F377553

General Info

Members Datasets Scaffolds Average Seq Length
271 178 542 212

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10204676|Ga0081455_102046762
Length 214
Sequence MTCEFSLDHYRDLLRAAGRGGYRWASFDREPEEGDLFLRHDVDLSLDAALRMAELEAEEGAAATYFLMTESVFYNLGSSEGRDALGRLRALGHRVGLHAVWPKRVVDERFEPVVAWHNPDPEYMREPLGDRLVNVMEPRFFTPEHYRSDSNQHWRSGCPHEQLARGEFEWLQLLTHPEIWVYSGSTMGETMRAMLDAERERRLQQLAEDRIDLS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0
Rhizoplane 11.44
Rhizosphere 85.24
Stem 0
Stem Tuber 0
Unclassified 22.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10204676 3300005937 Bacteria 1475
2 Ga0070658_10530823 3300005327 Unclassified 1018
3 Ga0070670_100000628 3300005331 Bacteria 27633
4 Ga0070671_100148166 3300005355 Bacteria 1981
5 Ga0070674_100083439 3300005356 Unclassified 2288
6 Ga0070709_10139649 3300005434 Bacteria 1663
7 Ga0070713_100556898 3300005436 Unclassified 1086
8 Ga0070711_100058451 3300005439 Bacteria 2674
9 Ga0070694_100309078 3300005444 Bacteria 1213
10 Ga0070678_100062979 3300005456 Unclassified 2742
11 Ga0070678_100405455 3300005456 Bacteria 1185
12 Ga0070681_10063626 3300005458 Unclassified 3661
13 Ga0070681_10261298 3300005458 Bacteria 1643
14 Ga0070706_100300201 3300005467 Bacteria 1499
15 Ga0070698_100649849 3300005471 Unclassified 996
16 Ga0070699_100070631 3300005518 Unclassified 3036
17 Ga0070699_100182095 3300005518 Bacteria 1865
18 Ga0070684_100104596 3300005535 Bacteria 2533
19 Ga0070684_100514534 3300005535 Unclassified 1109
20 Ga0070697_100612037 3300005536 Bacteria 958
21 Ga0070693_100457067 3300005547 Unclassified 897
22 Ga0070704_100325944 3300005549 Bacteria 1288
23 Ga0081455_10476572 3300005937 Bacteria 845
24 Ga0081538_10000055 3300005981 Bacteria 106524
25 Ga0070717_10587519 3300006028 Bacteria 1010
26 Ga0075365_10025908 3300006038 Bacteria 3716
27 Ga0075365_10067507 3300006038 Archaea 2401
28 Ga0075365_10093124 3300006038 Unclassified 2055
29 Ga0075363_100035834 3300006048 Bacteria 2599
30 Ga0075364_10053032 3300006051 Bacteria 2650
31 Ga0070715_10098041 3300006163 Bacteria 1362
32 Ga0070712_100053501 3300006175 Bacteria 2819
33 Ga0070712_100194840 3300006175 Bacteria 1588
34 Ga0075367_10349105 3300006178 Bacteria 934
35 Ga0097621_100136800 3300006237 Unclassified 2090
36 Ga0075428_100006409 3300006844 Bacteria 13094
37 Ga0075431_100117767 3300006847 Bacteria 2741
38 Ga0075433_10070412 3300006852 Bacteria 3074
39 Ga0075434_100232548 3300006871 Bacteria 1863
40 Ga0068865_100016462 3300006881 Unclassified 4732
41 Ga0068865_100281879 3300006881 Bacteria 1323
42 Ga0111539_10601726 3300009094 Unclassified 1280
43 Ga0111539_11094324 3300009094 Bacteria 926
44 Ga0105245_10434683 3300009098 Unclassified 1318
45 Ga0105245_10824198 3300009098 Unclassified 967
46 Ga0105245_11176142 3300009098 Unclassified 814
47 Ga0105245_11337761 3300009098 Bacteria 766
48 Ga0114129_10001817 3300009147 Bacteria 29087
49 Ga0114129_10824877 3300009147 Archaea 1181
50 Ga0105243_10482159 3300009148 Bacteria 1171
51 Ga0105243_10846974 3300009148 Unclassified 905
52 Ga0105241_11103106 3300009174 Bacteria 747
53 Ga0105242_10031249 3300009176 Unclassified 4251
54 Ga0105242_10048269 3300009176 Bacteria 3460
55 Ga0105242_10884240 3300009176 Unclassified 892
56 Ga0105249_10283624 3300009553 Bacteria 1655
57 Ga0105246_10086018 3300011119 Archaea 2253
58 Ga0157369_10191608 3300013105 Bacteria 2148
59 Ga0157378_10259268 3300013297 Bacteria 1667
60 Ga0157375_10151731 3300013308 Unclassified 2453
61 Ga0157375_11067221 3300013308 Bacteria 945
62 Ga0163163_10332959 3300014325 Unclassified 1573
63 Ga0157377_10229114 3300014745 Unclassified 1194
64 Ga0157376_10248284 3300014969 Bacteria 1661
65 Ga0163161_10735609 3300017792 Bacteria 824
66 Ga0207692_10262939 3300025898 Bacteria 1038
67 Ga0207707_10183634 3300025912 Bacteria 1825
68 Ga0207693_10068011 3300025915 Bacteria 2789
69 Ga0207663_10031339 3300025916 Unclassified 3147
70 Ga0207657_10019298 3300025919 Bacteria 6478
71 Ga0207681_10288432 3300025923 Unclassified 1295
72 Ga0207650_10015035 3300025925 Bacteria 5384
73 Ga0207687_10087260 3300025927 Bacteria 2267
74 Ga0207687_10138201 3300025927 Bacteria 1845
75 Ga0207700_10168532 3300025928 Bacteria 1825
76 Ga0207664_10422215 3300025929 Bacteria 1188
77 Ga0207664_10620585 3300025929 Bacteria 971
78 Ga0207644_10631005 3300025931 Bacteria 891
79 Ga0207686_10084906 3300025934 Unclassified 2075
80 Ga0207709_10169646 3300025935 Unclassified 1530
81 Ga0207709_10577967 3300025935 Unclassified 887
82 Ga0207669_10051496 3300025937 Bacteria 2467
83 Ga0207661_10887854 3300025944 Unclassified 821
84 Ga0207712_10317334 3300025961 Bacteria 1285
85 Ga0207677_10444105 3300026023 Bacteria 1110
86 Ga0207678_10585011 3300026067 Bacteria 978
87 Ga0207702_10569727 3300026078 Bacteria 1109
88 Ga0207674_10013118 3300026116 Bacteria 9222
89 Ga0207675_100046592 3300026118 Bacteria 4051
90 Ga0207683_10041336 3300026121 Bacteria 4026
91 Ga0207428_10108053 3300027907 Unclassified 2143
92 Ga0265319_1012127 3300028563 Bacteria 3494
93 Ga0265319_1041695 3300028563 Bacteria 1547
94 Ga0265334_10012546 3300028573 Bacteria 3558
95 Ga0265318_10004243 3300028577 Bacteria 6993
96 Ga0265318_10022894 3300028577 Bacteria 2494
97 Ga0265322_10013672 3300028654 Unclassified 2350
98 Ga0265336_10030743 3300028666 Bacteria 1672
99 Ga0265320_10033979 3300031240 Bacteria 2599
100 Ga0265320_10060159 3300031240 Unclassified 1814
101 Ga0265340_10014021 3300031247 Bacteria 4199
102 Ga0265340_10148565 3300031247 Unclassified 1069
103 Ga0265331_10128290 3300031250 Bacteria 1158
104 Ga0265327_10026967 3300031251 Bacteria 3316
105 Ga0265327_10079942 3300031251 Bacteria 1617
106 Ga0265316_10063344 3300031344 Unclassified 2867
107 Ga0265314_10011598 3300031711 Bacteria 7259
108 Ga0265342_10106347 3300031712 Unclassified 1592
109 Ga0307409_100207364 3300031995 Bacteria 1759
110 Ga0307416_100089680 3300032002 Bacteria 2634
111 Ga0307416_100143867 3300032002 Bacteria 2173
112 Ga0307416_100961558 3300032002 Unclassified 956
113 Ga0307414_10605642 3300032004 Bacteria 983
114 Ga0307411_10239497 3300032005 Bacteria 1419
115 Ga0373955_0020519 3300035172 Unclassified 3324
116 Ga0373933_0120751 3300035724 Unclassified 1641
117 Ga0395899_0026824 3300037312 Bacteria 4346
118 Ga0395899_0185347 3300037312 Bacteria 1459
119 Ga0395900_0210597 3300037418 Bacteria 1963
120 Ga0395900_0447641 3300037418 Unclassified 1248
121 Ga0395898_0057875 3300037466 Bacteria 3775
122 Ga0395898_0450312 3300037466 Unclassified 1226
123 Ga0395898_0535593 3300037466 Bacteria 1113
124 Ga0395905_0100219 3300037471 Bacteria 2720
125 Ga0395905_0774522 3300037471 Bacteria 862
126 Ga0395905_0778199 3300037471 Bacteria 860
127 Ga0395901_0012197 3300038443 Bacteria 8722
128 Ga0395901_0028157 3300038443 Bacteria 5780
129 Ga0395901_0062367 3300038443 Bacteria 3879
130 Ga0395901_0094911 3300038443 Bacteria 3125
131 Ga0395901_0143441 3300038443 Bacteria 2510
132 Ga0395901_0333266 3300038443 Unclassified 1568
133 Ga0395901_0882059 3300038443 Bacteria 878
134 Ga0436360_0216136 3300039438 Bacteria 2026
135 Ga0439436_0035424 3300041404 Unclassified 1442
136 Ga0439439_0001319 3300041406 Bacteria 4874
137 Ga0451847_0519690 3300041503 Unclassified 1448
138 Ga0439431_0018343 3300041997 Unclassified 1655
139 Ga0439433_0000319 3300041999 Bacteria 8402
140 Ga0439449_0039800 3300042007 Unclassified 1748
141 Ga0439457_011240 3300042014 Bacteria 2041
142 Ga0466972_0227532 3300044658 Bacteria 873
143 Ga0466963_0004129 3300044694 Bacteria 8398
144 Ga0466963_0028714 3300044694 Bacteria 3575
145 Ga0466963_0038263 3300044694 Bacteria 3136
146 Ga0466963_0397695 3300044694 Bacteria 972
147 Ga0466971_0018577 3300044719 Bacteria 3081
148 Ga0466968_0003656 3300044735 Bacteria 5702
149 Ga0466970_0134301 3300044765 Bacteria 1360
150 Ga0466957_0068414 3300044842 Bacteria 2192
151 Ga0466957_0297657 3300044842 Bacteria 1083
152 Ga0466957_0299875 3300044842 Bacteria 1079
153 Ga0466957_0558607 3300044842 Bacteria 798
154 Ga0466960_0012860 3300044901 Bacteria 3543
155 Ga0466959_0068227 3300045049 Bacteria 2577
156 Ga0466958_0020085 3300045836 Bacteria 3894
157 Ga0466958_0188774 3300045836 Bacteria 1309
158 Ga0466967_0014629 3300045976 Bacteria 6122
159 Ga0466967_0026947 3300045976 Bacteria 4772
160 Ga0466967_0032385 3300045976 Bacteria 4413
161 Ga0466967_0519663 3300045976 Bacteria 1170
162 Ga0495629_0352265 3300046459 Bacteria 1004
163 Ga0495664_0115701 3300046477 Unclassified 1621
164 Ga0495596_0098801 3300046500 Unclassified 1133
165 Ga0495608_0014570 3300046511 Bacteria 5455
166 Ga0495628_0278504 3300046516 Bacteria 1243
167 Ga0495630_0106586 3300046517 Bacteria 2123
168 Ga0495640_0085586 3300046533 Bacteria 2089
169 Ga0495645_0343265 3300046543 Unclassified 964
170 Ga0495645_0442798 3300046543 Bacteria 821
171 Ga0495634_0337769 3300046642 Unclassified 904
172 Ga0495635_0036138 3300046663 Bacteria 3425
173 Ga0495599_0034012 3300046678 Unclassified 3204
174 Ga0495613_0165435 3300046689 Unclassified 1572
175 Ga0495674_0055057 3300047319 Unclassified 3490
176 Ga0495674_0346632 3300047319 Bacteria 1206
177 Ga0495680_0018508 3300047322 Bacteria 5909
178 Ga0495684_0162474 3300047471 Bacteria 1665
179 Ga0495684_0341845 3300047471 Unclassified 1065
180 Ga0495684_0462088 3300047471 Bacteria 880
181 Ga0495602_0127828 3300048088 Unclassified 2032
182 Ga0496100_0042724 3300048903 Bacteria 2896
183 Ga0496101_0002859 3300048904 Bacteria 10609
184 Ga0496101_0055043 3300048904 Bacteria 2872
185 Ga0496101_0445132 3300048904 Bacteria 1022
186 Ga0496102_0048956 3300048905 Bacteria 3844
187 Ga0496102_1007148 3300048905 Unclassified 754
188 Ga0496103_0035903 3300048906 Bacteria 3035
189 Ga0496103_0041198 3300048906 Bacteria 2839
190 Ga0496104_0001903 3300048907 Bacteria 18081
191 Ga0496104_0239979 3300048907 Bacteria 1725
192 Ga0496105_0000330 3300048908 Bacteria 31113
193 Ga0496107_0088508 3300048910 Bacteria 2260
194 Ga0496107_0107653 3300048910 Bacteria 2047
195 Ga0496108_0009322 3300048911 Bacteria 7947
196 Ga0496109_0005869 3300048912 Bacteria 10299
197 Ga0496109_0075336 3300048912 Bacteria 3103
198 Ga0496109_0346516 3300048912 Bacteria 1403
199 Ga0496110_0026431 3300048913 Bacteria 4968
200 Ga0496110_0172733 3300048913 Bacteria 1961
201 Ga0496110_0591766 3300048913 Bacteria 1007
202 Ga0496112_0000445 3300048915 Bacteria 27506
203 Ga0496112_0009027 3300048915 Bacteria 8954
204 Ga0496112_0011208 3300048915 Bacteria 8176
205 Ga0496112_0239850 3300048915 Bacteria 1766
206 Ga0496113_0197596 3300048916 Bacteria 1598
207 Ga0496114_0002274 3300048917 Bacteria 14629
208 Ga0496115_0016657 3300048918 Bacteria 5602
209 Ga0496115_0069700 3300048918 Unclassified 2849
210 Ga0496115_0113259 3300048918 Bacteria 2229
211 Ga0496115_0206209 3300048918 Bacteria 1624
212 Ga0496115_0223662 3300048918 Bacteria 1553
213 Ga0501033_0011965 3300049570 Bacteria 6629
214 Ga0501034_0011961 3300049571 Bacteria 8969
215 Ga0501037_0049585 3300049573 Bacteria 3074
216 Ga0501038_0119753 3300049574 Bacteria 2172
217 Ga0501041_0089640 3300049577 Archaea 1899
218 Ga0501042_0301042 3300049578 Bacteria 1158
219 Ga0501043_0019623 3300049579 Bacteria 5306
220 Ga0501046_0002548 3300049580 Bacteria 17045
221 Ga0501047_0149977 3300049581 Bacteria 2208
222 Ga0501047_0264326 3300049581 Bacteria 1568
223 Ga0501047_0565805 3300049581 Bacteria 960
224 Ga0501048_0051081 3300049582 Bacteria 2943
225 Ga0501067_0095028 3300049583 Bacteria 1655
226 Ga0501068_0013881 3300049584 Bacteria 4592
227 Ga0501069_0000627 3300049585 Bacteria 16319
228 Ga0501069_0009240 3300049585 Bacteria 5204
229 Ga0501069_0382428 3300049585 Bacteria 832
230 Ga0501070_0000124 3300049586 Bacteria 68928
231 Ga0501070_0212574 3300049586 Bacteria 1587
232 Ga0501071_0341623 3300049587 Unclassified 1138
233 Ga0501071_0364581 3300049587 Bacteria 1100
234 Ga0501072_0146635 3300049588 Bacteria 1881
235 Ga0501072_0286291 3300049588 Bacteria 1310
236 Ga0501072_0647407 3300049588 Bacteria 832
237 Ga0501073_0006171 3300049589 Bacteria 8946
238 Ga0501075_0107199 3300049591 Bacteria 2124
239 Ga0501075_0159328 3300049591 Bacteria 1721
240 Ga0501076_0126080 3300049592 Bacteria 2074
241 Ga0501076_0141924 3300049592 Archaea 1952
242 Ga0501076_0259254 3300049592 Unclassified 1423
243 Ga0501076_0605734 3300049592 Unclassified 904
244 Ga0501077_0030433 3300049593 Bacteria 3434
245 Ga0501077_0290735 3300049593 Bacteria 1041
246 Ga0501079_0125304 3300049741 Bacteria 1998
247 Ga0501079_0606785 3300049741 Bacteria 861
248 Ga0501080_0133957 3300049742 Bacteria 2293
249 Ga0501080_0208000 3300049742 Unclassified 1794
250 Ga0501080_0463491 3300049742 Unclassified 1135
251 Ga0501081_0093053 3300049743 Bacteria 2122
252 Ga0501083_0005576 3300049744 Bacteria 8911
253 Ga0501044_0031410 3300049823 Bacteria 5591
254 Ga0501045_0026784 3300049824 Bacteria 4149
255 nmdc:mga00v17_68176_c1 3300050491 Archaea 2199
256 nmdc:mga0yw44_73907_c1 3300050492 Archaea 2122
257 nmdc:mga05p37_2481_c1 3300050507 Bacteria 21472
258 nmdc:mga05p37_70542_c1 3300050507 Bacteria 4297
259 nmdc:mga05p37_893201_c1 3300050507 Bacteria 959
260 nmdc:mga06r32_104668_c1 3300050510 Bacteria 2779
261 nmdc:mga0n895_215927_c1 3300050512 Bacteria 1947
262 nmdc:mga0n895_69978_c1 3300050512 Bacteria 3477
263 nmdc:mga0rr50_100765_c1 3300050513 Unclassified 2269
264 nmdc:mga0a205_62785_c1 3300050515 Bacteria 3589
265 Ga0495619_0248394 3300053085 Bacteria 1233
266 Ga0501084_0325001 3300054114 Bacteria 1299
267 Ga0501084_0633145 3300054114 Bacteria 903
268 Ga0501082_0087203 3300060353 Bacteria 2692
269 Ga0501082_0261050 3300060353 Bacteria 1507
270 Ga0530510_0258705 3300061734 Bacteria 1297
271 Ga0530510_0345120 3300061734 Bacteria 1118
272 Ga0081455_10204676
273 Ga0070658_10530823
274 Ga0070670_100000628
275 Ga0070671_100148166
276 Ga0070674_100083439
277 Ga0070709_10139649
278 Ga0070713_100556898
279 Ga0070711_100058451
280 Ga0070694_100309078
281 Ga0070678_100062979
282 Ga0070678_100405455
283 Ga0070681_10063626
284 Ga0070681_10261298
285 Ga0070706_100300201
286 Ga0070698_100649849
287 Ga0070699_100070631
288 Ga0070699_100182095
289 Ga0070684_100104596
290 Ga0070684_100514534
291 Ga0070697_100612037
292 Ga0070693_100457067
293 Ga0070704_100325944
294 Ga0081455_10476572
295 Ga0081538_10000055
296 Ga0070717_10587519
297 Ga0075365_10025908
298 Ga0075365_10067507
299 Ga0075365_10093124
300 Ga0075363_100035834
301 Ga0075364_10053032
302 Ga0070715_10098041
303 Ga0070712_100053501
304 Ga0070712_100194840
305 Ga0075367_10349105
306 Ga0097621_100136800
307 Ga0075428_100006409
308 Ga0075431_100117767
309 Ga0075433_10070412
310 Ga0075434_100232548
311 Ga0068865_100016462
312 Ga0068865_100281879
313 Ga0111539_10601726
314 Ga0111539_11094324
315 Ga0105245_10434683
316 Ga0105245_10824198
317 Ga0105245_11176142
318 Ga0105245_11337761
319 Ga0114129_10001817
320 Ga0114129_10824877
321 Ga0105243_10482159
322 Ga0105243_10846974
323 Ga0105241_11103106
324 Ga0105242_10031249
325 Ga0105242_10048269
326 Ga0105242_10884240
327 Ga0105249_10283624
328 Ga0105246_10086018
329 Ga0157369_10191608
330 Ga0157378_10259268
331 Ga0157375_10151731
332 Ga0157375_11067221
333 Ga0163163_10332959
334 Ga0157377_10229114
335 Ga0157376_10248284
336 Ga0163161_10735609
337 Ga0207692_10262939
338 Ga0207707_10183634
339 Ga0207693_10068011
340 Ga0207663_10031339
341 Ga0207657_10019298
342 Ga0207681_10288432
343 Ga0207650_10015035
344 Ga0207687_10087260
345 Ga0207687_10138201
346 Ga0207700_10168532
347 Ga0207664_10422215
348 Ga0207664_10620585
349 Ga0207644_10631005
350 Ga0207686_10084906
351 Ga0207709_10169646
352 Ga0207709_10577967
353 Ga0207669_10051496
354 Ga0207661_10887854
355 Ga0207712_10317334
356 Ga0207677_10444105
357 Ga0207678_10585011
358 Ga0207702_10569727
359 Ga0207674_10013118
360 Ga0207675_100046592
361 Ga0207683_10041336
362 Ga0207428_10108053
363 Ga0265319_1012127
364 Ga0265319_1041695
365 Ga0265334_10012546
366 Ga0265318_10004243
367 Ga0265318_10022894
368 Ga0265322_10013672
369 Ga0265336_10030743
370 Ga0265320_10033979
371 Ga0265320_10060159
372 Ga0265340_10014021
373 Ga0265340_10148565
374 Ga0265331_10128290
375 Ga0265327_10026967
376 Ga0265327_10079942
377 Ga0265316_10063344
378 Ga0265314_10011598
379 Ga0265342_10106347
380 Ga0307409_100207364
381 Ga0307416_100089680
382 Ga0307416_100143867
383 Ga0307416_100961558
384 Ga0307414_10605642
385 Ga0307411_10239497
386 Ga0373955_0020519
387 Ga0373933_0120751
388 Ga0395899_0026824
389 Ga0395899_0185347
390 Ga0395900_0210597
391 Ga0395900_0447641
392 Ga0395898_0057875
393 Ga0395898_0450312
394 Ga0395898_0535593
395 Ga0395905_0100219
396 Ga0395905_0774522
397 Ga0395905_0778199
398 Ga0395901_0012197
399 Ga0395901_0028157
400 Ga0395901_0062367
401 Ga0395901_0094911
402 Ga0395901_0143441
403 Ga0395901_0333266
404 Ga0395901_0882059
405 Ga0436360_0216136
406 Ga0439436_0035424
407 Ga0439439_0001319
408 Ga0451847_0519690
409 Ga0439431_0018343
410 Ga0439433_0000319
411 Ga0439449_0039800
412 Ga0439457_011240
413 Ga0466972_0227532
414 Ga0466963_0004129
415 Ga0466963_0028714
416 Ga0466963_0038263
417 Ga0466963_0397695
418 Ga0466971_0018577
419 Ga0466968_0003656
420 Ga0466970_0134301
421 Ga0466957_0068414
422 Ga0466957_0297657
423 Ga0466957_0299875
424 Ga0466957_0558607
425 Ga0466960_0012860
426 Ga0466959_0068227
427 Ga0466958_0020085
428 Ga0466958_0188774
429 Ga0466967_0014629
430 Ga0466967_0026947
431 Ga0466967_0032385
432 Ga0466967_0519663
433 Ga0495629_0352265
434 Ga0495664_0115701
435 Ga0495596_0098801
436 Ga0495608_0014570
437 Ga0495628_0278504
438 Ga0495630_0106586
439 Ga0495640_0085586
440 Ga0495645_0343265
441 Ga0495645_0442798
442 Ga0495634_0337769
443 Ga0495635_0036138
444 Ga0495599_0034012
445 Ga0495613_0165435
446 Ga0495674_0055057
447 Ga0495674_0346632
448 Ga0495680_0018508
449 Ga0495684_0162474
450 Ga0495684_0341845
451 Ga0495684_0462088
452 Ga0495602_0127828
453 Ga0496100_0042724
454 Ga0496101_0002859
455 Ga0496101_0055043
456 Ga0496101_0445132
457 Ga0496102_0048956
458 Ga0496102_1007148
459 Ga0496103_0035903
460 Ga0496103_0041198
461 Ga0496104_0001903
462 Ga0496104_0239979
463 Ga0496105_0000330
464 Ga0496107_0088508
465 Ga0496107_0107653
466 Ga0496108_0009322
467 Ga0496109_0005869
468 Ga0496109_0075336
469 Ga0496109_0346516
470 Ga0496110_0026431
471 Ga0496110_0172733
472 Ga0496110_0591766
473 Ga0496112_0000445
474 Ga0496112_0009027
475 Ga0496112_0011208
476 Ga0496112_0239850
477 Ga0496113_0197596
478 Ga0496114_0002274
479 Ga0496115_0016657
480 Ga0496115_0069700
481 Ga0496115_0113259
482 Ga0496115_0206209
483 Ga0496115_0223662
484 Ga0501033_0011965
485 Ga0501034_0011961
486 Ga0501037_0049585
487 Ga0501038_0119753
488 Ga0501041_0089640
489 Ga0501042_0301042
490 Ga0501043_0019623
491 Ga0501046_0002548
492 Ga0501047_0149977
493 Ga0501047_0264326
494 Ga0501047_0565805
495 Ga0501048_0051081
496 Ga0501067_0095028
497 Ga0501068_0013881
498 Ga0501069_0000627
499 Ga0501069_0009240
500 Ga0501069_0382428
501 Ga0501070_0000124
502 Ga0501070_0212574
503 Ga0501071_0341623
504 Ga0501071_0364581
505 Ga0501072_0146635
506 Ga0501072_0286291
507 Ga0501072_0647407
508 Ga0501073_0006171
509 Ga0501075_0107199
510 Ga0501075_0159328
511 Ga0501076_0126080
512 Ga0501076_0141924
513 Ga0501076_0259254
514 Ga0501076_0605734
515 Ga0501077_0030433
516 Ga0501077_0290735
517 Ga0501079_0125304
518 Ga0501079_0606785
519 Ga0501080_0133957
520 Ga0501080_0208000
521 Ga0501080_0463491
522 Ga0501081_0093053
523 Ga0501083_0005576
524 Ga0501044_0031410
525 Ga0501045_0026784
526 nmdc:mga00v17_68176_c1
527 nmdc:mga0yw44_73907_c1
528 nmdc:mga05p37_2481_c1
529 nmdc:mga05p37_70542_c1
530 nmdc:mga05p37_893201_c1
531 nmdc:mga06r32_104668_c1
532 nmdc:mga0n895_215927_c1
533 nmdc:mga0n895_69978_c1
534 nmdc:mga0rr50_100765_c1
535 nmdc:mga0a205_62785_c1
536 Ga0495619_0248394
537 Ga0501084_0325001
538 Ga0501084_0633145
539 Ga0501082_0087203
540 Ga0501082_0261050
541 Ga0530510_0258705
542 Ga0530510_0345120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cc0-assembly1.cif.gz_B family 4 carbohydrate esterase from streptomyces lividans in complex with acetate 0.8744 36 99
2c79-assembly1.cif.gz_A the structure of a family 4 acetyl xylan esterase from clostridium thermocellum in complex with a colbalt ion. 0.8377 36 98
2vyo-assembly1.cif.gz_A chitin deacetylase family member from encephalitozoon cuniculi 0.804 28 98
4neg-assembly1.cif.gz_A the crystal structure of tryptophan synthase subunit beta from bacillus anthracis str. 'ames ancestor' 0.7847 38 99
3gem-assembly1.cif.gz_C crystal structure of short-chain dehydrogenase from pseudomonas syringae 0.7507 37 99
ID Description Score Start End Superfamily
2cc0B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8744 36 99 3.20.20.370
2c79A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8377 36 98 3.20.20.370
2vyoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.804 28 98 3.20.20.370
af_P0AFS3_8_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7816 38 99 3.40.50.720
af_K7K156_39_177_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7711 38 99 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W0TRI9-F1-model_v4 Uncharacterized protein 0.9939 1 183
AF-A0A7W0JLK0-F1-model_v4 Uncharacterized protein 0.9937 1 213
AF-A0A7W0JLK0-F1-model_v4 Uncharacterized protein 0.9891 1 213
AF-A0A7W1H368-F1-model_v4 Uncharacterized protein 0.9877 1 213
AF-A0A7W0TRI9-F1-model_v4 Uncharacterized protein 0.9832 1 183

Map