F377683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 183 | 271 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300025904|Ga0207647_10229517|Ga0207647_102295172 |
| Length | 244 |
| Sequence | VIRVAVSGAAGRMGQAVCEAVEAAGDTELSGRADPALGTGLADVLGGADVVVDFTTPDTALDNAEACLAAGVHVVVGTTGFDLERLEAAAEASQANCFVAPNFAIGAVLLMRFAQEAARYFPSVEVVELHHPHKVDAPSGTAVRTARLIAAARRAAGLPSVPDATTDALPGARGADVEGISVHAVRLTGLVAHQEVLMGAAGETLTLRHDSYDRTSFMPGVLLAVREIAGHPGLTVGIESFLGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 31 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 82 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 83 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 85 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 86 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 90 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 91 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 92 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 93 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 94 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 95 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 130 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 131 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 132 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 133 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 141 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 142 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 143 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 144 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 145 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 146 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 147 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 181 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 8.12 |
| Rhizosphere | 87.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003657 | 3300001977 | Bacteria | 2423 |
| 2 | Ga0070683_100038595 | 3300005329 | Bacteria | 4379 |
| 3 | Ga0070683_100094024 | 3300005329 | Bacteria | 2817 |
| 4 | Ga0070682_100000075 | 3300005337 | Bacteria | 90547 |
| 5 | Ga0070661_100000099 | 3300005344 | Bacteria | 71115 |
| 6 | Ga0070674_100521054 | 3300005356 | Bacteria | 993 |
| 7 | Ga0070659_100065555 | 3300005366 | Bacteria | 2876 |
| 8 | Ga0070667_100045207 | 3300005367 | Bacteria | 3701 |
| 9 | Ga0070667_100675632 | 3300005367 | Bacteria | 954 |
| 10 | Ga0070709_10499428 | 3300005434 | Bacteria | 924 |
| 11 | Ga0070713_100091689 | 3300005436 | Bacteria | 2615 |
| 12 | Ga0070701_10226220 | 3300005438 | Bacteria | 1118 |
| 13 | Ga0070708_100891657 | 3300005445 | Bacteria | 835 |
| 14 | Ga0070663_100005524 | 3300005455 | Bacteria | 7520 |
| 15 | Ga0070662_100185649 | 3300005457 | Bacteria | 1642 |
| 16 | Ga0070681_10084429 | 3300005458 | Bacteria | 3128 |
| 17 | Ga0070685_10003546 | 3300005466 | Bacteria | 7927 |
| 18 | Ga0070679_100000369 | 3300005530 | Bacteria | 38264 |
| 19 | Ga0070679_100137534 | 3300005530 | Bacteria | 2424 |
| 20 | Ga0070684_100073244 | 3300005535 | Bacteria | 3018 |
| 21 | Ga0070684_100105533 | 3300005535 | Bacteria | 2521 |
| 22 | Ga0070684_100146101 | 3300005535 | Bacteria | 2140 |
| 23 | Ga0070697_100615397 | 3300005536 | Bacteria | 955 |
| 24 | Ga0068853_100021307 | 3300005539 | Bacteria | 5402 |
| 25 | Ga0068853_100185557 | 3300005539 | Bacteria | 1888 |
| 26 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 27 | Ga0070686_100338635 | 3300005544 | Bacteria | 1127 |
| 28 | Ga0070665_100018070 | 3300005548 | Bacteria | 7077 |
| 29 | Ga0070665_100136231 | 3300005548 | Bacteria | 2458 |
| 30 | Ga0068855_100136015 | 3300005563 | Bacteria | 2804 |
| 31 | Ga0068854_100000597 | 3300005578 | Bacteria | 21452 |
| 32 | Ga0068856_100150467 | 3300005614 | Bacteria | 2336 |
| 33 | Ga0068856_100964290 | 3300005614 | Bacteria | 871 |
| 34 | Ga0068852_100000056 | 3300005616 | Bacteria | 76111 |
| 35 | Ga0068852_100001985 | 3300005616 | Bacteria | 13958 |
| 36 | Ga0068860_100095376 | 3300005843 | Bacteria | 2836 |
| 37 | Ga0081538_10000141 | 3300005981 | Bacteria | 74085 |
| 38 | Ga0081538_10072152 | 3300005981 | Bacteria | 1895 |
| 39 | Ga0081538_10108682 | 3300005981 | Bacteria | 1369 |
| 40 | Ga0070712_100027794 | 3300006175 | Bacteria | 3781 |
| 41 | Ga0075433_10271663 | 3300006852 | Bacteria | 1502 |
| 42 | Ga0075434_100133061 | 3300006871 | Bacteria | 2506 |
| 43 | Ga0068865_100000490 | 3300006881 | Bacteria | 22178 |
| 44 | Ga0075435_100156821 | 3300007076 | Bacteria | 1916 |
| 45 | Ga0105245_10000130 | 3300009098 | Bacteria | 72166 |
| 46 | Ga0105247_10062266 | 3300009101 | Bacteria | 2314 |
| 47 | Ga0105247_10203672 | 3300009101 | Bacteria | 1331 |
| 48 | Ga0114129_10510594 | 3300009147 | Bacteria | 1568 |
| 49 | Ga0105241_10304907 | 3300009174 | Bacteria | 1368 |
| 50 | Ga0105248_10290080 | 3300009177 | Bacteria | 1842 |
| 51 | Ga0105237_10130301 | 3300009545 | Bacteria | 2510 |
| 52 | Ga0105238_10093544 | 3300009551 | Bacteria | 2994 |
| 53 | Ga0105249_10000143 | 3300009553 | Bacteria | 92539 |
| 54 | Ga0105249_11417760 | 3300009553 | Bacteria | 767 |
| 55 | Ga0105239_10707258 | 3300010375 | Bacteria | 1152 |
| 56 | Ga0157371_10012360 | 3300013102 | Bacteria | 6530 |
| 57 | Ga0157370_10033402 | 3300013104 | Bacteria | 5017 |
| 58 | Ga0157374_10010755 | 3300013296 | Bacteria | 7888 |
| 59 | Ga0157378_10480435 | 3300013297 | Bacteria | 1238 |
| 60 | Ga0157375_10553376 | 3300013308 | Bacteria | 1312 |
| 61 | Ga0163163_10216764 | 3300014325 | Bacteria | 1963 |
| 62 | Ga0157379_10235418 | 3300014968 | Bacteria | 1660 |
| 63 | Ga0157376_10030681 | 3300014969 | Bacteria | 4296 |
| 64 | Ga0207682_10000091 | 3300025893 | Bacteria | 41479 |
| 65 | Ga0207710_10022601 | 3300025900 | Bacteria | 2700 |
| 66 | Ga0207680_10008001 | 3300025903 | Bacteria | 5176 |
| 67 | Ga0207647_10229517 | 3300025904 | Bacteria | 1068 |
| 68 | Ga0207685_10000028 | 3300025905 | Bacteria | 97935 |
| 69 | Ga0207685_10054325 | 3300025905 | Bacteria | 1559 |
| 70 | Ga0207643_10142471 | 3300025908 | Bacteria | 1432 |
| 71 | Ga0207705_10031957 | 3300025909 | Bacteria | 3760 |
| 72 | Ga0207654_10066353 | 3300025911 | Bacteria | 2128 |
| 73 | Ga0207707_10081665 | 3300025912 | Bacteria | 2822 |
| 74 | Ga0207693_10010394 | 3300025915 | Bacteria | 7557 |
| 75 | Ga0207652_10000321 | 3300025921 | Bacteria | 49720 |
| 76 | Ga0207652_10000827 | 3300025921 | Bacteria | 29489 |
| 77 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 78 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 79 | Ga0207687_10001820 | 3300025927 | Bacteria | 14678 |
| 80 | Ga0207687_10003571 | 3300025927 | Bacteria | 10467 |
| 81 | Ga0207690_10034255 | 3300025932 | Bacteria | 3271 |
| 82 | Ga0207691_10000747 | 3300025940 | Bacteria | 32117 |
| 83 | Ga0207661_10000921 | 3300025944 | Bacteria | 19315 |
| 84 | Ga0207661_10001320 | 3300025944 | Bacteria | 16601 |
| 85 | Ga0207661_10004833 | 3300025944 | Bacteria | 9441 |
| 86 | Ga0207679_10489688 | 3300025945 | Bacteria | 1096 |
| 87 | Ga0207667_10163879 | 3300025949 | Bacteria | 2286 |
| 88 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 89 | Ga0207640_10015656 | 3300025981 | Bacteria | 4395 |
| 90 | Ga0207658_10033211 | 3300025986 | Bacteria | 3679 |
| 91 | Ga0207678_10016549 | 3300026067 | Bacteria | 6475 |
| 92 | Ga0207708_10205378 | 3300026075 | Bacteria | 1573 |
| 93 | Ga0207702_10121120 | 3300026078 | Bacteria | 2342 |
| 94 | Ga0207702_10836252 | 3300026078 | Bacteria | 911 |
| 95 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 96 | Ga0207648_10011475 | 3300026089 | Bacteria | 8341 |
| 97 | Ga0207648_10119955 | 3300026089 | Bacteria | 2312 |
| 98 | Ga0207648_10232404 | 3300026089 | Bacteria | 1640 |
| 99 | Ga0207674_10218655 | 3300026116 | Bacteria | 1853 |
| 100 | Ga0207675_100230427 | 3300026118 | Bacteria | 1787 |
| 101 | Ga0207675_100688008 | 3300026118 | Bacteria | 1031 |
| 102 | Ga0207698_10011384 | 3300026142 | Bacteria | 5767 |
| 103 | Ga0207698_10012334 | 3300026142 | Bacteria | 5589 |
| 104 | Ga0207698_10507392 | 3300026142 | Bacteria | 1175 |
| 105 | Ga0268266_10000674 | 3300028379 | Bacteria | 46135 |
| 106 | Ga0268266_10037338 | 3300028379 | Bacteria | 4139 |
| 107 | Ga0268266_10227193 | 3300028379 | Bacteria | 1718 |
| 108 | Ga0316181_1229879 | 3300030744 | Bacteria | 821 |
| 109 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 110 | Ga0307405_10803469 | 3300031731 | Bacteria | 788 |
| 111 | Ga0307410_10503774 | 3300031852 | Bacteria | 997 |
| 112 | Ga0307415_100569830 | 3300032126 | Bacteria | 1002 |
| 113 | Ga0373937_0440861 | 3300036401 | Bacteria | 1236 |
| 114 | Ga0395900_0137055 | 3300037418 | Bacteria | 2508 |
| 115 | Ga0395901_0235935 | 3300038443 | Bacteria | 1909 |
| 116 | Ga0395901_1092396 | 3300038443 | Bacteria | 769 |
| 117 | Ga0451853_0696215 | 3300041512 | Bacteria | 2774 |
| 118 | Ga0439449_0032860 | 3300042007 | Bacteria | 1933 |
| 119 | Ga0466966_0051998 | 3300044684 | Bacteria | 2604 |
| 120 | Ga0466963_0000017 | 3300044694 | Bacteria | 58283 |
| 121 | Ga0466963_0014266 | 3300044694 | Bacteria | 4896 |
| 122 | Ga0466957_0076053 | 3300044842 | Bacteria | 2084 |
| 123 | Ga0466959_0357776 | 3300045049 | Bacteria | 995 |
| 124 | Ga0466959_0744789 | 3300045049 | Bacteria | 656 |
| 125 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 126 | Ga0466967_0030399 | 3300045976 | Bacteria | 4533 |
| 127 | Ga0466967_0031969 | 3300045976 | Bacteria | 4438 |
| 128 | Ga0466967_0062796 | 3300045976 | Bacteria | 3299 |
| 129 | Ga0466967_0120433 | 3300045976 | Bacteria | 2424 |
| 130 | Ga0495592_0000261 | 3300046454 | Bacteria | 44965 |
| 131 | Ga0495592_0048473 | 3300046454 | Bacteria | 3160 |
| 132 | Ga0495592_0126822 | 3300046454 | Bacteria | 1789 |
| 133 | Ga0495603_0026227 | 3300046455 | Bacteria | 3521 |
| 134 | Ga0495591_062451 | 3300046458 | Bacteria | 986 |
| 135 | Ga0495629_0002184 | 3300046459 | Bacteria | 15103 |
| 136 | Ga0495629_0083173 | 3300046459 | Bacteria | 2234 |
| 137 | Ga0495629_0105872 | 3300046459 | Bacteria | 1962 |
| 138 | Ga0495653_0116570 | 3300046463 | Bacteria | 1910 |
| 139 | Ga0495662_0003445 | 3300046476 | Bacteria | 8015 |
| 140 | Ga0495585_0112158 | 3300046492 | Bacteria | 1449 |
| 141 | Ga0495594_0000030 | 3300046499 | Bacteria | 66443 |
| 142 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 143 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 144 | Ga0495620_0000139 | 3300046515 | Bacteria | 59244 |
| 145 | Ga0495628_0000815 | 3300046516 | Bacteria | 28812 |
| 146 | Ga0495628_0033528 | 3300046516 | Bacteria | 4138 |
| 147 | Ga0495628_0184297 | 3300046516 | Bacteria | 1578 |
| 148 | Ga0495630_0000075 | 3300046517 | Bacteria | 77378 |
| 149 | Ga0495644_0000377 | 3300046523 | Bacteria | 20229 |
| 150 | Ga0495644_0134521 | 3300046523 | Bacteria | 943 |
| 151 | Ga0495652_0017958 | 3300046529 | Bacteria | 6311 |
| 152 | Ga0495652_0064126 | 3300046529 | Bacteria | 3091 |
| 153 | Ga0495586_0001484 | 3300046535 | Bacteria | 12933 |
| 154 | Ga0495598_0000632 | 3300046537 | Bacteria | 6660 |
| 155 | Ga0495634_0009798 | 3300046642 | Bacteria | 7051 |
| 156 | Ga0495635_0000076 | 3300046663 | Bacteria | 61665 |
| 157 | Ga0495635_0263984 | 3300046663 | Bacteria | 1159 |
| 158 | Ga0495588_0000387 | 3300046674 | Bacteria | 25193 |
| 159 | Ga0495657_0015870 | 3300046675 | Bacteria | 5500 |
| 160 | Ga0495599_0023030 | 3300046678 | Bacteria | 3891 |
| 161 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 162 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 163 | Ga0495624_0000027 | 3300046690 | Bacteria | 93611 |
| 164 | Ga0495649_0001845 | 3300046694 | Bacteria | 15537 |
| 165 | Ga0495600_0005375 | 3300046809 | Bacteria | 7725 |
| 166 | Ga0495604_0000704 | 3300047317 | Bacteria | 28417 |
| 167 | Ga0495604_0009362 | 3300047317 | Bacteria | 7750 |
| 168 | Ga0495604_0177302 | 3300047317 | Bacteria | 1493 |
| 169 | Ga0495676_0238437 | 3300047321 | Bacteria | 1246 |
| 170 | Ga0495679_020895 | 3300047446 | Bacteria | 2272 |
| 171 | Ga0495686_0043741 | 3300047472 | Bacteria | 2838 |
| 172 | Ga0495593_0047022 | 3300047673 | Bacteria | 2297 |
| 173 | Ga0495593_0075601 | 3300047673 | Bacteria | 1746 |
| 174 | Ga0495593_0198785 | 3300047673 | Bacteria | 1008 |
| 175 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 176 | Ga0495602_0048315 | 3300048088 | Bacteria | 3825 |
| 177 | Ga0495602_0282561 | 3300048088 | Bacteria | 1222 |
| 178 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 179 | Ga0496104_0087108 | 3300048907 | Bacteria | 2982 |
| 180 | Ga0496104_0128586 | 3300048907 | Bacteria | 2433 |
| 181 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 182 | Ga0496105_0062109 | 3300048908 | Bacteria | 3083 |
| 183 | Ga0496106_0509357 | 3300048909 | Bacteria | 967 |
| 184 | Ga0496107_0141535 | 3300048910 | Bacteria | 1778 |
| 185 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 186 | Ga0496108_0000550 | 3300048911 | Bacteria | 29326 |
| 187 | Ga0496108_0088536 | 3300048911 | Bacteria | 2631 |
| 188 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 189 | Ga0496109_0000174 | 3300048912 | Bacteria | 63794 |
| 190 | Ga0496109_0000261 | 3300048912 | Bacteria | 50812 |
| 191 | Ga0496109_0271075 | 3300048912 | Bacteria | 1599 |
| 192 | Ga0496110_0087624 | 3300048913 | Bacteria | 2780 |
| 193 | Ga0496112_0302922 | 3300048915 | Bacteria | 1544 |
| 194 | Ga0496113_0013048 | 3300048916 | Bacteria | 5610 |
| 195 | Ga0496114_0076661 | 3300048917 | Bacteria | 2817 |
| 196 | Ga0496114_0155415 | 3300048917 | Bacteria | 1986 |
| 197 | Ga0496114_0436983 | 3300048917 | Bacteria | 1159 |
| 198 | Ga0496114_0740863 | 3300048917 | Bacteria | 860 |
| 199 | Ga0496115_0000659 | 3300048918 | Bacteria | 25718 |
| 200 | Ga0496117_0119800 | 3300048920 | Bacteria | 1620 |
| 201 | Ga0496118_0179439 | 3300048921 | Bacteria | 1281 |
| 202 | Ga0496119_0016234 | 3300048922 | Bacteria | 5682 |
| 203 | Ga0496121_0023378 | 3300048924 | Bacteria | 5955 |
| 204 | Ga0496121_0313929 | 3300048924 | Bacteria | 1058 |
| 205 | Ga0496124_0031918 | 3300048927 | Bacteria | 4658 |
| 206 | Ga0496125_0027315 | 3300048928 | Bacteria | 5177 |
| 207 | Ga0496125_0042198 | 3300048928 | Bacteria | 3889 |
| 208 | Ga0496126_0378067 | 3300048929 | Bacteria | 1153 |
| 209 | Ga0496126_0551120 | 3300048929 | Bacteria | 915 |
| 210 | Ga0501031_0000322 | 3300049568 | Bacteria | 27494 |
| 211 | Ga0501031_0332422 | 3300049568 | Bacteria | 984 |
| 212 | Ga0501032_0000826 | 3300049569 | Bacteria | 25207 |
| 213 | Ga0501032_0123882 | 3300049569 | Bacteria | 1708 |
| 214 | Ga0501033_0001043 | 3300049570 | Bacteria | 25258 |
| 215 | Ga0501034_0011269 | 3300049571 | Bacteria | 9280 |
| 216 | Ga0501034_0355723 | 3300049571 | Bacteria | 1392 |
| 217 | Ga0501036_0001543 | 3300049572 | Bacteria | 17799 |
| 218 | Ga0501037_0000695 | 3300049573 | Bacteria | 25643 |
| 219 | Ga0501038_0000822 | 3300049574 | Bacteria | 27621 |
| 220 | Ga0501039_0021456 | 3300049575 | Bacteria | 4954 |
| 221 | Ga0501042_0055922 | 3300049578 | Bacteria | 2816 |
| 222 | Ga0501043_0015803 | 3300049579 | Bacteria | 5916 |
| 223 | Ga0501043_0351823 | 3300049579 | Bacteria | 1119 |
| 224 | Ga0501046_0001474 | 3300049580 | Bacteria | 22598 |
| 225 | Ga0501046_0686611 | 3300049580 | Bacteria | 722 |
| 226 | Ga0501047_0000430 | 3300049581 | Bacteria | 46649 |
| 227 | Ga0501047_0214463 | 3300049581 | Bacteria | 1782 |
| 228 | Ga0501048_0001198 | 3300049582 | Bacteria | 19630 |
| 229 | Ga0501048_0126316 | 3300049582 | Bacteria | 1808 |
| 230 | Ga0501068_0020730 | 3300049584 | Bacteria | 3834 |
| 231 | Ga0501069_0057820 | 3300049585 | Bacteria | 2162 |
| 232 | Ga0501070_0001324 | 3300049586 | Bacteria | 22140 |
| 233 | Ga0501070_0009114 | 3300049586 | Bacteria | 8392 |
| 234 | Ga0501070_0031155 | 3300049586 | Bacteria | 4467 |
| 235 | Ga0501070_0251898 | 3300049586 | Bacteria | 1444 |
| 236 | Ga0501071_0088484 | 3300049587 | Bacteria | 2272 |
| 237 | Ga0501073_0034491 | 3300049589 | Bacteria | 3601 |
| 238 | Ga0501074_0020905 | 3300049590 | Bacteria | 4753 |
| 239 | Ga0501075_0002912 | 3300049591 | Bacteria | 11484 |
| 240 | Ga0501079_0016631 | 3300049741 | Bacteria | 5618 |
| 241 | Ga0501079_0034113 | 3300049741 | Bacteria | 3915 |
| 242 | Ga0501080_0008088 | 3300049742 | Bacteria | 9529 |
| 243 | Ga0501080_0211285 | 3300049742 | Bacteria | 1778 |
| 244 | Ga0501083_0014653 | 3300049744 | Bacteria | 5481 |
| 245 | Ga0501083_0046963 | 3300049744 | Bacteria | 2919 |
| 246 | Ga0501035_0007209 | 3300049822 | Bacteria | 10405 |
| 247 | Ga0501035_0508534 | 3300049822 | Bacteria | 991 |
| 248 | Ga0501044_0001702 | 3300049823 | Bacteria | 25807 |
| 249 | Ga0501044_0057033 | 3300049823 | Bacteria | 4008 |
| 250 | Ga0501044_0389683 | 3300049823 | Bacteria | 1307 |
| 251 | Ga0501045_0158772 | 3300049824 | Bacteria | 1683 |
| 252 | Ga0501045_0313998 | 3300049824 | Bacteria | 1166 |
| 253 | nmdc:mga05p37_371720_c1 | 3300050507 | Bacteria | 1677 |
| 254 | nmdc:mga06r32_52940_c1 | 3300050510 | Bacteria | 3888 |
| 255 | nmdc:mga0rr50_90825_c1 | 3300050513 | Bacteria | 2377 |
| 256 | Ga0495601_0000043 | 3300053077 | Bacteria | 77025 |
| 257 | Ga0495601_0000723 | 3300053077 | Bacteria | 17749 |
| 258 | Ga0495601_0013476 | 3300053077 | Bacteria | 4917 |
| 259 | Ga0495601_0208995 | 3300053077 | Bacteria | 1275 |
| 260 | Ga0495612_0023716 | 3300053078 | Bacteria | 2462 |
| 261 | Ga0495595_0007636 | 3300053084 | Bacteria | 4430 |
| 262 | Ga0495595_0243178 | 3300053084 | Bacteria | 900 |
| 263 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 264 | Ga0500572_069441 | 3300053111 | Bacteria | 1086 |
| 265 | Ga0501084_0148845 | 3300054114 | Bacteria | 1973 |
| 266 | Ga0501084_0155411 | 3300054114 | Bacteria | 1929 |
| 267 | Ga0501084_0425345 | 3300054114 | Bacteria | 1123 |
| 268 | Ga0501082_0001614 | 3300060353 | Bacteria | 19859 |
| 269 | Ga0501082_0814897 | 3300060353 | Bacteria | 817 |
| 270 | Ga0530510_0174018 | 3300061734 | Bacteria | 1595 |
| 271 | Ga0530510_0262806 | 3300061734 | Bacteria | 1287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0425345 | Ga0501084_0425345_22_573 | 183 |
| 2 | 3300045049 | Ga0466959_0744789 | Ga0466959_0744789_11_601 | 190 |
| 3 | 3300038443 | Ga0395901_1092396 | Ga0395901_1092396_14_619 | 201 |
| 4 | 3300045976 | Ga0466967_0062796 | Ga0466967_0062796_1004_1627 | 204 |
| 5 | 3300049742 | Ga0501080_0211285 | Ga0501080_0211285_607_1221 | 204 |
| 6 | 3300048924 | Ga0496121_0313929 | Ga0496121_0313929_266_931 | 205 |
| 7 | 3300044694 | Ga0466963_0000017 | Ga0466963_0000017_55021_55686 | 207 |
| 8 | 3300005329 | Ga0070683_100038595 | Ga0070683_1000385953 | 209 |
| 9 | 3300005436 | Ga0070713_100091689 | Ga0070713_1000916891 | 209 |
| 10 | 3300005535 | Ga0070684_100105533 | Ga0070684_1001055332 | 209 |
| 11 | 3300009174 | Ga0105241_10304907 | Ga0105241_103049072 | 209 |
| 12 | 3300009553 | Ga0105249_10000143 | Ga0105249_1000014337 | 209 |
| 13 | 3300013104 | Ga0157370_10033402 | Ga0157370_100334023 | 209 |
| 14 | 3300013296 | Ga0157374_10010755 | Ga0157374_100107553 | 209 |
| 15 | 3300025905 | Ga0207685_10000028 | Ga0207685_1000002887 | 209 |
| 16 | 3300025909 | Ga0207705_10031957 | Ga0207705_100319573 | 209 |
| 17 | 3300025911 | Ga0207654_10066353 | Ga0207654_100663532 | 209 |
| 18 | 3300025944 | Ga0207661_10000921 | Ga0207661_1000092116 | 209 |
| 19 | 3300025961 | Ga0207712_10000058 | Ga0207712_1000005888 | 209 |
| 20 | 3300036401 | Ga0373937_0440861 | Ga0373937_0440861_357_986 | 209 |
| 21 | 3300044694 | Ga0466963_0014266 | Ga0466963_0014266_2430_3065 | 209 |
| 22 | 3300044842 | Ga0466957_0076053 | Ga0466957_0076053_1086_1715 | 209 |
| 23 | 3300045976 | Ga0466967_0030399 | Ga0466967_0030399_3005_3640 | 209 |
| 24 | 3300046454 | Ga0495592_0000261 | Ga0495592_0000261_34023_34652 | 209 |
| 25 | 3300046454 | Ga0495592_0126822 | Ga0495592_0126822_627_1262 | 209 |
| 26 | 3300046459 | Ga0495629_0083173 | Ga0495629_0083173_868_1503 | 209 |
| 27 | 3300046499 | Ga0495594_0000030 | Ga0495594_0000030_23555_24184 | 209 |
| 28 | 3300046516 | Ga0495628_0184297 | Ga0495628_0184297_385_1020 | 209 |
| 29 | 3300046529 | Ga0495652_0017958 | Ga0495652_0017958_2412_3047 | 209 |
| 30 | 3300046529 | Ga0495652_0064126 | Ga0495652_0064126_501_1133 | 209 |
| 31 | 3300046642 | Ga0495634_0009798 | Ga0495634_0009798_3390_4025 | 209 |
| 32 | 3300047673 | Ga0495593_0075601 | Ga0495593_0075601_634_1269 | 209 |
| 33 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_182847_183476 | 209 |
| 34 | 3300048088 | Ga0495602_0282561 | Ga0495602_0282561_351_986 | 209 |
| 35 | 3300048907 | Ga0496104_0000052 | Ga0496104_0000052_58747_59376 | 209 |
| 36 | 3300048908 | Ga0496105_0000030 | Ga0496105_0000030_77950_78579 | 209 |
| 37 | 3300048915 | Ga0496112_0302922 | Ga0496112_0302922_85_720 | 209 |
| 38 | 3300048917 | Ga0496114_0436983 | Ga0496114_0436983_511_1140 | 209 |
| 39 | 3300048918 | Ga0496115_0000659 | Ga0496115_0000659_13078_13707 | 209 |
| 40 | 3300049591 | Ga0501075_0002912 | Ga0501075_0002912_2568_3197 | 209 |
| 41 | 3300053077 | Ga0495601_0000043 | Ga0495601_0000043_65739_66368 | 209 |
| 42 | 3300053077 | Ga0495601_0013476 | Ga0495601_0013476_1950_2582 | 209 |
| 43 | 3300053077 | Ga0495601_0208995 | Ga0495601_0208995_37_672 | 209 |
| 44 | 3300025908 | Ga0207643_10142471 | Ga0207643_101424712 | 210 |
| 45 | 3300025945 | Ga0207679_10489688 | Ga0207679_104896882 | 212 |
| 46 | 3300030744 | Ga0316181_1229879 | Ga0316181_12298791 | 214 |
| 47 | 3300031456 | Ga0307513_10000001 | Ga0307513_100000011066 | 214 |
| 48 | 3300042007 | Ga0439449_0032860 | Ga0439449_0032860_894_1628 | 214 |
| 49 | 3300046458 | Ga0495591_062451 | Ga0495591_062451_23_688 | 215 |
| 50 | 3300005356 | Ga0070674_100521054 | Ga0070674_1005210542 | 216 |
| 51 | 3300005434 | Ga0070709_10499428 | Ga0070709_104994281 | 216 |
| 52 | 3300005438 | Ga0070701_10226220 | Ga0070701_102262201 | 216 |
| 53 | 3300005457 | Ga0070662_100185649 | Ga0070662_1001856492 | 216 |
| 54 | 3300026075 | Ga0207708_10205378 | Ga0207708_102053782 | 216 |
| 55 | 3300026089 | Ga0207648_10232404 | Ga0207648_102324042 | 216 |
| 56 | 3300026118 | Ga0207675_100230427 | Ga0207675_1002304272 | 216 |
| 57 | 3300028379 | Ga0268266_10227193 | Ga0268266_102271933 | 216 |
| 58 | 3300031731 | Ga0307405_10803469 | Ga0307405_108034692 | 216 |
| 59 | 3300031852 | Ga0307410_10503774 | Ga0307410_105037742 | 216 |
| 60 | 3300032126 | Ga0307415_100569830 | Ga0307415_1005698302 | 216 |
| 61 | 3300044684 | Ga0466966_0051998 | Ga0466966_0051998_628_1296 | 216 |
| 62 | 3300045049 | Ga0466959_0357776 | Ga0466959_0357776_313_978 | 216 |
| 63 | 3300045976 | Ga0466967_0031969 | Ga0466967_0031969_2528_3187 | 216 |
| 64 | 3300045976 | Ga0466967_0120433 | Ga0466967_0120433_722_1372 | 216 |
| 65 | 3300049568 | Ga0501031_0332422 | Ga0501031_0332422_108_767 | 216 |
| 66 | 3300049580 | Ga0501046_0686611 | Ga0501046_0686611_38_697 | 216 |
| 67 | 3300010375 | Ga0105239_10707258 | Ga0105239_107072581 | 220 |
| 68 | 3300025904 | Ga0207647_10229517 | Ga0207647_102295172 | 220 |
| 69 | 3300001977 | JGI24746J21847_1003657 | JGI24746J21847_10036573 | 221 |
| 70 | 3300005329 | Ga0070683_100094024 | Ga0070683_1000940242 | 221 |
| 71 | 3300005337 | Ga0070682_100000075 | Ga0070682_10000007540 | 221 |
| 72 | 3300005344 | Ga0070661_100000099 | Ga0070661_10000009946 | 221 |
| 73 | 3300005366 | Ga0070659_100065555 | Ga0070659_1000655553 | 221 |
| 74 | 3300005367 | Ga0070667_100045207 | Ga0070667_1000452072 | 221 |
| 75 | 3300005367 | Ga0070667_100675632 | Ga0070667_1006756322 | 221 |
| 76 | 3300005445 | Ga0070708_100891657 | Ga0070708_1008916571 | 221 |
| 77 | 3300005455 | Ga0070663_100005524 | Ga0070663_1000055242 | 221 |
| 78 | 3300005458 | Ga0070681_10084429 | Ga0070681_100844293 | 221 |
| 79 | 3300005466 | Ga0070685_10003546 | Ga0070685_100035466 | 221 |
| 80 | 3300005530 | Ga0070679_100000369 | Ga0070679_1000003693 | 221 |
| 81 | 3300005530 | Ga0070679_100137534 | Ga0070679_1001375342 | 221 |
| 82 | 3300005535 | Ga0070684_100073244 | Ga0070684_1000732442 | 221 |
| 83 | 3300005535 | Ga0070684_100146101 | Ga0070684_1001461012 | 221 |
| 84 | 3300005536 | Ga0070697_100615397 | Ga0070697_1006153971 | 221 |
| 85 | 3300005539 | Ga0068853_100021307 | Ga0068853_1000213073 | 221 |
| 86 | 3300005539 | Ga0068853_100185557 | Ga0068853_1001855572 | 221 |
| 87 | 3300005543 | Ga0070672_100000001 | Ga0070672_10000000162 | 221 |
| 88 | 3300005544 | Ga0070686_100338635 | Ga0070686_1003386352 | 221 |
| 89 | 3300005548 | Ga0070665_100018070 | Ga0070665_1000180702 | 221 |
| 90 | 3300005548 | Ga0070665_100136231 | Ga0070665_1001362313 | 221 |
| 91 | 3300005563 | Ga0068855_100136015 | Ga0068855_1001360152 | 221 |
| 92 | 3300005578 | Ga0068854_100000597 | Ga0068854_10000059716 | 221 |
| 93 | 3300005614 | Ga0068856_100150467 | Ga0068856_1001504672 | 221 |
| 94 | 3300005614 | Ga0068856_100964290 | Ga0068856_1009642902 | 221 |
| 95 | 3300005616 | Ga0068852_100000056 | Ga0068852_10000005681 | 221 |
| 96 | 3300005616 | Ga0068852_100001985 | Ga0068852_10000198514 | 221 |
| 97 | 3300005843 | Ga0068860_100095376 | Ga0068860_1000953762 | 221 |
| 98 | 3300005981 | Ga0081538_10000141 | Ga0081538_1000014147 | 221 |
| 99 | 3300005981 | Ga0081538_10072152 | Ga0081538_100721522 | 221 |
| 100 | 3300005981 | Ga0081538_10108682 | Ga0081538_101086822 | 221 |
| 101 | 3300006175 | Ga0070712_100027794 | Ga0070712_1000277942 | 221 |
| 102 | 3300006852 | Ga0075433_10271663 | Ga0075433_102716632 | 221 |
| 103 | 3300006871 | Ga0075434_100133061 | Ga0075434_1001330612 | 221 |
| 104 | 3300006881 | Ga0068865_100000490 | Ga0068865_10000049013 | 221 |
| 105 | 3300007076 | Ga0075435_100156821 | Ga0075435_1001568212 | 221 |
| 106 | 3300009098 | Ga0105245_10000130 | Ga0105245_1000013013 | 221 |
| 107 | 3300009101 | Ga0105247_10062266 | Ga0105247_100622662 | 221 |
| 108 | 3300009101 | Ga0105247_10203672 | Ga0105247_102036722 | 221 |
| 109 | 3300009147 | Ga0114129_10510594 | Ga0114129_105105942 | 221 |
| 110 | 3300009177 | Ga0105248_10290080 | Ga0105248_102900802 | 221 |
| 111 | 3300009545 | Ga0105237_10130301 | Ga0105237_101303013 | 221 |
| 112 | 3300009551 | Ga0105238_10093544 | Ga0105238_100935442 | 221 |
| 113 | 3300009553 | Ga0105249_11417760 | Ga0105249_114177601 | 221 |
| 114 | 3300013102 | Ga0157371_10012360 | Ga0157371_100123604 | 221 |
| 115 | 3300013297 | Ga0157378_10480435 | Ga0157378_104804352 | 221 |
| 116 | 3300013308 | Ga0157375_10553376 | Ga0157375_105533761 | 221 |
| 117 | 3300014325 | Ga0163163_10216764 | Ga0163163_102167641 | 221 |
| 118 | 3300014968 | Ga0157379_10235418 | Ga0157379_102354182 | 221 |
| 119 | 3300014969 | Ga0157376_10030681 | Ga0157376_100306813 | 221 |
| 120 | 3300025893 | Ga0207682_10000091 | Ga0207682_1000009131 | 221 |
| 121 | 3300025900 | Ga0207710_10022601 | Ga0207710_100226012 | 221 |
| 122 | 3300025903 | Ga0207680_10008001 | Ga0207680_100080013 | 221 |
| 123 | 3300025905 | Ga0207685_10054325 | Ga0207685_100543252 | 221 |
| 124 | 3300025912 | Ga0207707_10081665 | Ga0207707_100816652 | 221 |
| 125 | 3300025915 | Ga0207693_10010394 | Ga0207693_100103942 | 221 |
| 126 | 3300025921 | Ga0207652_10000321 | Ga0207652_100003213 | 221 |
| 127 | 3300025921 | Ga0207652_10000827 | Ga0207652_1000082727 | 221 |
| 128 | 3300025926 | Ga0207659_10000013 | Ga0207659_1000001355 | 221 |
| 129 | 3300025927 | Ga0207687_10000032 | Ga0207687_1000003252 | 221 |
| 130 | 3300025927 | Ga0207687_10001820 | Ga0207687_100018206 | 221 |
| 131 | 3300025927 | Ga0207687_10003571 | Ga0207687_100035712 | 221 |
| 132 | 3300025932 | Ga0207690_10034255 | Ga0207690_100342552 | 221 |
| 133 | 3300025940 | Ga0207691_10000747 | Ga0207691_1000074719 | 221 |
| 134 | 3300025944 | Ga0207661_10001320 | Ga0207661_100013202 | 221 |
| 135 | 3300025944 | Ga0207661_10004833 | Ga0207661_100048334 | 221 |
| 136 | 3300025949 | Ga0207667_10163879 | Ga0207667_101638792 | 221 |
| 137 | 3300025981 | Ga0207640_10015656 | Ga0207640_100156563 | 221 |
| 138 | 3300025986 | Ga0207658_10033211 | Ga0207658_100332112 | 221 |
| 139 | 3300026067 | Ga0207678_10016549 | Ga0207678_100165493 | 221 |
| 140 | 3300026078 | Ga0207702_10121120 | Ga0207702_101211202 | 221 |
| 141 | 3300026078 | Ga0207702_10836252 | Ga0207702_108362522 | 221 |
| 142 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016222 | 221 |
| 143 | 3300026089 | Ga0207648_10011475 | Ga0207648_100114755 | 221 |
| 144 | 3300026089 | Ga0207648_10119955 | Ga0207648_101199552 | 221 |
| 145 | 3300026116 | Ga0207674_10218655 | Ga0207674_102186552 | 221 |
| 146 | 3300026118 | Ga0207675_100688008 | Ga0207675_1006880082 | 221 |
| 147 | 3300026142 | Ga0207698_10011384 | Ga0207698_100113843 | 221 |
| 148 | 3300026142 | Ga0207698_10012334 | Ga0207698_100123343 | 221 |
| 149 | 3300026142 | Ga0207698_10507392 | Ga0207698_105073922 | 221 |
| 150 | 3300028379 | Ga0268266_10000674 | Ga0268266_1000067414 | 221 |
| 151 | 3300028379 | Ga0268266_10037338 | Ga0268266_100373383 | 221 |
| 152 | 3300037418 | Ga0395900_0137055 | Ga0395900_0137055_130_795 | 221 |
| 153 | 3300038443 | Ga0395901_0235935 | Ga0395901_0235935_765_1430 | 221 |
| 154 | 3300041512 | Ga0451853_0696215 | Ga0451853_0696215_1639_2304 | 221 |
| 155 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_83393_84058 | 221 |
| 156 | 3300046454 | Ga0495592_0048473 | Ga0495592_0048473_1865_2530 | 221 |
| 157 | 3300046455 | Ga0495603_0026227 | Ga0495603_0026227_2446_3111 | 221 |
| 158 | 3300046459 | Ga0495629_0002184 | Ga0495629_0002184_2664_3329 | 221 |
| 159 | 3300046459 | Ga0495629_0105872 | Ga0495629_0105872_1210_1875 | 221 |
| 160 | 3300046463 | Ga0495653_0116570 | Ga0495653_0116570_844_1509 | 221 |
| 161 | 3300046476 | Ga0495662_0003445 | Ga0495662_0003445_575_1240 | 221 |
| 162 | 3300046492 | Ga0495585_0112158 | Ga0495585_0112158_202_867 | 221 |
| 163 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_15421_16086 | 221 |
| 164 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_144804_145469 | 221 |
| 165 | 3300046515 | Ga0495620_0000139 | Ga0495620_0000139_30464_31129 | 221 |
| 166 | 3300046516 | Ga0495628_0000815 | Ga0495628_0000815_2907_3575 | 221 |
| 167 | 3300046516 | Ga0495628_0033528 | Ga0495628_0033528_851_1516 | 221 |
| 168 | 3300046517 | Ga0495630_0000075 | Ga0495630_0000075_1907_2572 | 221 |
| 169 | 3300046523 | Ga0495644_0000377 | Ga0495644_0000377_18436_19101 | 221 |
| 170 | 3300046523 | Ga0495644_0134521 | Ga0495644_0134521_173_859 | 221 |
| 171 | 3300046535 | Ga0495586_0001484 | Ga0495586_0001484_9434_10099 | 221 |
| 172 | 3300046537 | Ga0495598_0000632 | Ga0495598_0000632_3169_3834 | 221 |
| 173 | 3300046663 | Ga0495635_0000076 | Ga0495635_0000076_35497_36162 | 221 |
| 174 | 3300046663 | Ga0495635_0263984 | Ga0495635_0263984_254_919 | 221 |
| 175 | 3300046674 | Ga0495588_0000387 | Ga0495588_0000387_12139_12804 | 221 |
| 176 | 3300046675 | Ga0495657_0015870 | Ga0495657_0015870_2469_3134 | 221 |
| 177 | 3300046678 | Ga0495599_0023030 | Ga0495599_0023030_1975_2640 | 221 |
| 178 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_138991_139656 | 221 |
| 179 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_71756_72421 | 221 |
| 180 | 3300046690 | Ga0495624_0000027 | Ga0495624_0000027_1005_1670 | 221 |
| 181 | 3300046694 | Ga0495649_0001845 | Ga0495649_0001845_14333_14998 | 221 |
| 182 | 3300046809 | Ga0495600_0005375 | Ga0495600_0005375_5016_5681 | 221 |
| 183 | 3300047317 | Ga0495604_0000704 | Ga0495604_0000704_919_1590 | 221 |
| 184 | 3300047317 | Ga0495604_0009362 | Ga0495604_0009362_910_1575 | 221 |
| 185 | 3300047317 | Ga0495604_0177302 | Ga0495604_0177302_250_915 | 221 |
| 186 | 3300047321 | Ga0495676_0238437 | Ga0495676_0238437_204_869 | 221 |
| 187 | 3300047446 | Ga0495679_020895 | Ga0495679_020895_368_1033 | 221 |
| 188 | 3300047472 | Ga0495686_0043741 | Ga0495686_0043741_597_1262 | 221 |
| 189 | 3300047673 | Ga0495593_0047022 | Ga0495593_0047022_888_1553 | 221 |
| 190 | 3300047673 | Ga0495593_0198785 | Ga0495593_0198785_225_896 | 221 |
| 191 | 3300048088 | Ga0495602_0048315 | Ga0495602_0048315_2685_3353 | 221 |
| 192 | 3300048907 | Ga0496104_0087108 | Ga0496104_0087108_444_1109 | 221 |
| 193 | 3300048907 | Ga0496104_0128586 | Ga0496104_0128586_668_1333 | 221 |
| 194 | 3300048908 | Ga0496105_0062109 | Ga0496105_0062109_1962_2627 | 221 |
| 195 | 3300048909 | Ga0496106_0509357 | Ga0496106_0509357_55_720 | 221 |
| 196 | 3300048910 | Ga0496107_0141535 | Ga0496107_0141535_526_1191 | 221 |
| 197 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_311712_312377 | 221 |
| 198 | 3300048911 | Ga0496108_0000550 | Ga0496108_0000550_24581_25246 | 221 |
| 199 | 3300048911 | Ga0496108_0088536 | Ga0496108_0088536_1707_2372 | 221 |
| 200 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_78800_79465 | 221 |
| 201 | 3300048912 | Ga0496109_0000174 | Ga0496109_0000174_37372_38037 | 221 |
| 202 | 3300048912 | Ga0496109_0000261 | Ga0496109_0000261_41881_42546 | 221 |
| 203 | 3300048912 | Ga0496109_0271075 | Ga0496109_0271075_22_687 | 221 |
| 204 | 3300048913 | Ga0496110_0087624 | Ga0496110_0087624_867_1532 | 221 |
| 205 | 3300048916 | Ga0496113_0013048 | Ga0496113_0013048_794_1459 | 221 |
| 206 | 3300048917 | Ga0496114_0076661 | Ga0496114_0076661_1023_1688 | 221 |
| 207 | 3300048917 | Ga0496114_0155415 | Ga0496114_0155415_183_848 | 221 |
| 208 | 3300048917 | Ga0496114_0740863 | Ga0496114_0740863_19_684 | 221 |
| 209 | 3300048920 | Ga0496117_0119800 | Ga0496117_0119800_773_1438 | 221 |
| 210 | 3300048921 | Ga0496118_0179439 | Ga0496118_0179439_168_833 | 221 |
| 211 | 3300048922 | Ga0496119_0016234 | Ga0496119_0016234_2311_2976 | 221 |
| 212 | 3300048924 | Ga0496121_0023378 | Ga0496121_0023378_3615_4280 | 221 |
| 213 | 3300048927 | Ga0496124_0031918 | Ga0496124_0031918_1015_1680 | 221 |
| 214 | 3300048928 | Ga0496125_0027315 | Ga0496125_0027315_2476_3141 | 221 |
| 215 | 3300048928 | Ga0496125_0042198 | Ga0496125_0042198_1192_1857 | 221 |
| 216 | 3300048929 | Ga0496126_0378067 | Ga0496126_0378067_39_704 | 221 |
| 217 | 3300048929 | Ga0496126_0551120 | Ga0496126_0551120_237_902 | 221 |
| 218 | 3300049568 | Ga0501031_0000322 | Ga0501031_0000322_22944_23609 | 221 |
| 219 | 3300049569 | Ga0501032_0000826 | Ga0501032_0000826_18141_18806 | 221 |
| 220 | 3300049569 | Ga0501032_0123882 | Ga0501032_0123882_523_1188 | 221 |
| 221 | 3300049570 | Ga0501033_0001043 | Ga0501033_0001043_6382_7047 | 221 |
| 222 | 3300049571 | Ga0501034_0011269 | Ga0501034_0011269_5182_5847 | 221 |
| 223 | 3300049571 | Ga0501034_0355723 | Ga0501034_0355723_574_1239 | 221 |
| 224 | 3300049572 | Ga0501036_0001543 | Ga0501036_0001543_10526_11191 | 221 |
| 225 | 3300049573 | Ga0501037_0000695 | Ga0501037_0000695_6375_7040 | 221 |
| 226 | 3300049574 | Ga0501038_0000822 | Ga0501038_0000822_22940_23605 | 221 |
| 227 | 3300049575 | Ga0501039_0021456 | Ga0501039_0021456_723_1388 | 221 |
| 228 | 3300049578 | Ga0501042_0055922 | Ga0501042_0055922_1099_1764 | 221 |
| 229 | 3300049579 | Ga0501043_0015803 | Ga0501043_0015803_1417_2082 | 221 |
| 230 | 3300049579 | Ga0501043_0351823 | Ga0501043_0351823_85_750 | 221 |
| 231 | 3300049580 | Ga0501046_0001474 | Ga0501046_0001474_3793_4458 | 221 |
| 232 | 3300049581 | Ga0501047_0000430 | Ga0501047_0000430_39350_40015 | 221 |
| 233 | 3300049581 | Ga0501047_0214463 | Ga0501047_0214463_301_966 | 221 |
| 234 | 3300049582 | Ga0501048_0001198 | Ga0501048_0001198_4026_4691 | 221 |
| 235 | 3300049582 | Ga0501048_0126316 | Ga0501048_0126316_697_1362 | 221 |
| 236 | 3300049584 | Ga0501068_0020730 | Ga0501068_0020730_2125_2790 | 221 |
| 237 | 3300049585 | Ga0501069_0057820 | Ga0501069_0057820_1434_2099 | 221 |
| 238 | 3300049586 | Ga0501070_0001324 | Ga0501070_0001324_17630_18295 | 221 |
| 239 | 3300049586 | Ga0501070_0009114 | Ga0501070_0009114_1547_2212 | 221 |
| 240 | 3300049586 | Ga0501070_0031155 | Ga0501070_0031155_3129_3794 | 221 |
| 241 | 3300049586 | Ga0501070_0251898 | Ga0501070_0251898_240_905 | 221 |
| 242 | 3300049587 | Ga0501071_0088484 | Ga0501071_0088484_990_1655 | 221 |
| 243 | 3300049589 | Ga0501073_0034491 | Ga0501073_0034491_2048_2713 | 221 |
| 244 | 3300049590 | Ga0501074_0020905 | Ga0501074_0020905_3456_4121 | 221 |
| 245 | 3300049741 | Ga0501079_0016631 | Ga0501079_0016631_4049_4714 | 221 |
| 246 | 3300049741 | Ga0501079_0034113 | Ga0501079_0034113_613_1278 | 221 |
| 247 | 3300049742 | Ga0501080_0008088 | Ga0501080_0008088_1523_2188 | 221 |
| 248 | 3300049744 | Ga0501083_0014653 | Ga0501083_0014653_2714_3379 | 221 |
| 249 | 3300049744 | Ga0501083_0046963 | Ga0501083_0046963_1008_1673 | 221 |
| 250 | 3300049822 | Ga0501035_0007209 | Ga0501035_0007209_4559_5224 | 221 |
| 251 | 3300049822 | Ga0501035_0508534 | Ga0501035_0508534_114_779 | 221 |
| 252 | 3300049823 | Ga0501044_0001702 | Ga0501044_0001702_6860_7525 | 221 |
| 253 | 3300049823 | Ga0501044_0057033 | Ga0501044_0057033_308_973 | 221 |
| 254 | 3300049823 | Ga0501044_0389683 | Ga0501044_0389683_308_973 | 221 |
| 255 | 3300049824 | Ga0501045_0158772 | Ga0501045_0158772_109_774 | 221 |
| 256 | 3300049824 | Ga0501045_0313998 | Ga0501045_0313998_393_1058 | 221 |
| 257 | 3300050507 | nmdc:mga05p37_371720_c1 | nmdc:mga05p37_371720_c1_621_1337 | 221 |
| 258 | 3300050510 | nmdc:mga06r32_52940_c1 | nmdc:mga06r32_52940_c1_1040_1720 | 221 |
| 259 | 3300050513 | nmdc:mga0rr50_90825_c1 | nmdc:mga0rr50_90825_c1_65_781 | 221 |
| 260 | 3300053077 | Ga0495601_0000723 | Ga0495601_0000723_14988_15653 | 221 |
| 261 | 3300053078 | Ga0495612_0023716 | Ga0495612_0023716_1335_2000 | 221 |
| 262 | 3300053084 | Ga0495595_0007636 | Ga0495595_0007636_1121_1786 | 221 |
| 263 | 3300053084 | Ga0495595_0243178 | Ga0495595_0243178_36_722 | 221 |
| 264 | 3300053085 | Ga0495619_0000047 | Ga0495619_0000047_82877_83542 | 221 |
| 265 | 3300053111 | Ga0500572_069441 | Ga0500572_069441_79_747 | 221 |
| 266 | 3300054114 | Ga0501084_0148845 | Ga0501084_0148845_233_916 | 221 |
| 267 | 3300054114 | Ga0501084_0155411 | Ga0501084_0155411_1033_1698 | 221 |
| 268 | 3300060353 | Ga0501082_0001614 | Ga0501082_0001614_15417_16082 | 221 |
| 269 | 3300060353 | Ga0501082_0814897 | Ga0501082_0814897_22_705 | 221 |
| 270 | 3300061734 | Ga0530510_0174018 | Ga0530510_0174018_582_1265 | 221 |
| 271 | 3300061734 | Ga0530510_0262806 | Ga0530510_0262806_148_831 | 221 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c3v-assembly1.cif.gz_A | dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc | 0.8892 | 2 | 221 |
| 1c3v-assembly1.cif.gz_A | dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc | 0.8816 | 2 | 221 |
| 5wol-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii | 0.8632 | 1 | 221 |
| 5wol-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii | 0.8595 | 1 | 221 |
| 5us6-assembly2.cif.gz_H | structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag | 0.8508 | 1 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP23_2_120_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9158 | 3 | 118 | 3.50.50.60 |
| 1c3vA02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8929 | 104 | 189 | 3.30.360.10 |
| 1yl7C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8901 | 3 | 220 | 3.40.50.720 |
| 1vm6D02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8883 | 105 | 190 | 3.30.360.10 |
| af_P9WP23_2_88_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8881 | 3 | 89 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LK28-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase | 1.001 | 1 | 72 |
GO:0008839
GO:0009089 |
| AF-A0A7W0LK28-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase | 0.9875 | 1 | 72 |
GO:0008839
GO:0009089 |
| AF-A0A538CS06-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase | 0.9698 | 1 | 83 |
GO:0005829
GO:0008839 GO:0009089 GO:0019877 |
| AF-A0A838UZA4-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) | 0.9526 | 1 | 221 |
GO:0005829
GO:0008839 GO:0009089 GO:0016726 GO:0019877 GO:0050661 GO:0051287 |
| AF-A0A7W1NHY9-F1-model_v4 | deleted | 0.951 | 1 | 220 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar