F377534

General Info

Members Datasets Scaffolds Average Seq Length
271 170 267 179

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100960949|Ga0068857_1009609491
Length 192
Sequence MYRSVLLGLSALLLFSISHAQNSIDTKSISASPLPADAVVQNACRQAAKENKRVLVMFHASWCGWCHRMDSSLNDNSCKKFFDDNYVIAHLVVMESKGKENLENPGGMDLLAKFNGVNQGIPFWVVMDKDGKVLADCLAKPEGAGSEVKGQNVGCPASENEVNFFIKVLKQTSKLSPEQEAAIVKRFRKNEH

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
3 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
4 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 1.48
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10095965 3300005288 Bacteria 1772
2 Ga0065712_10002201 3300005290 Bacteria 4932
3 Ga0070658_10233036 3300005327 Bacteria 1559
4 Ga0070683_100011519 3300005329 Bacteria 7650
5 Ga0070670_100074075 3300005331 Bacteria 2924
6 Ga0070670_100169832 3300005331 Bacteria 1891
7 Ga0070680_100010184 3300005336 Bacteria 7250
8 Ga0070682_100000306 3300005337 Bacteria 34011
9 Ga0068868_101149289 3300005338 Bacteria 716
10 Ga0070660_100244638 3300005339 Bacteria 1462
11 Ga0070689_100225913 3300005340 Bacteria 1537
12 Ga0070689_100963148 3300005340 Bacteria 757
13 Ga0070661_100020017 3300005344 Bacteria 4770
14 Ga0070661_100473781 3300005344 Bacteria 999
15 Ga0070668_100031183 3300005347 Unclassified 4055
16 Ga0070675_100495487 3300005354 Bacteria 1100
17 Ga0070671_100159642 3300005355 Bacteria 1906
18 Ga0070674_100056375 3300005356 Bacteria 2725
19 Ga0070673_100096124 3300005364 Bacteria 2431
20 Ga0070673_100190746 3300005364 Bacteria 1760
21 Ga0070688_100010004 3300005365 Bacteria 5210
22 Ga0070688_100059275 3300005365 Bacteria 2413
23 Ga0070659_100025511 3300005366 Bacteria 4541
24 Ga0070700_100055925 3300005441 Unclassified 2472
25 Ga0070694_100989064 3300005444 Unclassified 698
26 Ga0070663_100116798 3300005455 Bacteria 2011
27 Ga0070663_100482546 3300005455 Bacteria 1026
28 Ga0070678_100011522 3300005456 Bacteria 5462
29 Ga0070678_100252185 3300005456 Unclassified 1480
30 Ga0068867_100092510 3300005459 Bacteria 2297
31 Ga0068867_100329834 3300005459 Bacteria 1267
32 Ga0070685_10050704 3300005466 Unclassified 2398
33 Ga0070685_10064140 3300005466 Bacteria 2159
34 Ga0070685_10131671 3300005466 Bacteria 1564
35 Ga0070685_10314398 3300005466 Bacteria 1059
36 Ga0070707_100104556 3300005468 Bacteria 2745
37 Ga0070698_100000392 3300005471 Bacteria 46091
38 Ga0070698_100009662 3300005471 Bacteria 10319
39 Ga0070698_100018803 3300005471 Bacteria 7270
40 Ga0070698_100228023 3300005471 Unclassified 1796
41 Ga0070699_100265266 3300005518 Bacteria 1536
42 Ga0070679_100186555 3300005530 Bacteria 2044
43 Ga0070684_101164170 3300005535 Viruses 725
44 Ga0068853_100098518 3300005539 Bacteria 2582
45 Ga0068853_100284271 3300005539 Bacteria 1525
46 Ga0068853_100320819 3300005539 Bacteria 1436
47 Ga0070672_100184079 3300005543 Bacteria 1741
48 Ga0070686_100107009 3300005544 Unclassified 1899
49 Ga0070686_100419704 3300005544 Bacteria 1022
50 Ga0070665_100020327 3300005548 Bacteria 6668
51 Ga0068855_100222779 3300005563 Bacteria 2114
52 Ga0070664_100033995 3300005564 Bacteria 4275
53 Ga0070664_100801117 3300005564 Bacteria 881
54 Ga0068857_100074551 3300005577 Bacteria 3024
55 Ga0068857_100076312 3300005577 Bacteria 2989
56 Ga0068857_100960949 3300005577 Bacteria 821
57 Ga0068852_100004522 3300005616 Bacteria 9840
58 Ga0068852_100075537 3300005616 Bacteria 2973
59 Ga0068859_100048072 3300005617 Bacteria 4285
60 Ga0068859_100112412 3300005617 Bacteria 2787
61 Ga0068859_100437230 3300005617 Bacteria 1404
62 Ga0068864_100058315 3300005618 Bacteria 3336
63 Ga0068866_10068999 3300005718 Bacteria 1861
64 Ga0068861_100369368 3300005719 Unclassified 1264
65 Ga0068861_100895982 3300005719 Bacteria 840
66 Ga0068851_10070426 3300005834 Bacteria 1808
67 Ga0068870_10050376 3300005840 Bacteria 2200
68 Ga0068863_100009683 3300005841 Bacteria 9401
69 Ga0068863_100087180 3300005841 Bacteria 2958
70 Ga0068863_100274815 3300005841 Bacteria 1631
71 Ga0068863_100803969 3300005841 Bacteria 938
72 Ga0068862_100281289 3300005844 Bacteria 1525
73 Ga0068862_101095205 3300005844 Bacteria 791
74 Ga0081539_10025801 3300005985 Unclassified 3769
75 Ga0070715_10138344 3300006163 Bacteria 1180
76 Ga0097621_100005328 3300006237 Bacteria 9056
77 Ga0097621_100040839 3300006237 Bacteria 3731
78 Ga0097621_100099918 3300006237 Bacteria 2440
79 Ga0097621_100187601 3300006237 Bacteria 1789
80 Ga0097621_100322893 3300006237 Bacteria 1368
81 Ga0097621_100888476 3300006237 Bacteria 829
82 Ga0068871_100002623 3300006358 Bacteria 12276
83 Ga0068871_100003060 3300006358 Bacteria 11481
84 Ga0068871_100117365 3300006358 Bacteria 2244
85 Ga0075428_100491736 3300006844 Bacteria 1313
86 Ga0075430_100013464 3300006846 Bacteria 6972
87 Ga0075431_100031956 3300006847 Bacteria 5423
88 Ga0075429_100023258 3300006880 Bacteria 5375
89 Ga0068865_100046602 3300006881 Bacteria 2975
90 Ga0068865_100267176 3300006881 Bacteria 1357
91 Ga0097620_100048071 3300006931 Bacteria 4285
92 Ga0097620_100112414 3300006931 Bacteria 2787
93 Ga0097620_100437203 3300006931 Bacteria 1404
94 Ga0111539_10298322 3300009094 Bacteria 1876
95 Ga0111539_10336846 3300009094 Bacteria 1756
96 Ga0114129_10040254 3300009147 Bacteria 6588
97 Ga0105241_10055619 3300009174 Bacteria 3032
98 Ga0105242_10008487 3300009176 Bacteria 7891
99 Ga0105242_10084008 3300009176 Bacteria 2667
100 Ga0105242_10515925 3300009176 Bacteria 1139
101 Ga0105248_10238209 3300009177 Unclassified 2048
102 Ga0105237_10236416 3300009545 Bacteria 1828
103 Ga0105249_10000793 3300009553 Bacteria 28356
104 Ga0105249_10015473 3300009553 Bacteria 6752
105 Ga0105249_11374511 3300009553 Bacteria 778
106 Ga0105246_10079617 3300011119 Bacteria 2330
107 Ga0105246_10217980 3300011119 Bacteria 1494
108 Ga0105246_10640558 3300011119 Bacteria 924
109 Ga0157373_10102012 3300013100 Bacteria 2019
110 Ga0157371_10024670 3300013102 Bacteria 4388
111 Ga0157371_10059348 3300013102 Bacteria 2712
112 Ga0157371_10454870 3300013102 Bacteria 942
113 Ga0157370_10032729 3300013104 Bacteria 5075
114 Ga0157369_10074444 3300013105 Bacteria 3642
115 Ga0157369_10191191 3300013105 Bacteria 2151
116 Ga0157374_10073767 3300013296 Bacteria 3221
117 Ga0157378_10012677 3300013297 Bacteria 7375
118 Ga0163162_10324674 3300013306 Unclassified 1671
119 Ga0163162_10743220 3300013306 Bacteria 1101
120 Ga0157372_10095381 3300013307 Bacteria 3389
121 Ga0157372_10225698 3300013307 Bacteria 2171
122 Ga0157372_10271219 3300013307 Bacteria 1972
123 Ga0157372_10315634 3300013307 Bacteria 1819
124 Ga0157372_10418417 3300013307 Unclassified 1562
125 Ga0157375_10592705 3300013308 Bacteria 1268
126 Ga0163163_10002472 3300014325 Bacteria 15623
127 Ga0163163_10090458 3300014325 Bacteria 3074
128 Ga0157380_10131808 3300014326 Unclassified 2134
129 Ga0157380_10136582 3300014326 Bacteria 2100
130 Ga0157380_11599326 3300014326 Bacteria 707
131 Ga0157377_10175301 3300014745 Bacteria 1344
132 Ga0157377_10482985 3300014745 Bacteria 862
133 Ga0157379_10139007 3300014968 Bacteria 2189
134 Ga0157376_10298870 3300014969 Bacteria 1523
135 Ga0157376_10739788 3300014969 Bacteria 992
136 Ga0157376_10835676 3300014969 Bacteria 935
137 Ga0163161_10029749 3300017792 Bacteria 3884
138 Ga0163161_10074768 3300017792 Bacteria 2485
139 Ga0163161_10093413 3300017792 Bacteria 2229
140 Ga0163161_10222885 3300017792 Bacteria 1461
141 Ga0163161_10577182 3300017792 Bacteria 924
142 Ga0209130_1002115 3300025284 Bacteria 10566
143 Ga0207426_1000137 3300025302 Bacteria 199010
144 Ga0207656_10033609 3300025321 Bacteria 2137
145 Ga0207682_10016323 3300025893 Bacteria 2896
146 Ga0207642_10191560 3300025899 Bacteria 1122
147 Ga0207680_10033147 3300025903 Bacteria 2943
148 Ga0207647_10000208 3300025904 Bacteria 47976
149 Ga0207647_10251664 3300025904 Bacteria 1013
150 Ga0207645_10000198 3300025907 Bacteria 49061
151 Ga0207645_10249618 3300025907 Bacteria 1174
152 Ga0207705_10095703 3300025909 Bacteria 2179
153 Ga0207660_10008387 3300025917 Bacteria 6684
154 Ga0207657_10258569 3300025919 Bacteria 1386
155 Ga0207649_10036057 3300025920 Bacteria 2976
156 Ga0207652_10141529 3300025921 Bacteria 2151
157 Ga0207646_10255742 3300025922 Unclassified 1583
158 Ga0207681_10178319 3300025923 Bacteria 1616
159 Ga0207681_10360665 3300025923 Bacteria 1166
160 Ga0207650_10095361 3300025925 Unclassified 2281
161 Ga0207650_10308824 3300025925 Bacteria 1293
162 Ga0207650_10536593 3300025925 Bacteria 980
163 Ga0207650_10966564 3300025925 Unclassified 724
164 Ga0207659_10032435 3300025926 Bacteria 3585
165 Ga0207659_10552809 3300025926 Bacteria 979
166 Ga0207659_10599515 3300025926 Bacteria 939
167 Ga0207644_10202147 3300025931 Bacteria 1568
168 Ga0207690_10136075 3300025932 Bacteria 1804
169 Ga0207686_10016163 3300025934 Bacteria 4183
170 Ga0207670_10180505 3300025936 Unclassified 1590
171 Ga0207670_10778402 3300025936 Bacteria 796
172 Ga0207669_10103112 3300025937 Bacteria 1891
173 Ga0207704_10353207 3300025938 Bacteria 1145
174 Ga0207704_10416118 3300025938 Bacteria 1064
175 Ga0207691_10007801 3300025940 Bacteria 10305
176 Ga0207691_10124504 3300025940 Bacteria 2282
177 Ga0207691_10493679 3300025940 Bacteria 1040
178 Ga0207689_10002649 3300025942 Bacteria 16555
179 Ga0207689_10046577 3300025942 Bacteria 3583
180 Ga0207689_10118800 3300025942 Bacteria 2174
181 Ga0207661_10037888 3300025944 Bacteria 3775
182 Ga0207679_10030471 3300025945 Bacteria 3767
183 Ga0207679_10713080 3300025945 Bacteria 911
184 Ga0207667_10009282 3300025949 Bacteria 11607
185 Ga0207651_10056188 3300025960 Bacteria 2708
186 Ga0207651_10056911 3300025960 Bacteria 2694
187 Ga0207712_10001144 3300025961 Bacteria 18474
188 Ga0207712_10056695 3300025961 Bacteria 2761
189 Ga0207712_10400703 3300025961 Bacteria 1153
190 Ga0207668_10212732 3300025972 Unclassified 1547
191 Ga0207658_10217955 3300025986 Unclassified 1604
192 Ga0207677_10164780 3300026023 Bacteria 1726
193 Ga0207677_10736951 3300026023 Bacteria 877
194 Ga0207639_10814865 3300026041 Bacteria 870
195 Ga0207678_10026912 3300026067 Bacteria 5017
196 Ga0207708_10036716 3300026075 Bacteria 3732
197 Ga0207641_10001688 3300026088 Bacteria 21481
198 Ga0207641_10329503 3300026088 Bacteria 1450
199 Ga0207641_10455222 3300026088 Bacteria 1237
200 Ga0207648_10001098 3300026089 Bacteria 30333
201 Ga0207648_10083289 3300026089 Bacteria 2790
202 Ga0207648_10180531 3300026089 Bacteria 1868
203 Ga0207676_10627085 3300026095 Unclassified 1035
204 Ga0207674_10130640 3300026116 Bacteria 2475
205 Ga0207674_10409689 3300026116 Bacteria 1310
206 Ga0207674_10982681 3300026116 Bacteria 813
207 Ga0207675_100056759 3300026118 Bacteria 3652
208 Ga0207675_100272382 3300026118 Unclassified 1643
209 Ga0207683_10005504 3300026121 Bacteria 10855
210 Ga0207683_10075759 3300026121 Bacteria 2979
211 Ga0207683_10547918 3300026121 Bacteria 1069
212 Ga0207698_11265177 3300026142 Bacteria 752
213 Ga0268265_10109219 3300028380 Bacteria 2254
214 Ga0268265_10319064 3300028380 Bacteria 1406
215 Ga0265327_10000219 3300031251 Bacteria 116606
216 Ga0265313_10054388 3300031595 Bacteria 1901
217 Ga0307414_10001096 3300032004 Bacteria 13840
218 Ga0307411_10579973 3300032005 Bacteria 961
219 Ga0373937_0860469 3300036401 Bacteria 855
220 Ga0395900_1251911 3300037418 Unclassified 657
221 Ga0451793_1435008 3300041452 Bacteria 897
222 Ga0451798_1063746 3300041458 Bacteria 1489
223 Ga0451807_0389271 3300041486 Bacteria 2145
224 Ga0439441_013409 3300042001 Bacteria 1421
225 Ga0466972_0138254 3300044658 Bacteria 1147
226 Ga0453684_0528607 3300044712 Bacteria 1302
227 Ga0451576_1093975 3300045051 Bacteria 834
228 Ga0495618_0541799 3300046514 Bacteria 698
229 Ga0495621_0043287 3300046539 Unclassified 1588
230 Ga0495621_0158220 3300046539 Bacteria 895
231 Ga0495686_0130570 3300047472 Bacteria 1490
232 Ga0496104_0091638 3300048907 Bacteria 2906
233 Ga0501031_0039883 3300049568 Bacteria 3065
234 Ga0501032_0022835 3300049569 Bacteria 4333
235 Ga0501033_0313306 3300049570 Bacteria 1103
236 Ga0501034_0062956 3300049571 Bacteria 3724
237 Ga0501034_0210133 3300049571 Bacteria 1901
238 Ga0501034_0758124 3300049571 Bacteria 866
239 Ga0501036_0009447 3300049572 Bacteria 8021
240 Ga0501037_0053547 3300049573 Bacteria 2951
241 Ga0501038_0024681 3300049574 Bacteria 5360
242 Ga0501038_1130009 3300049574 Bacteria 571
243 Ga0501039_0052073 3300049575 Bacteria 3167
244 Ga0501040_0433726 3300049576 Bacteria 945
245 Ga0501043_0059025 3300049579 Bacteria 3010
246 Ga0501047_0192536 3300049581 Bacteria 1902
247 Ga0501047_1294856 3300049581 Bacteria 543
248 Ga0501072_0181683 3300049588 Bacteria 1678
249 Ga0501072_0236468 3300049588 Unclassified 1455
250 Ga0501259_050185 3300049688 Bacteria 845
251 Ga0501219_000072 3300049703 Bacteria 17183
252 Ga0501080_0148846 3300049742 Bacteria 2165
253 Ga0501080_0399209 3300049742 Unclassified 1237
254 Ga0501241_004071 3300049758 Bacteria 2750
255 Ga0501035_0026074 3300049822 Bacteria 5353
256 Ga0501044_0004343 3300049823 Bacteria 15878
257 Ga0501044_0082753 3300049823 Bacteria 3247
258 Ga0501284_00059 3300050005 Bacteria 39196
259 nmdc:mga05p37_613070_c1 3300050507 Bacteria 1226
260 nmdc:mga09592_44385_c1 3300050508 Bacteria 3742
261 nmdc:mga09592_907053_c1 3300050508 Bacteria 740
262 nmdc:mga0qj67_5946_c1 3300050509 Bacteria 8940
263 nmdc:mga06r32_9171_c1 3300050510 Bacteria 8917
264 nmdc:mga08y16_682350_c1 3300050511 Bacteria 1029
265 Ga0500562_000094 3300053108 Bacteria 36637
266 Ga0500616_0054941 3300053153 Bacteria 2084
267 Ga0500622_0000652 3300053156 Bacteria 30940

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049688 Ga0501259_050185 Ga0501259_050185_23_460 145
2 3300046514 Ga0495618_0541799 Ga0495618_0541799_167_625 152
3 3300050507 nmdc:mga05p37_613070_c1 nmdc:mga05p37_613070_c1_691_1152 153
4 3300049574 Ga0501038_1130009 Ga0501038_1130009_75_557 160
5 3300049581 Ga0501047_1294856 Ga0501047_1294856_26_508 160
6 3300005985 Ga0081539_10025801 Ga0081539_100258013 162
7 3300025961 Ga0207712_10400703 Ga0207712_104007031 164
8 3300037418 Ga0395900_1251911 Ga0395900_1251911_47_544 164
9 3300005347 Ga0070668_100031183 Ga0070668_1000311833 165
10 3300005356 Ga0070674_100056375 Ga0070674_1000563753 165
11 3300005459 Ga0068867_100329834 Ga0068867_1003298342 165
12 3300005719 Ga0068861_100895982 Ga0068861_1008959822 165
13 3300006237 Ga0097621_100187601 Ga0097621_1001876012 165
14 3300006881 Ga0068865_100046602 Ga0068865_1000466024 165
15 3300025938 Ga0207704_10416118 Ga0207704_104161182 165
16 3300025942 Ga0207689_10046577 Ga0207689_100465773 165
17 3300025972 Ga0207668_10212732 Ga0207668_102127322 165
18 3300026118 Ga0207675_100056759 Ga0207675_1000567591 165
19 3300005466 Ga0070685_10050704 Ga0070685_100507043 166
20 3300011119 Ga0105246_10640558 Ga0105246_106405582 168
21 3300049570 Ga0501033_0313306 Ga0501033_0313306_459_971 170
22 iso_pu_bacteria 2946013367 2946017168 170
23 3300005535 Ga0070684_101164170 Ga0070684_1011641702 171
24 3300050508 nmdc:mga09592_907053_c1 nmdc:mga09592_907053_c1_177_692 171
25 3300005339 Ga0070660_100244638 Ga0070660_1002446382 172
26 3300005344 Ga0070661_100020017 Ga0070661_1000200173 172
27 3300005366 Ga0070659_100025511 Ga0070659_1000255112 172
28 3300005539 Ga0068853_100284271 Ga0068853_1002842712 172
29 3300005616 Ga0068852_100004522 Ga0068852_10000452211 172
30 3300013105 Ga0157369_10074444 Ga0157369_100744443 172
31 3300013296 Ga0157374_10073767 Ga0157374_100737673 172
32 3300014745 Ga0157377_10175301 Ga0157377_101753011 172
33 3300025904 Ga0207647_10000208 Ga0207647_1000020810 172
34 3300025919 Ga0207657_10258569 Ga0207657_102585692 172
35 3300025920 Ga0207649_10036057 Ga0207649_100360573 172
36 3300025932 Ga0207690_10136075 Ga0207690_101360752 172
37 3300026041 Ga0207639_10814865 Ga0207639_108148651 172
38 3300026142 Ga0207698_11265177 Ga0207698_112651772 172
39 3300005329 Ga0070683_100011519 Ga0070683_1000115196 173
40 3300005331 Ga0070670_100074075 Ga0070670_1000740753 173
41 3300005344 Ga0070661_100473781 Ga0070661_1004737813 173
42 3300005355 Ga0070671_100159642 Ga0070671_1001596421 173
43 3300005539 Ga0068853_100320819 Ga0068853_1003208192 173
44 3300005564 Ga0070664_100033995 Ga0070664_1000339953 173
45 3300005564 Ga0070664_100801117 Ga0070664_1008011172 173
46 3300005834 Ga0068851_10070426 Ga0068851_100704262 173
47 3300006237 Ga0097621_100888476 Ga0097621_1008884761 173
48 3300013307 Ga0157372_10315634 Ga0157372_103156341 173
49 3300014325 Ga0163163_10002472 Ga0163163_1000247216 173
50 3300014969 Ga0157376_10739788 Ga0157376_107397882 173
51 3300025925 Ga0207650_10308824 Ga0207650_103088242 173
52 3300025926 Ga0207659_10552809 Ga0207659_105528091 173
53 3300025931 Ga0207644_10202147 Ga0207644_102021471 173
54 3300025944 Ga0207661_10037888 Ga0207661_100378885 173
55 3300025945 Ga0207679_10030471 Ga0207679_100304713 173
56 3300025945 Ga0207679_10713080 Ga0207679_107130802 173
57 3300026023 Ga0207677_10164780 Ga0207677_101647801 173
58 3300026095 Ga0207676_10627085 Ga0207676_106270851 173
59 3300009545 Ga0105237_10236416 Ga0105237_102364163 174
60 3300013102 Ga0157371_10024670 Ga0157371_100246703 174
61 3300013307 Ga0157372_10095381 Ga0157372_100953812 174
62 3300013307 Ga0157372_10271219 Ga0157372_102712191 174
63 3300013307 Ga0157372_10418417 Ga0157372_104184172 174
64 iso_pu_bacteria 2929177148 2929181040 175
65 iso_pu_bacteria 2945977869 2945983441 175
66 iso_pu_bacteria 2818991460 2819678262 176
67 3300025284 Ga0209130_1002115 Ga0209130_10021159 178
68 3300025302 Ga0207426_1000137 Ga0207426_100013731 178
69 3300049571 Ga0501034_0210133 Ga0501034_0210133_136_675 178
70 3300049576 Ga0501040_0433726 Ga0501040_0433726_72_611 178
71 3300005456 Ga0070678_100252185 Ga0070678_1002521852 179
72 3300005459 Ga0068867_100092510 Ga0068867_1000925101 179
73 3300005577 Ga0068857_100076312 Ga0068857_1000763122 179
74 3300006237 Ga0097621_100005328 Ga0097621_1000053285 179
75 3300006358 Ga0068871_100003060 Ga0068871_1000030602 179
76 3300013102 Ga0157371_10454870 Ga0157371_104548702 179
77 3300013297 Ga0157378_10012677 Ga0157378_100126778 179
78 3300013306 Ga0163162_10324674 Ga0163162_103246742 179
79 3300017792 Ga0163161_10093413 Ga0163161_100934133 179
80 3300025907 Ga0207645_10249618 Ga0207645_102496182 179
81 3300026089 Ga0207648_10180531 Ga0207648_101805312 179
82 3300026116 Ga0207674_10409689 Ga0207674_104096892 179
83 3300026121 Ga0207683_10547918 Ga0207683_105479182 179
84 3300041458 Ga0451798_1063746 Ga0451798_1063746_423_962 179
85 3300048907 Ga0496104_0091638 Ga0496104_0091638_1991_2530 179
86 3300005471 Ga0070698_100009662 Ga0070698_1000096626 180
87 3300031251 Ga0265327_10000219 Ga0265327_1000021945 180
88 3300049571 Ga0501034_0062956 Ga0501034_0062956_2919_3470 180
89 3300049823 Ga0501044_0082753 Ga0501044_0082753_1661_2212 180
90 3300005327 Ga0070658_10233036 Ga0070658_102330362 181
91 3300005331 Ga0070670_100169832 Ga0070670_1001698322 181
92 3300005336 Ga0070680_100010184 Ga0070680_1000101843 181
93 3300005337 Ga0070682_100000306 Ga0070682_10000030628 181
94 3300005340 Ga0070689_100225913 Ga0070689_1002259131 181
95 3300005354 Ga0070675_100495487 Ga0070675_1004954872 181
96 3300005364 Ga0070673_100096124 Ga0070673_1000961242 181
97 3300005364 Ga0070673_100190746 Ga0070673_1001907463 181
98 3300005365 Ga0070688_100010004 Ga0070688_1000100042 181
99 3300005455 Ga0070663_100116798 Ga0070663_1001167982 181
100 3300005455 Ga0070663_100482546 Ga0070663_1004825462 181
101 3300005456 Ga0070678_100011522 Ga0070678_1000115226 181
102 3300005466 Ga0070685_10064140 Ga0070685_100641401 181
103 3300005466 Ga0070685_10131671 Ga0070685_101316711 181
104 3300005466 Ga0070685_10314398 Ga0070685_103143981 181
105 3300005530 Ga0070679_100186555 Ga0070679_1001865552 181
106 3300005539 Ga0068853_100098518 Ga0068853_1000985182 181
107 3300005543 Ga0070672_100184079 Ga0070672_1001840791 181
108 3300005544 Ga0070686_100419704 Ga0070686_1004197042 181
109 3300005548 Ga0070665_100020327 Ga0070665_1000203273 181
110 3300005563 Ga0068855_100222779 Ga0068855_1002227792 181
111 3300005617 Ga0068859_100048072 Ga0068859_1000480723 181
112 3300005617 Ga0068859_100112412 Ga0068859_1001124124 181
113 3300005617 Ga0068859_100437230 Ga0068859_1004372301 181
114 3300005718 Ga0068866_10068999 Ga0068866_100689992 181
115 3300005840 Ga0068870_10050376 Ga0068870_100503763 181
116 3300005841 Ga0068863_100009683 Ga0068863_1000096833 181
117 3300005841 Ga0068863_100087180 Ga0068863_1000871802 181
118 3300005841 Ga0068863_100274815 Ga0068863_1002748152 181
119 3300005841 Ga0068863_100803969 Ga0068863_1008039691 181
120 3300005844 Ga0068862_100281289 Ga0068862_1002812892 181
121 3300005844 Ga0068862_101095205 Ga0068862_1010952052 181
122 3300006163 Ga0070715_10138344 Ga0070715_101383442 181
123 3300006237 Ga0097621_100040839 Ga0097621_1000408393 181
124 3300006237 Ga0097621_100099918 Ga0097621_1000999183 181
125 3300006237 Ga0097621_100322893 Ga0097621_1003228931 181
126 3300006358 Ga0068871_100002623 Ga0068871_1000026237 181
127 3300006358 Ga0068871_100117365 Ga0068871_1001173652 181
128 3300006881 Ga0068865_100267176 Ga0068865_1002671762 181
129 3300006931 Ga0097620_100048071 Ga0097620_1000480713 181
130 3300006931 Ga0097620_100112414 Ga0097620_1001124144 181
131 3300006931 Ga0097620_100437203 Ga0097620_1004372031 181
132 3300009094 Ga0111539_10298322 Ga0111539_102983222 181
133 3300009094 Ga0111539_10336846 Ga0111539_103368463 181
134 3300009174 Ga0105241_10055619 Ga0105241_100556193 181
135 3300009176 Ga0105242_10008487 Ga0105242_100084873 181
136 3300009176 Ga0105242_10084008 Ga0105242_100840082 181
137 3300009176 Ga0105242_10515925 Ga0105242_105159252 181
138 3300009553 Ga0105249_10000793 Ga0105249_1000079318 181
139 3300009553 Ga0105249_11374511 Ga0105249_113745112 181
140 3300011119 Ga0105246_10079617 Ga0105246_100796173 181
141 3300011119 Ga0105246_10217980 Ga0105246_102179802 181
142 3300013102 Ga0157371_10059348 Ga0157371_100593483 181
143 3300013104 Ga0157370_10032729 Ga0157370_100327294 181
144 3300013105 Ga0157369_10191191 Ga0157369_101911913 181
145 3300013306 Ga0163162_10743220 Ga0163162_107432202 181
146 3300013307 Ga0157372_10225698 Ga0157372_102256983 181
147 3300013308 Ga0157375_10592705 Ga0157375_105927051 181
148 3300014325 Ga0163163_10090458 Ga0163163_100904583 181
149 3300014326 Ga0157380_10131808 Ga0157380_101318082 181
150 3300014326 Ga0157380_10136582 Ga0157380_101365823 181
151 3300014326 Ga0157380_11599326 Ga0157380_115993261 181
152 3300014745 Ga0157377_10482985 Ga0157377_104829851 181
153 3300014968 Ga0157379_10139007 Ga0157379_101390072 181
154 3300014969 Ga0157376_10298870 Ga0157376_102988702 181
155 3300014969 Ga0157376_10835676 Ga0157376_108356761 181
156 3300017792 Ga0163161_10074768 Ga0163161_100747682 181
157 3300017792 Ga0163161_10222885 Ga0163161_102228851 181
158 3300017792 Ga0163161_10577182 Ga0163161_105771822 181
159 3300025321 Ga0207656_10033609 Ga0207656_100336092 181
160 3300025893 Ga0207682_10016323 Ga0207682_100163232 181
161 3300025899 Ga0207642_10191560 Ga0207642_101915602 181
162 3300025903 Ga0207680_10033147 Ga0207680_100331473 181
163 3300025904 Ga0207647_10251664 Ga0207647_102516642 181
164 3300025907 Ga0207645_10000198 Ga0207645_1000019831 181
165 3300025909 Ga0207705_10095703 Ga0207705_100957032 181
166 3300025917 Ga0207660_10008387 Ga0207660_100083876 181
167 3300025921 Ga0207652_10141529 Ga0207652_101415292 181
168 3300025923 Ga0207681_10178319 Ga0207681_101783192 181
169 3300025925 Ga0207650_10095361 Ga0207650_100953614 181
170 3300025925 Ga0207650_10536593 Ga0207650_105365932 181
171 3300025925 Ga0207650_10966564 Ga0207650_109665641 181
172 3300025926 Ga0207659_10032435 Ga0207659_100324352 181
173 3300025934 Ga0207686_10016163 Ga0207686_100161633 181
174 3300025936 Ga0207670_10778402 Ga0207670_107784021 181
175 3300025937 Ga0207669_10103112 Ga0207669_101031122 181
176 3300025938 Ga0207704_10353207 Ga0207704_103532072 181
177 3300025940 Ga0207691_10007801 Ga0207691_1000780110 181
178 3300025940 Ga0207691_10124504 Ga0207691_101245042 181
179 3300025940 Ga0207691_10493679 Ga0207691_104936792 181
180 3300025942 Ga0207689_10002649 Ga0207689_100026493 181
181 3300025942 Ga0207689_10118800 Ga0207689_101188004 181
182 3300025949 Ga0207667_10009282 Ga0207667_100092827 181
183 3300025960 Ga0207651_10056188 Ga0207651_100561883 181
184 3300025960 Ga0207651_10056911 Ga0207651_100569113 181
185 3300025961 Ga0207712_10001144 Ga0207712_1000114415 181
186 3300025986 Ga0207658_10217955 Ga0207658_102179553 181
187 3300026023 Ga0207677_10736951 Ga0207677_107369511 181
188 3300026067 Ga0207678_10026912 Ga0207678_100269124 181
189 3300026088 Ga0207641_10001688 Ga0207641_100016886 181
190 3300026088 Ga0207641_10329503 Ga0207641_103295031 181
191 3300026088 Ga0207641_10455222 Ga0207641_104552221 181
192 3300026089 Ga0207648_10001098 Ga0207648_100010986 181
193 3300026089 Ga0207648_10083289 Ga0207648_100832892 181
194 3300026121 Ga0207683_10005504 Ga0207683_100055044 181
195 3300026121 Ga0207683_10075759 Ga0207683_100757593 181
196 3300028380 Ga0268265_10109219 Ga0268265_101092192 181
197 3300028380 Ga0268265_10319064 Ga0268265_103190642 181
198 3300041452 Ga0451793_1435008 Ga0451793_1435008_189_734 181
199 3300041486 Ga0451807_0389271 Ga0451807_0389271_165_710 181
200 3300044658 Ga0466972_0138254 Ga0466972_0138254_119_664 181
201 3300044712 Ga0453684_0528607 Ga0453684_0528607_517_1071 181
202 3300045051 Ga0451576_1093975 Ga0451576_1093975_270_824 181
203 3300046539 Ga0495621_0043287 Ga0495621_0043287_188_733 181
204 3300046539 Ga0495621_0158220 Ga0495621_0158220_260_805 181
205 3300050511 nmdc:mga08y16_682350_c1 nmdc:mga08y16_682350_c1_196_741 181
206 3300005338 Ga0068868_101149289 Ga0068868_1011492891 182
207 3300005444 Ga0070694_100989064 Ga0070694_1009890641 182
208 3300005471 Ga0070698_100000392 Ga0070698_1000003924 182
209 3300005471 Ga0070698_100228023 Ga0070698_1002280232 182
210 3300005518 Ga0070699_100265266 Ga0070699_1002652663 182
211 3300025922 Ga0207646_10255742 Ga0207646_102557423 182
212 3300036401 Ga0373937_0860469 Ga0373937_0860469_153_701 182
213 3300047472 Ga0495686_0130570 Ga0495686_0130570_186_737 182
214 3300049568 Ga0501031_0039883 Ga0501031_0039883_1066_1617 182
215 3300049569 Ga0501032_0022835 Ga0501032_0022835_201_752 182
216 3300049571 Ga0501034_0758124 Ga0501034_0758124_139_687 182
217 3300049572 Ga0501036_0009447 Ga0501036_0009447_7259_7810 182
218 3300049573 Ga0501037_0053547 Ga0501037_0053547_212_763 182
219 3300049574 Ga0501038_0024681 Ga0501038_0024681_1385_1936 182
220 3300049575 Ga0501039_0052073 Ga0501039_0052073_2234_2785 182
221 3300049579 Ga0501043_0059025 Ga0501043_0059025_2013_2564 182
222 3300049581 Ga0501047_0192536 Ga0501047_0192536_93_644 182
223 3300049588 Ga0501072_0181683 Ga0501072_0181683_36_587 182
224 3300049742 Ga0501080_0148846 Ga0501080_0148846_204_755 182
225 3300049822 Ga0501035_0026074 Ga0501035_0026074_2323_2874 182
226 3300049823 Ga0501044_0004343 Ga0501044_0004343_14894_15445 182
227 3300053108 Ga0500562_000094 Ga0500562_000094_4575_5129 182
228 3300053153 Ga0500616_0054941 Ga0500616_0054941_1025_1579 182
229 3300053156 Ga0500622_0000652 Ga0500622_0000652_25666_26217 182
230 3300005290 Ga0065712_10002201 Ga0065712_100022017 183
231 3300005365 Ga0070688_100059275 Ga0070688_1000592751 183
232 3300005441 Ga0070700_100055925 Ga0070700_1000559252 183
233 3300005468 Ga0070707_100104556 Ga0070707_1001045563 183
234 3300005471 Ga0070698_100018803 Ga0070698_1000188038 183
235 3300005544 Ga0070686_100107009 Ga0070686_1001070092 183
236 3300005577 Ga0068857_100074551 Ga0068857_1000745513 183
237 3300005577 Ga0068857_100960949 Ga0068857_1009609491 183
238 3300005616 Ga0068852_100075537 Ga0068852_1000755376 183
239 3300005618 Ga0068864_100058315 Ga0068864_1000583152 183
240 3300005719 Ga0068861_100369368 Ga0068861_1003693682 183
241 3300006844 Ga0075428_100491736 Ga0075428_1004917361 183
242 3300006846 Ga0075430_100013464 Ga0075430_1000134643 183
243 3300006847 Ga0075431_100031956 Ga0075431_1000319566 183
244 3300006880 Ga0075429_100023258 Ga0075429_1000232587 183
245 3300009147 Ga0114129_10040254 Ga0114129_100402546 183
246 3300009177 Ga0105248_10238209 Ga0105248_102382094 183
247 3300009553 Ga0105249_10015473 Ga0105249_100154733 183
248 3300017792 Ga0163161_10029749 Ga0163161_100297496 183
249 3300025923 Ga0207681_10360665 Ga0207681_103606652 183
250 3300025926 Ga0207659_10599515 Ga0207659_105995152 183
251 3300025936 Ga0207670_10180505 Ga0207670_101805053 183
252 3300025961 Ga0207712_10056695 Ga0207712_100566953 183
253 3300026075 Ga0207708_10036716 Ga0207708_100367166 183
254 3300026116 Ga0207674_10130640 Ga0207674_101306403 183
255 3300026116 Ga0207674_10982681 Ga0207674_109826812 183
256 3300026118 Ga0207675_100272382 Ga0207675_1002723822 183
257 3300031595 Ga0265313_10054388 Ga0265313_100543882 183
258 3300042001 Ga0439441_013409 Ga0439441_013409_218_769 183
259 3300050508 nmdc:mga09592_44385_c1 nmdc:mga09592_44385_c1_590_1141 183
260 3300050509 nmdc:mga0qj67_5946_c1 nmdc:mga0qj67_5946_c1_3480_4031 183
261 3300050510 nmdc:mga06r32_9171_c1 nmdc:mga06r32_9171_c1_4872_5423 183
262 3300005340 Ga0070689_100963148 Ga0070689_1009631481 184
263 3300032005 Ga0307411_10579973 Ga0307411_105799732 184
264 3300049588 Ga0501072_0236468 Ga0501072_0236468_836_1393 184
265 3300049703 Ga0501219_000072 Ga0501219_000072_9134_9694 184
266 3300049742 Ga0501080_0399209 Ga0501080_0399209_382_939 184
267 3300049758 Ga0501241_004071 Ga0501241_004071_1500_2060 184
268 3300050005 Ga0501284_00059 Ga0501284_00059_9620_10180 184
269 3300005288 Ga0065714_10095965 Ga0065714_100959652 185
270 3300013100 Ga0157373_10102012 Ga0157373_101020122 185
271 3300032004 Ga0307414_10001096 Ga0307414_100010968 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13098

Thioredoxin_2

Thioredoxin-like domain

47

137

0.82

PF13899

Thioredoxin_7

Thioredoxin-like

37

129

0.76

PF00085

Thioredoxin

Thioredoxin

37

102

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fk8-assembly1.cif.gz_A the crystal structure of disulphide isomerase from xylella fastidiosa temecula1 0.8403 20 128
7bzk-assembly1.cif.gz_B crystal structure of ferredoxin: thioredoxin reductase and thioredoxin y1 complex 0.7857 26 128
4kca-assembly2.cif.gz_B crystal structure of endo-1,5-alpha-l-arabinanase from a bovine ruminal metagenomic library 0.7806 24 128
7ysi-assembly1.cif.gz_A crystal structure of thioredoxin 2 0.7764 44 128
4pob-assembly1.cif.gz_B crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus 0.756 24 128
ID Description Score Start End Superfamily
af_O17657_141_389_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.8554 153 184 1.10.565.10
af_O44668_157_360_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.8508 152 184 1.10.565.10
af_Q9NAJ2_47_214_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.8473 152 182 1.10.565.10
3fk8A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8403 20 128 3.40.30.10
af_Q2G203_11_180_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8195 44 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1V9FYL3-F1-model_v4 Thioredoxin domain-containing protein 0.9837 21 180
AF-A0A537JEZ1-F1-model_v4 Thioredoxin family protein 0.9833 20 181
AF-A0A4V2TP26-F1-model_v4 deleted 0.9822 21 181
AF-A0A4Y4M693-F1-model_v4 Thioredoxin domain-containing protein 0.9811 20 179
AF-A0A848FSC0-F1-model_v4 Thioredoxin family protein 0.9801 20 181

Feature Viewer

pLDDT pTM Quality
92.57 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map