F377683

General Info

Members Datasets Scaffolds Average Seq Length
271 183 271 220

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10229517|Ga0207647_102295172
Length 244
Sequence VIRVAVSGAAGRMGQAVCEAVEAAGDTELSGRADPALGTGLADVLGGADVVVDFTTPDTALDNAEACLAAGVHVVVGTTGFDLERLEAAAEASQANCFVAPNFAIGAVLLMRFAQEAARYFPSVEVVELHHPHKVDAPSGTAVRTARLIAAARRAAGLPSVPDATTDALPGARGADVEGISVHAVRLTGLVAHQEVLMGAAGETLTLRHDSYDRTSFMPGVLLAVREIAGHPGLTVGIESFLGL

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 8.12
Rhizosphere 87.08
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003657 3300001977 Bacteria 2423
2 Ga0070683_100038595 3300005329 Bacteria 4379
3 Ga0070683_100094024 3300005329 Bacteria 2817
4 Ga0070682_100000075 3300005337 Bacteria 90547
5 Ga0070661_100000099 3300005344 Bacteria 71115
6 Ga0070674_100521054 3300005356 Bacteria 993
7 Ga0070659_100065555 3300005366 Bacteria 2876
8 Ga0070667_100045207 3300005367 Bacteria 3701
9 Ga0070667_100675632 3300005367 Bacteria 954
10 Ga0070709_10499428 3300005434 Bacteria 924
11 Ga0070713_100091689 3300005436 Bacteria 2615
12 Ga0070701_10226220 3300005438 Bacteria 1118
13 Ga0070708_100891657 3300005445 Bacteria 835
14 Ga0070663_100005524 3300005455 Bacteria 7520
15 Ga0070662_100185649 3300005457 Bacteria 1642
16 Ga0070681_10084429 3300005458 Bacteria 3128
17 Ga0070685_10003546 3300005466 Bacteria 7927
18 Ga0070679_100000369 3300005530 Bacteria 38264
19 Ga0070679_100137534 3300005530 Bacteria 2424
20 Ga0070684_100073244 3300005535 Bacteria 3018
21 Ga0070684_100105533 3300005535 Bacteria 2521
22 Ga0070684_100146101 3300005535 Bacteria 2140
23 Ga0070697_100615397 3300005536 Bacteria 955
24 Ga0068853_100021307 3300005539 Bacteria 5402
25 Ga0068853_100185557 3300005539 Bacteria 1888
26 Ga0070672_100000001 3300005543 Bacteria 204624
27 Ga0070686_100338635 3300005544 Bacteria 1127
28 Ga0070665_100018070 3300005548 Bacteria 7077
29 Ga0070665_100136231 3300005548 Bacteria 2458
30 Ga0068855_100136015 3300005563 Bacteria 2804
31 Ga0068854_100000597 3300005578 Bacteria 21452
32 Ga0068856_100150467 3300005614 Bacteria 2336
33 Ga0068856_100964290 3300005614 Bacteria 871
34 Ga0068852_100000056 3300005616 Bacteria 76111
35 Ga0068852_100001985 3300005616 Bacteria 13958
36 Ga0068860_100095376 3300005843 Bacteria 2836
37 Ga0081538_10000141 3300005981 Bacteria 74085
38 Ga0081538_10072152 3300005981 Bacteria 1895
39 Ga0081538_10108682 3300005981 Bacteria 1369
40 Ga0070712_100027794 3300006175 Bacteria 3781
41 Ga0075433_10271663 3300006852 Bacteria 1502
42 Ga0075434_100133061 3300006871 Bacteria 2506
43 Ga0068865_100000490 3300006881 Bacteria 22178
44 Ga0075435_100156821 3300007076 Bacteria 1916
45 Ga0105245_10000130 3300009098 Bacteria 72166
46 Ga0105247_10062266 3300009101 Bacteria 2314
47 Ga0105247_10203672 3300009101 Bacteria 1331
48 Ga0114129_10510594 3300009147 Bacteria 1568
49 Ga0105241_10304907 3300009174 Bacteria 1368
50 Ga0105248_10290080 3300009177 Bacteria 1842
51 Ga0105237_10130301 3300009545 Bacteria 2510
52 Ga0105238_10093544 3300009551 Bacteria 2994
53 Ga0105249_10000143 3300009553 Bacteria 92539
54 Ga0105249_11417760 3300009553 Bacteria 767
55 Ga0105239_10707258 3300010375 Bacteria 1152
56 Ga0157371_10012360 3300013102 Bacteria 6530
57 Ga0157370_10033402 3300013104 Bacteria 5017
58 Ga0157374_10010755 3300013296 Bacteria 7888
59 Ga0157378_10480435 3300013297 Bacteria 1238
60 Ga0157375_10553376 3300013308 Bacteria 1312
61 Ga0163163_10216764 3300014325 Bacteria 1963
62 Ga0157379_10235418 3300014968 Bacteria 1660
63 Ga0157376_10030681 3300014969 Bacteria 4296
64 Ga0207682_10000091 3300025893 Bacteria 41479
65 Ga0207710_10022601 3300025900 Bacteria 2700
66 Ga0207680_10008001 3300025903 Bacteria 5176
67 Ga0207647_10229517 3300025904 Bacteria 1068
68 Ga0207685_10000028 3300025905 Bacteria 97935
69 Ga0207685_10054325 3300025905 Bacteria 1559
70 Ga0207643_10142471 3300025908 Bacteria 1432
71 Ga0207705_10031957 3300025909 Bacteria 3760
72 Ga0207654_10066353 3300025911 Bacteria 2128
73 Ga0207707_10081665 3300025912 Bacteria 2822
74 Ga0207693_10010394 3300025915 Bacteria 7557
75 Ga0207652_10000321 3300025921 Bacteria 49720
76 Ga0207652_10000827 3300025921 Bacteria 29489
77 Ga0207659_10000013 3300025926 Bacteria 172742
78 Ga0207687_10000032 3300025927 Bacteria 143196
79 Ga0207687_10001820 3300025927 Bacteria 14678
80 Ga0207687_10003571 3300025927 Bacteria 10467
81 Ga0207690_10034255 3300025932 Bacteria 3271
82 Ga0207691_10000747 3300025940 Bacteria 32117
83 Ga0207661_10000921 3300025944 Bacteria 19315
84 Ga0207661_10001320 3300025944 Bacteria 16601
85 Ga0207661_10004833 3300025944 Bacteria 9441
86 Ga0207679_10489688 3300025945 Bacteria 1096
87 Ga0207667_10163879 3300025949 Bacteria 2286
88 Ga0207712_10000058 3300025961 Bacteria 140948
89 Ga0207640_10015656 3300025981 Bacteria 4395
90 Ga0207658_10033211 3300025986 Bacteria 3679
91 Ga0207678_10016549 3300026067 Bacteria 6475
92 Ga0207708_10205378 3300026075 Bacteria 1573
93 Ga0207702_10121120 3300026078 Bacteria 2342
94 Ga0207702_10836252 3300026078 Bacteria 911
95 Ga0207641_10000016 3300026088 Bacteria 307363
96 Ga0207648_10011475 3300026089 Bacteria 8341
97 Ga0207648_10119955 3300026089 Bacteria 2312
98 Ga0207648_10232404 3300026089 Bacteria 1640
99 Ga0207674_10218655 3300026116 Bacteria 1853
100 Ga0207675_100230427 3300026118 Bacteria 1787
101 Ga0207675_100688008 3300026118 Bacteria 1031
102 Ga0207698_10011384 3300026142 Bacteria 5767
103 Ga0207698_10012334 3300026142 Bacteria 5589
104 Ga0207698_10507392 3300026142 Bacteria 1175
105 Ga0268266_10000674 3300028379 Bacteria 46135
106 Ga0268266_10037338 3300028379 Bacteria 4139
107 Ga0268266_10227193 3300028379 Bacteria 1718
108 Ga0316181_1229879 3300030744 Bacteria 821
109 Ga0307513_10000001 3300031456 Bacteria 1660464
110 Ga0307405_10803469 3300031731 Bacteria 788
111 Ga0307410_10503774 3300031852 Bacteria 997
112 Ga0307415_100569830 3300032126 Bacteria 1002
113 Ga0373937_0440861 3300036401 Bacteria 1236
114 Ga0395900_0137055 3300037418 Bacteria 2508
115 Ga0395901_0235935 3300038443 Bacteria 1909
116 Ga0395901_1092396 3300038443 Bacteria 769
117 Ga0451853_0696215 3300041512 Bacteria 2774
118 Ga0439449_0032860 3300042007 Bacteria 1933
119 Ga0466966_0051998 3300044684 Bacteria 2604
120 Ga0466963_0000017 3300044694 Bacteria 58283
121 Ga0466963_0014266 3300044694 Bacteria 4896
122 Ga0466957_0076053 3300044842 Bacteria 2084
123 Ga0466959_0357776 3300045049 Bacteria 995
124 Ga0466959_0744789 3300045049 Bacteria 656
125 Ga0466967_0000001 3300045976 Bacteria 229823
126 Ga0466967_0030399 3300045976 Bacteria 4533
127 Ga0466967_0031969 3300045976 Bacteria 4438
128 Ga0466967_0062796 3300045976 Bacteria 3299
129 Ga0466967_0120433 3300045976 Bacteria 2424
130 Ga0495592_0000261 3300046454 Bacteria 44965
131 Ga0495592_0048473 3300046454 Bacteria 3160
132 Ga0495592_0126822 3300046454 Bacteria 1789
133 Ga0495603_0026227 3300046455 Bacteria 3521
134 Ga0495591_062451 3300046458 Bacteria 986
135 Ga0495629_0002184 3300046459 Bacteria 15103
136 Ga0495629_0083173 3300046459 Bacteria 2234
137 Ga0495629_0105872 3300046459 Bacteria 1962
138 Ga0495653_0116570 3300046463 Bacteria 1910
139 Ga0495662_0003445 3300046476 Bacteria 8015
140 Ga0495585_0112158 3300046492 Bacteria 1449
141 Ga0495594_0000030 3300046499 Bacteria 66443
142 Ga0495606_0000040 3300046507 Bacteria 223500
143 Ga0495618_0000014 3300046514 Bacteria 163136
144 Ga0495620_0000139 3300046515 Bacteria 59244
145 Ga0495628_0000815 3300046516 Bacteria 28812
146 Ga0495628_0033528 3300046516 Bacteria 4138
147 Ga0495628_0184297 3300046516 Bacteria 1578
148 Ga0495630_0000075 3300046517 Bacteria 77378
149 Ga0495644_0000377 3300046523 Bacteria 20229
150 Ga0495644_0134521 3300046523 Bacteria 943
151 Ga0495652_0017958 3300046529 Bacteria 6311
152 Ga0495652_0064126 3300046529 Bacteria 3091
153 Ga0495586_0001484 3300046535 Bacteria 12933
154 Ga0495598_0000632 3300046537 Bacteria 6660
155 Ga0495634_0009798 3300046642 Bacteria 7051
156 Ga0495635_0000076 3300046663 Bacteria 61665
157 Ga0495635_0263984 3300046663 Bacteria 1159
158 Ga0495588_0000387 3300046674 Bacteria 25193
159 Ga0495657_0015870 3300046675 Bacteria 5500
160 Ga0495599_0023030 3300046678 Bacteria 3891
161 Ga0495647_0000001 3300046681 Bacteria 222371
162 Ga0495613_0000005 3300046689 Bacteria 222558
163 Ga0495624_0000027 3300046690 Bacteria 93611
164 Ga0495649_0001845 3300046694 Bacteria 15537
165 Ga0495600_0005375 3300046809 Bacteria 7725
166 Ga0495604_0000704 3300047317 Bacteria 28417
167 Ga0495604_0009362 3300047317 Bacteria 7750
168 Ga0495604_0177302 3300047317 Bacteria 1493
169 Ga0495676_0238437 3300047321 Bacteria 1246
170 Ga0495679_020895 3300047446 Bacteria 2272
171 Ga0495686_0043741 3300047472 Bacteria 2838
172 Ga0495593_0047022 3300047673 Bacteria 2297
173 Ga0495593_0075601 3300047673 Bacteria 1746
174 Ga0495593_0198785 3300047673 Bacteria 1008
175 Ga0495602_0000007 3300048088 Bacteria 273212
176 Ga0495602_0048315 3300048088 Bacteria 3825
177 Ga0495602_0282561 3300048088 Bacteria 1222
178 Ga0496104_0000052 3300048907 Bacteria 137286
179 Ga0496104_0087108 3300048907 Bacteria 2982
180 Ga0496104_0128586 3300048907 Bacteria 2433
181 Ga0496105_0000030 3300048908 Bacteria 137325
182 Ga0496105_0062109 3300048908 Bacteria 3083
183 Ga0496106_0509357 3300048909 Bacteria 967
184 Ga0496107_0141535 3300048910 Bacteria 1778
185 Ga0496108_0000006 3300048911 Bacteria 469473
186 Ga0496108_0000550 3300048911 Bacteria 29326
187 Ga0496108_0088536 3300048911 Bacteria 2631
188 Ga0496109_0000009 3300048912 Bacteria 236561
189 Ga0496109_0000174 3300048912 Bacteria 63794
190 Ga0496109_0000261 3300048912 Bacteria 50812
191 Ga0496109_0271075 3300048912 Bacteria 1599
192 Ga0496110_0087624 3300048913 Bacteria 2780
193 Ga0496112_0302922 3300048915 Bacteria 1544
194 Ga0496113_0013048 3300048916 Bacteria 5610
195 Ga0496114_0076661 3300048917 Bacteria 2817
196 Ga0496114_0155415 3300048917 Bacteria 1986
197 Ga0496114_0436983 3300048917 Bacteria 1159
198 Ga0496114_0740863 3300048917 Bacteria 860
199 Ga0496115_0000659 3300048918 Bacteria 25718
200 Ga0496117_0119800 3300048920 Bacteria 1620
201 Ga0496118_0179439 3300048921 Bacteria 1281
202 Ga0496119_0016234 3300048922 Bacteria 5682
203 Ga0496121_0023378 3300048924 Bacteria 5955
204 Ga0496121_0313929 3300048924 Bacteria 1058
205 Ga0496124_0031918 3300048927 Bacteria 4658
206 Ga0496125_0027315 3300048928 Bacteria 5177
207 Ga0496125_0042198 3300048928 Bacteria 3889
208 Ga0496126_0378067 3300048929 Bacteria 1153
209 Ga0496126_0551120 3300048929 Bacteria 915
210 Ga0501031_0000322 3300049568 Bacteria 27494
211 Ga0501031_0332422 3300049568 Bacteria 984
212 Ga0501032_0000826 3300049569 Bacteria 25207
213 Ga0501032_0123882 3300049569 Bacteria 1708
214 Ga0501033_0001043 3300049570 Bacteria 25258
215 Ga0501034_0011269 3300049571 Bacteria 9280
216 Ga0501034_0355723 3300049571 Bacteria 1392
217 Ga0501036_0001543 3300049572 Bacteria 17799
218 Ga0501037_0000695 3300049573 Bacteria 25643
219 Ga0501038_0000822 3300049574 Bacteria 27621
220 Ga0501039_0021456 3300049575 Bacteria 4954
221 Ga0501042_0055922 3300049578 Bacteria 2816
222 Ga0501043_0015803 3300049579 Bacteria 5916
223 Ga0501043_0351823 3300049579 Bacteria 1119
224 Ga0501046_0001474 3300049580 Bacteria 22598
225 Ga0501046_0686611 3300049580 Bacteria 722
226 Ga0501047_0000430 3300049581 Bacteria 46649
227 Ga0501047_0214463 3300049581 Bacteria 1782
228 Ga0501048_0001198 3300049582 Bacteria 19630
229 Ga0501048_0126316 3300049582 Bacteria 1808
230 Ga0501068_0020730 3300049584 Bacteria 3834
231 Ga0501069_0057820 3300049585 Bacteria 2162
232 Ga0501070_0001324 3300049586 Bacteria 22140
233 Ga0501070_0009114 3300049586 Bacteria 8392
234 Ga0501070_0031155 3300049586 Bacteria 4467
235 Ga0501070_0251898 3300049586 Bacteria 1444
236 Ga0501071_0088484 3300049587 Bacteria 2272
237 Ga0501073_0034491 3300049589 Bacteria 3601
238 Ga0501074_0020905 3300049590 Bacteria 4753
239 Ga0501075_0002912 3300049591 Bacteria 11484
240 Ga0501079_0016631 3300049741 Bacteria 5618
241 Ga0501079_0034113 3300049741 Bacteria 3915
242 Ga0501080_0008088 3300049742 Bacteria 9529
243 Ga0501080_0211285 3300049742 Bacteria 1778
244 Ga0501083_0014653 3300049744 Bacteria 5481
245 Ga0501083_0046963 3300049744 Bacteria 2919
246 Ga0501035_0007209 3300049822 Bacteria 10405
247 Ga0501035_0508534 3300049822 Bacteria 991
248 Ga0501044_0001702 3300049823 Bacteria 25807
249 Ga0501044_0057033 3300049823 Bacteria 4008
250 Ga0501044_0389683 3300049823 Bacteria 1307
251 Ga0501045_0158772 3300049824 Bacteria 1683
252 Ga0501045_0313998 3300049824 Bacteria 1166
253 nmdc:mga05p37_371720_c1 3300050507 Bacteria 1677
254 nmdc:mga06r32_52940_c1 3300050510 Bacteria 3888
255 nmdc:mga0rr50_90825_c1 3300050513 Bacteria 2377
256 Ga0495601_0000043 3300053077 Bacteria 77025
257 Ga0495601_0000723 3300053077 Bacteria 17749
258 Ga0495601_0013476 3300053077 Bacteria 4917
259 Ga0495601_0208995 3300053077 Bacteria 1275
260 Ga0495612_0023716 3300053078 Bacteria 2462
261 Ga0495595_0007636 3300053084 Bacteria 4430
262 Ga0495595_0243178 3300053084 Bacteria 900
263 Ga0495619_0000047 3300053085 Bacteria 102152
264 Ga0500572_069441 3300053111 Bacteria 1086
265 Ga0501084_0148845 3300054114 Bacteria 1973
266 Ga0501084_0155411 3300054114 Bacteria 1929
267 Ga0501084_0425345 3300054114 Bacteria 1123
268 Ga0501082_0001614 3300060353 Bacteria 19859
269 Ga0501082_0814897 3300060353 Bacteria 817
270 Ga0530510_0174018 3300061734 Bacteria 1595
271 Ga0530510_0262806 3300061734 Bacteria 1287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0425345 Ga0501084_0425345_22_573 183
2 3300045049 Ga0466959_0744789 Ga0466959_0744789_11_601 190
3 3300038443 Ga0395901_1092396 Ga0395901_1092396_14_619 201
4 3300045976 Ga0466967_0062796 Ga0466967_0062796_1004_1627 204
5 3300049742 Ga0501080_0211285 Ga0501080_0211285_607_1221 204
6 3300048924 Ga0496121_0313929 Ga0496121_0313929_266_931 205
7 3300044694 Ga0466963_0000017 Ga0466963_0000017_55021_55686 207
8 3300005329 Ga0070683_100038595 Ga0070683_1000385953 209
9 3300005436 Ga0070713_100091689 Ga0070713_1000916891 209
10 3300005535 Ga0070684_100105533 Ga0070684_1001055332 209
11 3300009174 Ga0105241_10304907 Ga0105241_103049072 209
12 3300009553 Ga0105249_10000143 Ga0105249_1000014337 209
13 3300013104 Ga0157370_10033402 Ga0157370_100334023 209
14 3300013296 Ga0157374_10010755 Ga0157374_100107553 209
15 3300025905 Ga0207685_10000028 Ga0207685_1000002887 209
16 3300025909 Ga0207705_10031957 Ga0207705_100319573 209
17 3300025911 Ga0207654_10066353 Ga0207654_100663532 209
18 3300025944 Ga0207661_10000921 Ga0207661_1000092116 209
19 3300025961 Ga0207712_10000058 Ga0207712_1000005888 209
20 3300036401 Ga0373937_0440861 Ga0373937_0440861_357_986 209
21 3300044694 Ga0466963_0014266 Ga0466963_0014266_2430_3065 209
22 3300044842 Ga0466957_0076053 Ga0466957_0076053_1086_1715 209
23 3300045976 Ga0466967_0030399 Ga0466967_0030399_3005_3640 209
24 3300046454 Ga0495592_0000261 Ga0495592_0000261_34023_34652 209
25 3300046454 Ga0495592_0126822 Ga0495592_0126822_627_1262 209
26 3300046459 Ga0495629_0083173 Ga0495629_0083173_868_1503 209
27 3300046499 Ga0495594_0000030 Ga0495594_0000030_23555_24184 209
28 3300046516 Ga0495628_0184297 Ga0495628_0184297_385_1020 209
29 3300046529 Ga0495652_0017958 Ga0495652_0017958_2412_3047 209
30 3300046529 Ga0495652_0064126 Ga0495652_0064126_501_1133 209
31 3300046642 Ga0495634_0009798 Ga0495634_0009798_3390_4025 209
32 3300047673 Ga0495593_0075601 Ga0495593_0075601_634_1269 209
33 3300048088 Ga0495602_0000007 Ga0495602_0000007_182847_183476 209
34 3300048088 Ga0495602_0282561 Ga0495602_0282561_351_986 209
35 3300048907 Ga0496104_0000052 Ga0496104_0000052_58747_59376 209
36 3300048908 Ga0496105_0000030 Ga0496105_0000030_77950_78579 209
37 3300048915 Ga0496112_0302922 Ga0496112_0302922_85_720 209
38 3300048917 Ga0496114_0436983 Ga0496114_0436983_511_1140 209
39 3300048918 Ga0496115_0000659 Ga0496115_0000659_13078_13707 209
40 3300049591 Ga0501075_0002912 Ga0501075_0002912_2568_3197 209
41 3300053077 Ga0495601_0000043 Ga0495601_0000043_65739_66368 209
42 3300053077 Ga0495601_0013476 Ga0495601_0013476_1950_2582 209
43 3300053077 Ga0495601_0208995 Ga0495601_0208995_37_672 209
44 3300025908 Ga0207643_10142471 Ga0207643_101424712 210
45 3300025945 Ga0207679_10489688 Ga0207679_104896882 212
46 3300030744 Ga0316181_1229879 Ga0316181_12298791 214
47 3300031456 Ga0307513_10000001 Ga0307513_100000011066 214
48 3300042007 Ga0439449_0032860 Ga0439449_0032860_894_1628 214
49 3300046458 Ga0495591_062451 Ga0495591_062451_23_688 215
50 3300005356 Ga0070674_100521054 Ga0070674_1005210542 216
51 3300005434 Ga0070709_10499428 Ga0070709_104994281 216
52 3300005438 Ga0070701_10226220 Ga0070701_102262201 216
53 3300005457 Ga0070662_100185649 Ga0070662_1001856492 216
54 3300026075 Ga0207708_10205378 Ga0207708_102053782 216
55 3300026089 Ga0207648_10232404 Ga0207648_102324042 216
56 3300026118 Ga0207675_100230427 Ga0207675_1002304272 216
57 3300028379 Ga0268266_10227193 Ga0268266_102271933 216
58 3300031731 Ga0307405_10803469 Ga0307405_108034692 216
59 3300031852 Ga0307410_10503774 Ga0307410_105037742 216
60 3300032126 Ga0307415_100569830 Ga0307415_1005698302 216
61 3300044684 Ga0466966_0051998 Ga0466966_0051998_628_1296 216
62 3300045049 Ga0466959_0357776 Ga0466959_0357776_313_978 216
63 3300045976 Ga0466967_0031969 Ga0466967_0031969_2528_3187 216
64 3300045976 Ga0466967_0120433 Ga0466967_0120433_722_1372 216
65 3300049568 Ga0501031_0332422 Ga0501031_0332422_108_767 216
66 3300049580 Ga0501046_0686611 Ga0501046_0686611_38_697 216
67 3300010375 Ga0105239_10707258 Ga0105239_107072581 220
68 3300025904 Ga0207647_10229517 Ga0207647_102295172 220
69 3300001977 JGI24746J21847_1003657 JGI24746J21847_10036573 221
70 3300005329 Ga0070683_100094024 Ga0070683_1000940242 221
71 3300005337 Ga0070682_100000075 Ga0070682_10000007540 221
72 3300005344 Ga0070661_100000099 Ga0070661_10000009946 221
73 3300005366 Ga0070659_100065555 Ga0070659_1000655553 221
74 3300005367 Ga0070667_100045207 Ga0070667_1000452072 221
75 3300005367 Ga0070667_100675632 Ga0070667_1006756322 221
76 3300005445 Ga0070708_100891657 Ga0070708_1008916571 221
77 3300005455 Ga0070663_100005524 Ga0070663_1000055242 221
78 3300005458 Ga0070681_10084429 Ga0070681_100844293 221
79 3300005466 Ga0070685_10003546 Ga0070685_100035466 221
80 3300005530 Ga0070679_100000369 Ga0070679_1000003693 221
81 3300005530 Ga0070679_100137534 Ga0070679_1001375342 221
82 3300005535 Ga0070684_100073244 Ga0070684_1000732442 221
83 3300005535 Ga0070684_100146101 Ga0070684_1001461012 221
84 3300005536 Ga0070697_100615397 Ga0070697_1006153971 221
85 3300005539 Ga0068853_100021307 Ga0068853_1000213073 221
86 3300005539 Ga0068853_100185557 Ga0068853_1001855572 221
87 3300005543 Ga0070672_100000001 Ga0070672_10000000162 221
88 3300005544 Ga0070686_100338635 Ga0070686_1003386352 221
89 3300005548 Ga0070665_100018070 Ga0070665_1000180702 221
90 3300005548 Ga0070665_100136231 Ga0070665_1001362313 221
91 3300005563 Ga0068855_100136015 Ga0068855_1001360152 221
92 3300005578 Ga0068854_100000597 Ga0068854_10000059716 221
93 3300005614 Ga0068856_100150467 Ga0068856_1001504672 221
94 3300005614 Ga0068856_100964290 Ga0068856_1009642902 221
95 3300005616 Ga0068852_100000056 Ga0068852_10000005681 221
96 3300005616 Ga0068852_100001985 Ga0068852_10000198514 221
97 3300005843 Ga0068860_100095376 Ga0068860_1000953762 221
98 3300005981 Ga0081538_10000141 Ga0081538_1000014147 221
99 3300005981 Ga0081538_10072152 Ga0081538_100721522 221
100 3300005981 Ga0081538_10108682 Ga0081538_101086822 221
101 3300006175 Ga0070712_100027794 Ga0070712_1000277942 221
102 3300006852 Ga0075433_10271663 Ga0075433_102716632 221
103 3300006871 Ga0075434_100133061 Ga0075434_1001330612 221
104 3300006881 Ga0068865_100000490 Ga0068865_10000049013 221
105 3300007076 Ga0075435_100156821 Ga0075435_1001568212 221
106 3300009098 Ga0105245_10000130 Ga0105245_1000013013 221
107 3300009101 Ga0105247_10062266 Ga0105247_100622662 221
108 3300009101 Ga0105247_10203672 Ga0105247_102036722 221
109 3300009147 Ga0114129_10510594 Ga0114129_105105942 221
110 3300009177 Ga0105248_10290080 Ga0105248_102900802 221
111 3300009545 Ga0105237_10130301 Ga0105237_101303013 221
112 3300009551 Ga0105238_10093544 Ga0105238_100935442 221
113 3300009553 Ga0105249_11417760 Ga0105249_114177601 221
114 3300013102 Ga0157371_10012360 Ga0157371_100123604 221
115 3300013297 Ga0157378_10480435 Ga0157378_104804352 221
116 3300013308 Ga0157375_10553376 Ga0157375_105533761 221
117 3300014325 Ga0163163_10216764 Ga0163163_102167641 221
118 3300014968 Ga0157379_10235418 Ga0157379_102354182 221
119 3300014969 Ga0157376_10030681 Ga0157376_100306813 221
120 3300025893 Ga0207682_10000091 Ga0207682_1000009131 221
121 3300025900 Ga0207710_10022601 Ga0207710_100226012 221
122 3300025903 Ga0207680_10008001 Ga0207680_100080013 221
123 3300025905 Ga0207685_10054325 Ga0207685_100543252 221
124 3300025912 Ga0207707_10081665 Ga0207707_100816652 221
125 3300025915 Ga0207693_10010394 Ga0207693_100103942 221
126 3300025921 Ga0207652_10000321 Ga0207652_100003213 221
127 3300025921 Ga0207652_10000827 Ga0207652_1000082727 221
128 3300025926 Ga0207659_10000013 Ga0207659_1000001355 221
129 3300025927 Ga0207687_10000032 Ga0207687_1000003252 221
130 3300025927 Ga0207687_10001820 Ga0207687_100018206 221
131 3300025927 Ga0207687_10003571 Ga0207687_100035712 221
132 3300025932 Ga0207690_10034255 Ga0207690_100342552 221
133 3300025940 Ga0207691_10000747 Ga0207691_1000074719 221
134 3300025944 Ga0207661_10001320 Ga0207661_100013202 221
135 3300025944 Ga0207661_10004833 Ga0207661_100048334 221
136 3300025949 Ga0207667_10163879 Ga0207667_101638792 221
137 3300025981 Ga0207640_10015656 Ga0207640_100156563 221
138 3300025986 Ga0207658_10033211 Ga0207658_100332112 221
139 3300026067 Ga0207678_10016549 Ga0207678_100165493 221
140 3300026078 Ga0207702_10121120 Ga0207702_101211202 221
141 3300026078 Ga0207702_10836252 Ga0207702_108362522 221
142 3300026088 Ga0207641_10000016 Ga0207641_10000016222 221
143 3300026089 Ga0207648_10011475 Ga0207648_100114755 221
144 3300026089 Ga0207648_10119955 Ga0207648_101199552 221
145 3300026116 Ga0207674_10218655 Ga0207674_102186552 221
146 3300026118 Ga0207675_100688008 Ga0207675_1006880082 221
147 3300026142 Ga0207698_10011384 Ga0207698_100113843 221
148 3300026142 Ga0207698_10012334 Ga0207698_100123343 221
149 3300026142 Ga0207698_10507392 Ga0207698_105073922 221
150 3300028379 Ga0268266_10000674 Ga0268266_1000067414 221
151 3300028379 Ga0268266_10037338 Ga0268266_100373383 221
152 3300037418 Ga0395900_0137055 Ga0395900_0137055_130_795 221
153 3300038443 Ga0395901_0235935 Ga0395901_0235935_765_1430 221
154 3300041512 Ga0451853_0696215 Ga0451853_0696215_1639_2304 221
155 3300045976 Ga0466967_0000001 Ga0466967_0000001_83393_84058 221
156 3300046454 Ga0495592_0048473 Ga0495592_0048473_1865_2530 221
157 3300046455 Ga0495603_0026227 Ga0495603_0026227_2446_3111 221
158 3300046459 Ga0495629_0002184 Ga0495629_0002184_2664_3329 221
159 3300046459 Ga0495629_0105872 Ga0495629_0105872_1210_1875 221
160 3300046463 Ga0495653_0116570 Ga0495653_0116570_844_1509 221
161 3300046476 Ga0495662_0003445 Ga0495662_0003445_575_1240 221
162 3300046492 Ga0495585_0112158 Ga0495585_0112158_202_867 221
163 3300046507 Ga0495606_0000040 Ga0495606_0000040_15421_16086 221
164 3300046514 Ga0495618_0000014 Ga0495618_0000014_144804_145469 221
165 3300046515 Ga0495620_0000139 Ga0495620_0000139_30464_31129 221
166 3300046516 Ga0495628_0000815 Ga0495628_0000815_2907_3575 221
167 3300046516 Ga0495628_0033528 Ga0495628_0033528_851_1516 221
168 3300046517 Ga0495630_0000075 Ga0495630_0000075_1907_2572 221
169 3300046523 Ga0495644_0000377 Ga0495644_0000377_18436_19101 221
170 3300046523 Ga0495644_0134521 Ga0495644_0134521_173_859 221
171 3300046535 Ga0495586_0001484 Ga0495586_0001484_9434_10099 221
172 3300046537 Ga0495598_0000632 Ga0495598_0000632_3169_3834 221
173 3300046663 Ga0495635_0000076 Ga0495635_0000076_35497_36162 221
174 3300046663 Ga0495635_0263984 Ga0495635_0263984_254_919 221
175 3300046674 Ga0495588_0000387 Ga0495588_0000387_12139_12804 221
176 3300046675 Ga0495657_0015870 Ga0495657_0015870_2469_3134 221
177 3300046678 Ga0495599_0023030 Ga0495599_0023030_1975_2640 221
178 3300046681 Ga0495647_0000001 Ga0495647_0000001_138991_139656 221
179 3300046689 Ga0495613_0000005 Ga0495613_0000005_71756_72421 221
180 3300046690 Ga0495624_0000027 Ga0495624_0000027_1005_1670 221
181 3300046694 Ga0495649_0001845 Ga0495649_0001845_14333_14998 221
182 3300046809 Ga0495600_0005375 Ga0495600_0005375_5016_5681 221
183 3300047317 Ga0495604_0000704 Ga0495604_0000704_919_1590 221
184 3300047317 Ga0495604_0009362 Ga0495604_0009362_910_1575 221
185 3300047317 Ga0495604_0177302 Ga0495604_0177302_250_915 221
186 3300047321 Ga0495676_0238437 Ga0495676_0238437_204_869 221
187 3300047446 Ga0495679_020895 Ga0495679_020895_368_1033 221
188 3300047472 Ga0495686_0043741 Ga0495686_0043741_597_1262 221
189 3300047673 Ga0495593_0047022 Ga0495593_0047022_888_1553 221
190 3300047673 Ga0495593_0198785 Ga0495593_0198785_225_896 221
191 3300048088 Ga0495602_0048315 Ga0495602_0048315_2685_3353 221
192 3300048907 Ga0496104_0087108 Ga0496104_0087108_444_1109 221
193 3300048907 Ga0496104_0128586 Ga0496104_0128586_668_1333 221
194 3300048908 Ga0496105_0062109 Ga0496105_0062109_1962_2627 221
195 3300048909 Ga0496106_0509357 Ga0496106_0509357_55_720 221
196 3300048910 Ga0496107_0141535 Ga0496107_0141535_526_1191 221
197 3300048911 Ga0496108_0000006 Ga0496108_0000006_311712_312377 221
198 3300048911 Ga0496108_0000550 Ga0496108_0000550_24581_25246 221
199 3300048911 Ga0496108_0088536 Ga0496108_0088536_1707_2372 221
200 3300048912 Ga0496109_0000009 Ga0496109_0000009_78800_79465 221
201 3300048912 Ga0496109_0000174 Ga0496109_0000174_37372_38037 221
202 3300048912 Ga0496109_0000261 Ga0496109_0000261_41881_42546 221
203 3300048912 Ga0496109_0271075 Ga0496109_0271075_22_687 221
204 3300048913 Ga0496110_0087624 Ga0496110_0087624_867_1532 221
205 3300048916 Ga0496113_0013048 Ga0496113_0013048_794_1459 221
206 3300048917 Ga0496114_0076661 Ga0496114_0076661_1023_1688 221
207 3300048917 Ga0496114_0155415 Ga0496114_0155415_183_848 221
208 3300048917 Ga0496114_0740863 Ga0496114_0740863_19_684 221
209 3300048920 Ga0496117_0119800 Ga0496117_0119800_773_1438 221
210 3300048921 Ga0496118_0179439 Ga0496118_0179439_168_833 221
211 3300048922 Ga0496119_0016234 Ga0496119_0016234_2311_2976 221
212 3300048924 Ga0496121_0023378 Ga0496121_0023378_3615_4280 221
213 3300048927 Ga0496124_0031918 Ga0496124_0031918_1015_1680 221
214 3300048928 Ga0496125_0027315 Ga0496125_0027315_2476_3141 221
215 3300048928 Ga0496125_0042198 Ga0496125_0042198_1192_1857 221
216 3300048929 Ga0496126_0378067 Ga0496126_0378067_39_704 221
217 3300048929 Ga0496126_0551120 Ga0496126_0551120_237_902 221
218 3300049568 Ga0501031_0000322 Ga0501031_0000322_22944_23609 221
219 3300049569 Ga0501032_0000826 Ga0501032_0000826_18141_18806 221
220 3300049569 Ga0501032_0123882 Ga0501032_0123882_523_1188 221
221 3300049570 Ga0501033_0001043 Ga0501033_0001043_6382_7047 221
222 3300049571 Ga0501034_0011269 Ga0501034_0011269_5182_5847 221
223 3300049571 Ga0501034_0355723 Ga0501034_0355723_574_1239 221
224 3300049572 Ga0501036_0001543 Ga0501036_0001543_10526_11191 221
225 3300049573 Ga0501037_0000695 Ga0501037_0000695_6375_7040 221
226 3300049574 Ga0501038_0000822 Ga0501038_0000822_22940_23605 221
227 3300049575 Ga0501039_0021456 Ga0501039_0021456_723_1388 221
228 3300049578 Ga0501042_0055922 Ga0501042_0055922_1099_1764 221
229 3300049579 Ga0501043_0015803 Ga0501043_0015803_1417_2082 221
230 3300049579 Ga0501043_0351823 Ga0501043_0351823_85_750 221
231 3300049580 Ga0501046_0001474 Ga0501046_0001474_3793_4458 221
232 3300049581 Ga0501047_0000430 Ga0501047_0000430_39350_40015 221
233 3300049581 Ga0501047_0214463 Ga0501047_0214463_301_966 221
234 3300049582 Ga0501048_0001198 Ga0501048_0001198_4026_4691 221
235 3300049582 Ga0501048_0126316 Ga0501048_0126316_697_1362 221
236 3300049584 Ga0501068_0020730 Ga0501068_0020730_2125_2790 221
237 3300049585 Ga0501069_0057820 Ga0501069_0057820_1434_2099 221
238 3300049586 Ga0501070_0001324 Ga0501070_0001324_17630_18295 221
239 3300049586 Ga0501070_0009114 Ga0501070_0009114_1547_2212 221
240 3300049586 Ga0501070_0031155 Ga0501070_0031155_3129_3794 221
241 3300049586 Ga0501070_0251898 Ga0501070_0251898_240_905 221
242 3300049587 Ga0501071_0088484 Ga0501071_0088484_990_1655 221
243 3300049589 Ga0501073_0034491 Ga0501073_0034491_2048_2713 221
244 3300049590 Ga0501074_0020905 Ga0501074_0020905_3456_4121 221
245 3300049741 Ga0501079_0016631 Ga0501079_0016631_4049_4714 221
246 3300049741 Ga0501079_0034113 Ga0501079_0034113_613_1278 221
247 3300049742 Ga0501080_0008088 Ga0501080_0008088_1523_2188 221
248 3300049744 Ga0501083_0014653 Ga0501083_0014653_2714_3379 221
249 3300049744 Ga0501083_0046963 Ga0501083_0046963_1008_1673 221
250 3300049822 Ga0501035_0007209 Ga0501035_0007209_4559_5224 221
251 3300049822 Ga0501035_0508534 Ga0501035_0508534_114_779 221
252 3300049823 Ga0501044_0001702 Ga0501044_0001702_6860_7525 221
253 3300049823 Ga0501044_0057033 Ga0501044_0057033_308_973 221
254 3300049823 Ga0501044_0389683 Ga0501044_0389683_308_973 221
255 3300049824 Ga0501045_0158772 Ga0501045_0158772_109_774 221
256 3300049824 Ga0501045_0313998 Ga0501045_0313998_393_1058 221
257 3300050507 nmdc:mga05p37_371720_c1 nmdc:mga05p37_371720_c1_621_1337 221
258 3300050510 nmdc:mga06r32_52940_c1 nmdc:mga06r32_52940_c1_1040_1720 221
259 3300050513 nmdc:mga0rr50_90825_c1 nmdc:mga0rr50_90825_c1_65_781 221
260 3300053077 Ga0495601_0000723 Ga0495601_0000723_14988_15653 221
261 3300053078 Ga0495612_0023716 Ga0495612_0023716_1335_2000 221
262 3300053084 Ga0495595_0007636 Ga0495595_0007636_1121_1786 221
263 3300053084 Ga0495595_0243178 Ga0495595_0243178_36_722 221
264 3300053085 Ga0495619_0000047 Ga0495619_0000047_82877_83542 221
265 3300053111 Ga0500572_069441 Ga0500572_069441_79_747 221
266 3300054114 Ga0501084_0148845 Ga0501084_0148845_233_916 221
267 3300054114 Ga0501084_0155411 Ga0501084_0155411_1033_1698 221
268 3300060353 Ga0501082_0001614 Ga0501082_0001614_15417_16082 221
269 3300060353 Ga0501082_0814897 Ga0501082_0814897_22_705 221
270 3300061734 Ga0530510_0174018 Ga0530510_0174018_582_1265 221
271 3300061734 Ga0530510_0262806 Ga0530510_0262806_148_831 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

2

103

0.94

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

106

242

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c3v-assembly1.cif.gz_A dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc 0.8892 2 221
1c3v-assembly1.cif.gz_A dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc 0.8816 2 221
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.8632 1 221
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.8595 1 221
5us6-assembly2.cif.gz_H structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.8508 1 215
ID Description Score Start End Superfamily
af_P9WP23_2_120_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9158 3 118 3.50.50.60
1c3vA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8929 104 189 3.30.360.10
1yl7C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8901 3 220 3.40.50.720
1vm6D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8883 105 190 3.30.360.10
af_P9WP23_2_88_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8881 3 89 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W0LK28-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 1.001 1 72 GO:0008839
GO:0009089
AF-A0A7W0LK28-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9875 1 72 GO:0008839
GO:0009089
AF-A0A538CS06-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9698 1 83 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A838UZA4-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.9526 1 221 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287
AF-A0A7W1NHY9-F1-model_v4 deleted 0.951 1 220

Feature Viewer

pLDDT pTM Quality
96.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map