ga0070689_100019826 Ga0070689_1000198262 440
65 3300005444 Ga0070694_100004055 Ga0070694_1000040557 440
66 3300005544 Ga0070686_100033159 Ga0070686_1000331592 440
67 3300005549 Ga0070704_100002198 Ga0070704_1000021987 440
68 3300005618 Ga0068864_100158028 Ga0068864_1001580283 440
69 3300005841 Ga0068863_100225991 Ga0068863_1002259911 440
70 3300006844 Ga0075428_100003043 Ga0075428_1000030433 440
71 3300009094 Ga0111539_10026272 Ga0111539_100262723 440
72 3300009147 Ga0114129_10089555 Ga0114129_100895552 440
73 3300025936 Ga0207670_10011351 Ga0207670_100113516 440
74 3300025936 Ga0207670_10024352 Ga0207670_100243522 440
75 3300026088 Ga0207641_10273218 Ga0207641_102732181 440
76 3300046683 Ga0495658_0036197 Ga0495658_0036197_1000_2418 440
77 3300050511 nmdc:mga08y16_213068_c1 nmdc:mga08y16_213068_c1_153_1571 440
78 3300028800 Ga0265338_10010421 Ga0265338_100104218 441
79 3300031241 Ga0265325_10001582 Ga0265325_100015827 441
80 3300031249 Ga0265339_10001491 Ga0265339_1000149115 441
81 3300031250 Ga0265331_10000014 Ga0265331_100000149 441
82 3300031595 Ga0265313_10000332 Ga0265313_100003324 441
83 3300031711 Ga0265314_10000547 Ga0265314_100005478 441
84 3300031712 Ga0265342_10010110 Ga0265342_100101103 441
85 3300009553 Ga0105249_10026081 Ga0105249_100260812 442
86 3300026088 Ga0207641_10016636 Ga0207641_100166364 442
87 3300025298 Ga0209050_1001986 Ga0209050_10019868 443
88 3300049742 Ga0501080_0141542 Ga0501080_0141542_694_2118 443
89 3300053153 Ga0500616_0001466 Ga0500616_0001466_6869_8293 443
90 3300005539 Ga0068853_100000007 Ga0068853_10000000755 444
91 3300005563 Ga0068855_100037010 Ga0068855_1000370103 444
92 3300005842 Ga0068858_100098420 Ga0068858_1000984202 444
93 3300006237 Ga0097621_100224183 Ga0097621_1002241831 444
94 3300009176 Ga0105242_10044042 Ga0105242_100440422 444
95 3300014325 Ga0163163_10013269 Ga0163163_100132694 444
96 3300014969 Ga0157376_10201614 Ga0157376_102016141 444
97 3300014969 Ga0157376_10312386 Ga0157376_103123861 444
98 3300026035 Ga0207703_10075464 Ga0207703_100754642 444
99 3300026041 Ga0207639_10000001 Ga0207639_10000001167 444
100 3300028381 Ga0268264_10264594 Ga0268264_102645942 444
101 3300046462 Ga0495651_0080137 Ga0495651_0080137_723_2096 444
102 3300046463 Ga0495653_0109941 Ga0495653_0109941_593_1972 444
103 3300046472 Ga0495580_0001953 Ga0495580_0001953_9139_10512 444
104 3300046477 Ga0495664_0020449 Ga0495664_0020449_1178_2551 444
105 3300046516 Ga0495628_0070994 Ga0495628_0070994_669_2042 444
106 3300046522 Ga0495643_0000125 Ga0495643_0000125_33738_35180 444
107 3300046531 Ga0495665_0011431 Ga0495665_0011431_1492_2865 444
108 3300046533 Ga0495640_0109772 Ga0495640_0109772_62_1441 444
109 3300046559 Ga0495667_0055875 Ga0495667_0055875_412_1791 444
110 3300046679 Ga0495623_0014135 Ga0495623_0014135_1032_2405 444
111 3300046809 Ga0495600_0003561 Ga0495600_0003561_3845_5224 444
112 3300047317 Ga0495604_0003985 Ga0495604_0003985_8785_10164 444
113 3300047319 Ga0495674_0001438 Ga0495674_0001438_12447_13826 444
114 3300047319 Ga0495674_0004156 Ga0495674_0004156_9805_11178 444
115 3300047322 Ga0495680_0079013 Ga0495680_0079013_250_1623 444
116 3300047444 Ga0495675_0000952 Ga0495675_0000952_14351_15730 444
117 3300047471 Ga0495684_0000486 Ga0495684_0000486_17949_19322 444
118 3300047471 Ga0495684_0001283 Ga0495684_0001283_3809_5188 444
119 3300047471 Ga0495684_0010596 Ga0495684_0010596_2922_4295 444
120 3300048088 Ga0495602_0001815 Ga0495602_0001815_3166_4539 444
121 3300006880 Ga0075429_100051376 Ga0075429_1000513762 447
122 3300050508 nmdc:mga09592_44016_c1 nmdc:mga09592_44016_c1_791_2305 447
123 3300050511 nmdc:mga08y16_84505_c1 nmdc:mga08y16_84505_c1_438_1826 447
124 3300005563 Ga0068855_100101577 Ga0068855_1001015772 448
125 3300006847 Ga0075431_100018874 Ga0075431_1000188748 448
126 3300006880 Ga0075429_100098292 Ga0075429_1000982922 448
127 3300013105 Ga0157369_10175101 Ga0157369_101751012 448
128 3300050508 nmdc:mga09592_91569_c1 nmdc:mga09592_91569_c1_584_1972 448
129 3300036401 Ga0373937_0163698 Ga0373937_0163698_422_1888 449
130 3300049581 Ga0501047_0066743 Ga0501047_0066743_30_1502 449
131 3300053077 Ga0495601_0144956 Ga0495601_0144956_35_1501 449
132 3300049571 Ga0501034_0002219 Ga0501034_0002219_1574_3010 450
133 3300049823 Ga0501044_0198210 Ga0501044_0198210_24_1424 450
134 3300014325 Ga0163163_10115020 Ga0163163_101150202 452
135 3300014968 Ga0157379_10016060 Ga0157379_100160603 452
136 3300049823 Ga0501044_0037399 Ga0501044_0037399_1778_3250 452
137 3300009093 Ga0105240_10001961 Ga0105240_1000196129 453
138 3300009545 Ga0105237_10022345 Ga0105237_100223452 453
139 3300014325 Ga0163163_10031103 Ga0163163_100311037 453
140 3300025913 Ga0207695_10002359 Ga0207695_1000235923 453
141 3300025913 Ga0207695_10093031 Ga0207695_100930313 453
142 3300025941 Ga0207711_10177524 Ga0207711_101775241 453
143 3300028800 Ga0265338_10107551 Ga0265338_101075512 453
144 3300049570 Ga0501033_0001872 Ga0501033_0001872_14572_15972 453
145 3300049573 Ga0501037_0027508 Ga0501037_0027508_788_2188 453
146 3300049575 Ga0501039_0005332 Ga0501039_0005332_8302_9702 453
147 3300049580 Ga0501046_0007116 Ga0501046_0007116_2257_3657 453
148 3300049742 Ga0501080_0051178 Ga0501080_0051178_405_1814 453
149 3300049744 Ga0501083_0005887 Ga0501083_0005887_6615_8015 453
150 3300049822 Ga0501035_0162477 Ga0501035_0162477_409_1809 453
151 3300005330 Ga0070690_100061468 Ga0070690_1000614682 454
152 3300005340 Ga0070689_100022970 Ga0070689_1000229706 454
153 3300005340 Ga0070689_100034460 Ga0070689_1000344601 454
154 3300005340 Ga0070689_100040283 Ga0070689_1000402832 454
155 3300005844 Ga0068862_100110689 Ga0068862_1001106893 454
156 3300006844 Ga0075428_100001355 Ga0075428_1000013553 454
157 3300006844 Ga0075428_100004859 Ga0075428_1000048594 454
158 3300006844 Ga0075428_100039346 Ga0075428_1000393463 454
159 3300006847 Ga0075431_100169246 Ga0075431_1001692462 454
160 3300006847 Ga0075431_100184633 Ga0075431_1001846331 454
161 3300006852 Ga0075433_10002140 Ga0075433_100021408 454
162 3300006880 Ga0075429_100202229 Ga0075429_1002022291 454
163 3300009094 Ga0111539_10004665 Ga0111539_100046654 454
164 3300009094 Ga0111539_10017660 Ga0111539_100176603 454
165 3300009147 Ga0114129_10170019 Ga0114129_101700192 454
166 3300013308 Ga0157375_10000111 Ga0157375_1000011138 454
167 3300014325 Ga0163163_10000133 Ga0163163_1000013335 454
168 3300025936 Ga0207670_10002138 Ga0207670_1000213812 454
169 3300025936 Ga0207670_10024216 Ga0207670_100242162 454
170 3300027907 Ga0207428_10004952 Ga0207428_100049522 454
171 3300028800 Ga0265338_10002860 Ga0265338_100028602 454
172 3300036401 Ga0373937_0076480 Ga0373937_0076480_99_1586 454
173 3300037471 Ga0395905_0014729 Ga0395905_0014729_1629_3089 454
174 3300045051 Ga0451576_0140342 Ga0451576_0140342_926_2434 454
175 3300046526 Ga0495666_0064767 Ga0495666_0064767_43_1488 454
176 3300050508 nmdc:mga09592_17066_c1 nmdc:mga09592_17066_c1_4335_5828 454
177 3300050510 nmdc:mga06r32_152608_c1 nmdc:mga06r32_152608_c1_369_1814 454
178 3300050510 nmdc:mga06r32_23397_c1 nmdc:mga06r32_23397_c1_2174_3610 454
179 3300050511 nmdc:mga08y16_897_c1 nmdc:mga08y16_897_c1_11828_13321 454
180 3300050515 nmdc:mga0a205_1947_c1 nmdc:mga0a205_1947_c1_8853_10277 454
181 3300005548 Ga0070665_100003235 Ga0070665_1000032351 455
182 3300005563 Ga0068855_100056465 Ga0068855_1000564653 455
183 3300005563 Ga0068855_100110250 Ga0068855_1001102505 455
184 3300005617 Ga0068859_100138430 Ga0068859_1001384302 455
185 3300005617 Ga0068859_100321953 Ga0068859_1003219531 455
186 3300006931 Ga0097620_100138432 Ga0097620_1001384322 455
187 3300006931 Ga0097620_100321916 Ga0097620_1003219161 455
188 3300025949 Ga0207667_10065045 Ga0207667_100650451 455
189 3300025949 Ga0207667_10070923 Ga0207667_100709231 455
190 3300028379 Ga0268266_10002927 Ga0268266_1000292720 455
191 3300031711 Ga0265314_10014514 Ga0265314_100145142 455
192 3300045051 Ga0451576_0197044 Ga0451576_0197044_672_2090 455
193 3300049580 Ga0501046_0056659 Ga0501046_0056659_1220_2677 455
194 3300049581 Ga0501047_0029227 Ga0501047_0029227_520_1977 455
195 3300049586 Ga0501070_0001097 Ga0501070_0001097_16655_18112 455
196 3300049823 Ga0501044_0078059 Ga0501044_0078059_128_1585 455
197 3300006844 Ga0075428_100099019 Ga0075428_1000990192 456
198 3300048907 Ga0496104_0145160 Ga0496104_0145160_742_2163 460
199 3300013307 Ga0157372_10216715 Ga0157372_102167152 461
200 3300049571 Ga0501034_0012142 Ga0501034_0012142_2840_4285 461
201 3300031711 Ga0265314_10017896 Ga0265314_100178962 463
202 3300042876 Ga0451577_0002743 Ga0451577_0002743_8812_10254 463
203 3300049589 Ga0501073_0126694 Ga0501073_0126694_265_1698 463
204 3300053139 Ga0500568_0016806 Ga0500568_0016806_853_2298 464
205 3300053153 Ga0500616_0003278 Ga0500616_0003278_8456_9901 464
206 iso_pu_bacteria 2889415604 2889419285 464
207 iso_pu_bacteria 2671180531 2673166814 465
208 iso_pu_bacteria 2687453257 2688070272 465
209 3300009545 Ga0105237_10028317 Ga0105237_100283173 466
210 3300013104 Ga0157370_10123777 Ga0157370_101237772 466
211 3300036401 Ga0373937_0033737 Ga0373937_0033737_1213_2703 466
212 3300049581 Ga0501047_0088392 Ga0501047_0088392_698_2137 466
213 3300053153 Ga0500616_0002097 Ga0500616_0002097_7509_8990 466
214 3300005577 Ga0068857_100001967 Ga0068857_1000019679 467
215 3300010375 Ga0105239_10238727 Ga0105239_102387272 467
216 3300013307 Ga0157372_10005446 Ga0157372_100054462 467
217 3300025927 Ga0207687_10031228 Ga0207687_100312282 467
218 3300026116 Ga0207674_10003625 Ga0207674_1000362516 467
219 3300031090 Ga0265760_10008992 Ga0265760_100089922 467
220 3300046472 Ga0495580_0051052 Ga0495580_0051052_1375_2850 467
221 3300046475 Ga0495639_0004894 Ga0495639_0004894_166_1641 467
222 3300046511 Ga0495608_0001138 Ga0495608_0001138_1889_3340 467
223 3300046517 Ga0495630_0002449 Ga0495630_0002449_1325_2800 467
224 3300046559 Ga0495667_0013752 Ga0495667_0013752_111_1562 467
225 3300046663 Ga0495635_0064038 Ga0495635_0064038_630_2105 467
226 3300046683 Ga0495658_0007748 Ga0495658_0007748_982_2496 467
227 3300046690 Ga0495624_0024816 Ga0495624_0024816_257_1732 467
228 3300047315 Ga0495581_0002729 Ga0495581_0002729_2289_3764 467
229 3300047317 Ga0495604_0012753 Ga0495604_0012753_2955_4406 467
230 3300047319 Ga0495674_0005234 Ga0495674_0005234_9751_11226 467
231 3300047471 Ga0495684_0006311 Ga0495684_0006311_889_2364 467
232 3300053077 Ga0495601_0000811 Ga0495601_0000811_7998_9449 467
233 iso_pu_bacteria 2684623219 2687234523 467
234 3300009094 Ga0111539_10074869 Ga0111539_100748693 468
235 3300032004 Ga0307414_10040562 Ga0307414_100405622 468
236 3300049571 Ga0501034_0041338 Ga0501034_0041338_297_1748 468
237 3300049581 Ga0501047_0072259 Ga0501047_0072259_124_1581 468
238 3300049823 Ga0501044_0124077 Ga0501044_0124077_198_1655 468
239 3300054114 Ga0501084_0103365 Ga0501084_0103365_626_2080 468
240 iso_pu_bacteria 2687453341 2688392589 468
241 3300005290 Ga0065712_10077811 Ga0065712_100778112 469
242 3300005365 Ga0070688_100097580 Ga0070688_1000975802 469
243 3300005438 Ga0070701_10015190 Ga0070701_100151902 469
244 3300005539 Ga0068853_100000001 Ga0068853_100000001373 469
245 3300005544 Ga0070686_100006402 Ga0070686_1000064025 469
246 3300005563 Ga0068855_100039210 Ga0068855_1000392102 469
247 3300005842 Ga0068858_100067505 Ga0068858_1000675051 469
248 3300005937 Ga0081455_10039993 Ga0081455_100399933 469
249 3300006844 Ga0075428_100174977 Ga0075428_1001749772 469
250 3300006931 Ga0097620_100071988 Ga0097620_1000719882 469
251 3300009551 Ga0105238_10000667 Ga0105238_100006676 469
252 3300025298 Ga0209050_1000964 Ga0209050_100096422 469
253 3300025924 Ga0207694_10009336 Ga0207694_100093362 469
254 3300025925 Ga0207650_10012395 Ga0207650_100123952 469
255 3300025949 Ga0207667_10035503 Ga0207667_100355032 469
256 3300026041 Ga0207639_10000001 Ga0207639_10000001721 469
257 3300026116 Ga0207674_10133224 Ga0207674_101332242 469
258 3300031251 Ga0265327_10006140 Ga0265327_100061402 469
259 3300049571 Ga0501034_0014834 Ga0501034_0014834_4658_6178 469
260 3300005289 Ga0065704_10083987 Ga0065704_100839872 470
261 3300005327 Ga0070658_10002039 Ga0070658_100020398 470
262 3300009545 Ga0105237_10017333 Ga0105237_100173332 470
263 3300025909 Ga0207705_10003757 Ga0207705_100037572 470
264 3300025914 Ga0207671_10014379 Ga0207671_100143792 470
265 3300025919 Ga0207657_10101265 Ga0207657_101012652 470
266 3300031239 Ga0265328_10019595 Ga0265328_100195952 470
267 3300031242 Ga0265329_10010842 Ga0265329_100108422 470
268 3300031711 Ga0265314_10000105 Ga0265314_1000010577 470
269 3300049571 Ga0501034_0026264 Ga0501034_0026264_1386_2873 470
270 3300049571 Ga0501034_0084257 Ga0501034_0084257_888_2387 470
271 iso_pu_bacteria 2920107658 2920114475 470

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

79

515

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m7m-assembly1.cif.gz_A novel imidazo[1,2-a]pyridine derivatives with potent autotaxin/enpp2 inhibitor activity 0.6715 299 378
4gtz-assembly1.cif.gz_A crystal structure of mouse enpp1 in complex with cmp 0.6542 282 378
6rdz-assembly1.cif.gz_H cryo-em structure of polytomella f-atp synthase, rotary substate 2a, composite map 0.6473 211 258
7p4j-assembly1.cif.gz_A crystal structure of autotaxin and tetrahydrocannabinol 0.6445 299 378
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.6411 282 377
ID Description Score Start End Superfamily
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6401 297 378 3.40.720.10
4gtyB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6374 282 377 3.40.720.10
af_Q9W0F7_144_431_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6365 297 376 3.40.720.10
1shqA00 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6104 297 416 3.40.720.10
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.609 289 453 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A3B8PRC3-F1-model_v4 DUF1501 domain-containing protein 0.9431 267 367
AF-A0A353DWW6-F1-model_v4 DUF1501 domain-containing protein 0.9383 55 470
AF-A0A3C1UME5-F1-model_v4 DUF1501 domain-containing protein 0.9355 248 470
AF-A0A351FCR5-F1-model_v4 DUF1501 domain-containing protein 0.933 246 470
AF-A0A3L7PK19-F1-model_v4 DUF1501 domain-containing protein 0.9326 50 470

Feature Viewer

pLDDT pTM Quality
79.98 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map