F377534
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 271 | 170 | 267 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100960949|Ga0068857_1009609491 |
| Length | 192 |
| Sequence | MYRSVLLGLSALLLFSISHAQNSIDTKSISASPLPADAVVQNACRQAAKENKRVLVMFHASWCGWCHRMDSSLNDNSCKKFFDDNYVIAHLVVMESKGKENLENPGGMDLLAKFNGVNQGIPFWVVMDKDGKVLADCLAKPEGAGSEVKGQNVGCPASENEVNFFIKVLKQTSKLSPEQEAAIVKRFRKNEH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 2 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 3 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 4 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 136 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 157 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 160 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 163 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 169 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 170 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.52 |
| Metatranscriptomes | 0 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 95.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10095965 | 3300005288 | Bacteria | 1772 |
| 2 | Ga0065712_10002201 | 3300005290 | Bacteria | 4932 |
| 3 | Ga0070658_10233036 | 3300005327 | Bacteria | 1559 |
| 4 | Ga0070683_100011519 | 3300005329 | Bacteria | 7650 |
| 5 | Ga0070670_100074075 | 3300005331 | Bacteria | 2924 |
| 6 | Ga0070670_100169832 | 3300005331 | Bacteria | 1891 |
| 7 | Ga0070680_100010184 | 3300005336 | Bacteria | 7250 |
| 8 | Ga0070682_100000306 | 3300005337 | Bacteria | 34011 |
| 9 | Ga0068868_101149289 | 3300005338 | Bacteria | 716 |
| 10 | Ga0070660_100244638 | 3300005339 | Bacteria | 1462 |
| 11 | Ga0070689_100225913 | 3300005340 | Bacteria | 1537 |
| 12 | Ga0070689_100963148 | 3300005340 | Bacteria | 757 |
| 13 | Ga0070661_100020017 | 3300005344 | Bacteria | 4770 |
| 14 | Ga0070661_100473781 | 3300005344 | Bacteria | 999 |
| 15 | Ga0070668_100031183 | 3300005347 | Unclassified | 4055 |
| 16 | Ga0070675_100495487 | 3300005354 | Bacteria | 1100 |
| 17 | Ga0070671_100159642 | 3300005355 | Bacteria | 1906 |
| 18 | Ga0070674_100056375 | 3300005356 | Bacteria | 2725 |
| 19 | Ga0070673_100096124 | 3300005364 | Bacteria | 2431 |
| 20 | Ga0070673_100190746 | 3300005364 | Bacteria | 1760 |
| 21 | Ga0070688_100010004 | 3300005365 | Bacteria | 5210 |
| 22 | Ga0070688_100059275 | 3300005365 | Bacteria | 2413 |
| 23 | Ga0070659_100025511 | 3300005366 | Bacteria | 4541 |
| 24 | Ga0070700_100055925 | 3300005441 | Unclassified | 2472 |
| 25 | Ga0070694_100989064 | 3300005444 | Unclassified | 698 |
| 26 | Ga0070663_100116798 | 3300005455 | Bacteria | 2011 |
| 27 | Ga0070663_100482546 | 3300005455 | Bacteria | 1026 |
| 28 | Ga0070678_100011522 | 3300005456 | Bacteria | 5462 |
| 29 | Ga0070678_100252185 | 3300005456 | Unclassified | 1480 |
| 30 | Ga0068867_100092510 | 3300005459 | Bacteria | 2297 |
| 31 | Ga0068867_100329834 | 3300005459 | Bacteria | 1267 |
| 32 | Ga0070685_10050704 | 3300005466 | Unclassified | 2398 |
| 33 | Ga0070685_10064140 | 3300005466 | Bacteria | 2159 |
| 34 | Ga0070685_10131671 | 3300005466 | Bacteria | 1564 |
| 35 | Ga0070685_10314398 | 3300005466 | Bacteria | 1059 |
| 36 | Ga0070707_100104556 | 3300005468 | Bacteria | 2745 |
| 37 | Ga0070698_100000392 | 3300005471 | Bacteria | 46091 |
| 38 | Ga0070698_100009662 | 3300005471 | Bacteria | 10319 |
| 39 | Ga0070698_100018803 | 3300005471 | Bacteria | 7270 |
| 40 | Ga0070698_100228023 | 3300005471 | Unclassified | 1796 |
| 41 | Ga0070699_100265266 | 3300005518 | Bacteria | 1536 |
| 42 | Ga0070679_100186555 | 3300005530 | Bacteria | 2044 |
| 43 | Ga0070684_101164170 | 3300005535 | Viruses | 725 |
| 44 | Ga0068853_100098518 | 3300005539 | Bacteria | 2582 |
| 45 | Ga0068853_100284271 | 3300005539 | Bacteria | 1525 |
| 46 | Ga0068853_100320819 | 3300005539 | Bacteria | 1436 |
| 47 | Ga0070672_100184079 | 3300005543 | Bacteria | 1741 |
| 48 | Ga0070686_100107009 | 3300005544 | Unclassified | 1899 |
| 49 | Ga0070686_100419704 | 3300005544 | Bacteria | 1022 |
| 50 | Ga0070665_100020327 | 3300005548 | Bacteria | 6668 |
| 51 | Ga0068855_100222779 | 3300005563 | Bacteria | 2114 |
| 52 | Ga0070664_100033995 | 3300005564 | Bacteria | 4275 |
| 53 | Ga0070664_100801117 | 3300005564 | Bacteria | 881 |
| 54 | Ga0068857_100074551 | 3300005577 | Bacteria | 3024 |
| 55 | Ga0068857_100076312 | 3300005577 | Bacteria | 2989 |
| 56 | Ga0068857_100960949 | 3300005577 | Bacteria | 821 |
| 57 | Ga0068852_100004522 | 3300005616 | Bacteria | 9840 |
| 58 | Ga0068852_100075537 | 3300005616 | Bacteria | 2973 |
| 59 | Ga0068859_100048072 | 3300005617 | Bacteria | 4285 |
| 60 | Ga0068859_100112412 | 3300005617 | Bacteria | 2787 |
| 61 | Ga0068859_100437230 | 3300005617 | Bacteria | 1404 |
| 62 | Ga0068864_100058315 | 3300005618 | Bacteria | 3336 |
| 63 | Ga0068866_10068999 | 3300005718 | Bacteria | 1861 |
| 64 | Ga0068861_100369368 | 3300005719 | Unclassified | 1264 |
| 65 | Ga0068861_100895982 | 3300005719 | Bacteria | 840 |
| 66 | Ga0068851_10070426 | 3300005834 | Bacteria | 1808 |
| 67 | Ga0068870_10050376 | 3300005840 | Bacteria | 2200 |
| 68 | Ga0068863_100009683 | 3300005841 | Bacteria | 9401 |
| 69 | Ga0068863_100087180 | 3300005841 | Bacteria | 2958 |
| 70 | Ga0068863_100274815 | 3300005841 | Bacteria | 1631 |
| 71 | Ga0068863_100803969 | 3300005841 | Bacteria | 938 |
| 72 | Ga0068862_100281289 | 3300005844 | Bacteria | 1525 |
| 73 | Ga0068862_101095205 | 3300005844 | Bacteria | 791 |
| 74 | Ga0081539_10025801 | 3300005985 | Unclassified | 3769 |
| 75 | Ga0070715_10138344 | 3300006163 | Bacteria | 1180 |
| 76 | Ga0097621_100005328 | 3300006237 | Bacteria | 9056 |
| 77 | Ga0097621_100040839 | 3300006237 | Bacteria | 3731 |
| 78 | Ga0097621_100099918 | 3300006237 | Bacteria | 2440 |
| 79 | Ga0097621_100187601 | 3300006237 | Bacteria | 1789 |
| 80 | Ga0097621_100322893 | 3300006237 | Bacteria | 1368 |
| 81 | Ga0097621_100888476 | 3300006237 | Bacteria | 829 |
| 82 | Ga0068871_100002623 | 3300006358 | Bacteria | 12276 |
| 83 | Ga0068871_100003060 | 3300006358 | Bacteria | 11481 |
| 84 | Ga0068871_100117365 | 3300006358 | Bacteria | 2244 |
| 85 | Ga0075428_100491736 | 3300006844 | Bacteria | 1313 |
| 86 | Ga0075430_100013464 | 3300006846 | Bacteria | 6972 |
| 87 | Ga0075431_100031956 | 3300006847 | Bacteria | 5423 |
| 88 | Ga0075429_100023258 | 3300006880 | Bacteria | 5375 |
| 89 | Ga0068865_100046602 | 3300006881 | Bacteria | 2975 |
| 90 | Ga0068865_100267176 | 3300006881 | Bacteria | 1357 |
| 91 | Ga0097620_100048071 | 3300006931 | Bacteria | 4285 |
| 92 | Ga0097620_100112414 | 3300006931 | Bacteria | 2787 |
| 93 | Ga0097620_100437203 | 3300006931 | Bacteria | 1404 |
| 94 | Ga0111539_10298322 | 3300009094 | Bacteria | 1876 |
| 95 | Ga0111539_10336846 | 3300009094 | Bacteria | 1756 |
| 96 | Ga0114129_10040254 | 3300009147 | Bacteria | 6588 |
| 97 | Ga0105241_10055619 | 3300009174 | Bacteria | 3032 |
| 98 | Ga0105242_10008487 | 3300009176 | Bacteria | 7891 |
| 99 | Ga0105242_10084008 | 3300009176 | Bacteria | 2667 |
| 100 | Ga0105242_10515925 | 3300009176 | Bacteria | 1139 |
| 101 | Ga0105248_10238209 | 3300009177 | Unclassified | 2048 |
| 102 | Ga0105237_10236416 | 3300009545 | Bacteria | 1828 |
| 103 | Ga0105249_10000793 | 3300009553 | Bacteria | 28356 |
| 104 | Ga0105249_10015473 | 3300009553 | Bacteria | 6752 |
| 105 | Ga0105249_11374511 | 3300009553 | Bacteria | 778 |
| 106 | Ga0105246_10079617 | 3300011119 | Bacteria | 2330 |
| 107 | Ga0105246_10217980 | 3300011119 | Bacteria | 1494 |
| 108 | Ga0105246_10640558 | 3300011119 | Bacteria | 924 |
| 109 | Ga0157373_10102012 | 3300013100 | Bacteria | 2019 |
| 110 | Ga0157371_10024670 | 3300013102 | Bacteria | 4388 |
| 111 | Ga0157371_10059348 | 3300013102 | Bacteria | 2712 |
| 112 | Ga0157371_10454870 | 3300013102 | Bacteria | 942 |
| 113 | Ga0157370_10032729 | 3300013104 | Bacteria | 5075 |
| 114 | Ga0157369_10074444 | 3300013105 | Bacteria | 3642 |
| 115 | Ga0157369_10191191 | 3300013105 | Bacteria | 2151 |
| 116 | Ga0157374_10073767 | 3300013296 | Bacteria | 3221 |
| 117 | Ga0157378_10012677 | 3300013297 | Bacteria | 7375 |
| 118 | Ga0163162_10324674 | 3300013306 | Unclassified | 1671 |
| 119 | Ga0163162_10743220 | 3300013306 | Bacteria | 1101 |
| 120 | Ga0157372_10095381 | 3300013307 | Bacteria | 3389 |
| 121 | Ga0157372_10225698 | 3300013307 | Bacteria | 2171 |
| 122 | Ga0157372_10271219 | 3300013307 | Bacteria | 1972 |
| 123 | Ga0157372_10315634 | 3300013307 | Bacteria | 1819 |
| 124 | Ga0157372_10418417 | 3300013307 | Unclassified | 1562 |
| 125 | Ga0157375_10592705 | 3300013308 | Bacteria | 1268 |
| 126 | Ga0163163_10002472 | 3300014325 | Bacteria | 15623 |
| 127 | Ga0163163_10090458 | 3300014325 | Bacteria | 3074 |
| 128 | Ga0157380_10131808 | 3300014326 | Unclassified | 2134 |
| 129 | Ga0157380_10136582 | 3300014326 | Bacteria | 2100 |
| 130 | Ga0157380_11599326 | 3300014326 | Bacteria | 707 |
| 131 | Ga0157377_10175301 | 3300014745 | Bacteria | 1344 |
| 132 | Ga0157377_10482985 | 3300014745 | Bacteria | 862 |
| 133 | Ga0157379_10139007 | 3300014968 | Bacteria | 2189 |
| 134 | Ga0157376_10298870 | 3300014969 | Bacteria | 1523 |
| 135 | Ga0157376_10739788 | 3300014969 | Bacteria | 992 |
| 136 | Ga0157376_10835676 | 3300014969 | Bacteria | 935 |
| 137 | Ga0163161_10029749 | 3300017792 | Bacteria | 3884 |
| 138 | Ga0163161_10074768 | 3300017792 | Bacteria | 2485 |
| 139 | Ga0163161_10093413 | 3300017792 | Bacteria | 2229 |
| 140 | Ga0163161_10222885 | 3300017792 | Bacteria | 1461 |
| 141 | Ga0163161_10577182 | 3300017792 | Bacteria | 924 |
| 142 | Ga0209130_1002115 | 3300025284 | Bacteria | 10566 |
| 143 | Ga0207426_1000137 | 3300025302 | Bacteria | 199010 |
| 144 | Ga0207656_10033609 | 3300025321 | Bacteria | 2137 |
| 145 | Ga0207682_10016323 | 3300025893 | Bacteria | 2896 |
| 146 | Ga0207642_10191560 | 3300025899 | Bacteria | 1122 |
| 147 | Ga0207680_10033147 | 3300025903 | Bacteria | 2943 |
| 148 | Ga0207647_10000208 | 3300025904 | Bacteria | 47976 |
| 149 | Ga0207647_10251664 | 3300025904 | Bacteria | 1013 |
| 150 | Ga0207645_10000198 | 3300025907 | Bacteria | 49061 |
| 151 | Ga0207645_10249618 | 3300025907 | Bacteria | 1174 |
| 152 | Ga0207705_10095703 | 3300025909 | Bacteria | 2179 |
| 153 | Ga0207660_10008387 | 3300025917 | Bacteria | 6684 |
| 154 | Ga0207657_10258569 | 3300025919 | Bacteria | 1386 |
| 155 | Ga0207649_10036057 | 3300025920 | Bacteria | 2976 |
| 156 | Ga0207652_10141529 | 3300025921 | Bacteria | 2151 |
| 157 | Ga0207646_10255742 | 3300025922 | Unclassified | 1583 |
| 158 | Ga0207681_10178319 | 3300025923 | Bacteria | 1616 |
| 159 | Ga0207681_10360665 | 3300025923 | Bacteria | 1166 |
| 160 | Ga0207650_10095361 | 3300025925 | Unclassified | 2281 |
| 161 | Ga0207650_10308824 | 3300025925 | Bacteria | 1293 |
| 162 | Ga0207650_10536593 | 3300025925 | Bacteria | 980 |
| 163 | Ga0207650_10966564 | 3300025925 | Unclassified | 724 |
| 164 | Ga0207659_10032435 | 3300025926 | Bacteria | 3585 |
| 165 | Ga0207659_10552809 | 3300025926 | Bacteria | 979 |
| 166 | Ga0207659_10599515 | 3300025926 | Bacteria | 939 |
| 167 | Ga0207644_10202147 | 3300025931 | Bacteria | 1568 |
| 168 | Ga0207690_10136075 | 3300025932 | Bacteria | 1804 |
| 169 | Ga0207686_10016163 | 3300025934 | Bacteria | 4183 |
| 170 | Ga0207670_10180505 | 3300025936 | Unclassified | 1590 |
| 171 | Ga0207670_10778402 | 3300025936 | Bacteria | 796 |
| 172 | Ga0207669_10103112 | 3300025937 | Bacteria | 1891 |
| 173 | Ga0207704_10353207 | 3300025938 | Bacteria | 1145 |
| 174 | Ga0207704_10416118 | 3300025938 | Bacteria | 1064 |
| 175 | Ga0207691_10007801 | 3300025940 | Bacteria | 10305 |
| 176 | Ga0207691_10124504 | 3300025940 | Bacteria | 2282 |
| 177 | Ga0207691_10493679 | 3300025940 | Bacteria | 1040 |
| 178 | Ga0207689_10002649 | 3300025942 | Bacteria | 16555 |
| 179 | Ga0207689_10046577 | 3300025942 | Bacteria | 3583 |
| 180 | Ga0207689_10118800 | 3300025942 | Bacteria | 2174 |
| 181 | Ga0207661_10037888 | 3300025944 | Bacteria | 3775 |
| 182 | Ga0207679_10030471 | 3300025945 | Bacteria | 3767 |
| 183 | Ga0207679_10713080 | 3300025945 | Bacteria | 911 |
| 184 | Ga0207667_10009282 | 3300025949 | Bacteria | 11607 |
| 185 | Ga0207651_10056188 | 3300025960 | Bacteria | 2708 |
| 186 | Ga0207651_10056911 | 3300025960 | Bacteria | 2694 |
| 187 | Ga0207712_10001144 | 3300025961 | Bacteria | 18474 |
| 188 | Ga0207712_10056695 | 3300025961 | Bacteria | 2761 |
| 189 | Ga0207712_10400703 | 3300025961 | Bacteria | 1153 |
| 190 | Ga0207668_10212732 | 3300025972 | Unclassified | 1547 |
| 191 | Ga0207658_10217955 | 3300025986 | Unclassified | 1604 |
| 192 | Ga0207677_10164780 | 3300026023 | Bacteria | 1726 |
| 193 | Ga0207677_10736951 | 3300026023 | Bacteria | 877 |
| 194 | Ga0207639_10814865 | 3300026041 | Bacteria | 870 |
| 195 | Ga0207678_10026912 | 3300026067 | Bacteria | 5017 |
| 196 | Ga0207708_10036716 | 3300026075 | Bacteria | 3732 |
| 197 | Ga0207641_10001688 | 3300026088 | Bacteria | 21481 |
| 198 | Ga0207641_10329503 | 3300026088 | Bacteria | 1450 |
| 199 | Ga0207641_10455222 | 3300026088 | Bacteria | 1237 |
| 200 | Ga0207648_10001098 | 3300026089 | Bacteria | 30333 |
| 201 | Ga0207648_10083289 | 3300026089 | Bacteria | 2790 |
| 202 | Ga0207648_10180531 | 3300026089 | Bacteria | 1868 |
| 203 | Ga0207676_10627085 | 3300026095 | Unclassified | 1035 |
| 204 | Ga0207674_10130640 | 3300026116 | Bacteria | 2475 |
| 205 | Ga0207674_10409689 | 3300026116 | Bacteria | 1310 |
| 206 | Ga0207674_10982681 | 3300026116 | Bacteria | 813 |
| 207 | Ga0207675_100056759 | 3300026118 | Bacteria | 3652 |
| 208 | Ga0207675_100272382 | 3300026118 | Unclassified | 1643 |
| 209 | Ga0207683_10005504 | 3300026121 | Bacteria | 10855 |
| 210 | Ga0207683_10075759 | 3300026121 | Bacteria | 2979 |
| 211 | Ga0207683_10547918 | 3300026121 | Bacteria | 1069 |
| 212 | Ga0207698_11265177 | 3300026142 | Bacteria | 752 |
| 213 | Ga0268265_10109219 | 3300028380 | Bacteria | 2254 |
| 214 | Ga0268265_10319064 | 3300028380 | Bacteria | 1406 |
| 215 | Ga0265327_10000219 | 3300031251 | Bacteria | 116606 |
| 216 | Ga0265313_10054388 | 3300031595 | Bacteria | 1901 |
| 217 | Ga0307414_10001096 | 3300032004 | Bacteria | 13840 |
| 218 | Ga0307411_10579973 | 3300032005 | Bacteria | 961 |
| 219 | Ga0373937_0860469 | 3300036401 | Bacteria | 855 |
| 220 | Ga0395900_1251911 | 3300037418 | Unclassified | 657 |
| 221 | Ga0451793_1435008 | 3300041452 | Bacteria | 897 |
| 222 | Ga0451798_1063746 | 3300041458 | Bacteria | 1489 |
| 223 | Ga0451807_0389271 | 3300041486 | Bacteria | 2145 |
| 224 | Ga0439441_013409 | 3300042001 | Bacteria | 1421 |
| 225 | Ga0466972_0138254 | 3300044658 | Bacteria | 1147 |
| 226 | Ga0453684_0528607 | 3300044712 | Bacteria | 1302 |
| 227 | Ga0451576_1093975 | 3300045051 | Bacteria | 834 |
| 228 | Ga0495618_0541799 | 3300046514 | Bacteria | 698 |
| 229 | Ga0495621_0043287 | 3300046539 | Unclassified | 1588 |
| 230 | Ga0495621_0158220 | 3300046539 | Bacteria | 895 |
| 231 | Ga0495686_0130570 | 3300047472 | Bacteria | 1490 |
| 232 | Ga0496104_0091638 | 3300048907 | Bacteria | 2906 |
| 233 | Ga0501031_0039883 | 3300049568 | Bacteria | 3065 |
| 234 | Ga0501032_0022835 | 3300049569 | Bacteria | 4333 |
| 235 | Ga0501033_0313306 | 3300049570 | Bacteria | 1103 |
| 236 | Ga0501034_0062956 | 3300049571 | Bacteria | 3724 |
| 237 | Ga0501034_0210133 | 3300049571 | Bacteria | 1901 |
| 238 | Ga0501034_0758124 | 3300049571 | Bacteria | 866 |
| 239 | Ga0501036_0009447 | 3300049572 | Bacteria | 8021 |
| 240 | Ga0501037_0053547 | 3300049573 | Bacteria | 2951 |
| 241 | Ga0501038_0024681 | 3300049574 | Bacteria | 5360 |
| 242 | Ga0501038_1130009 | 3300049574 | Bacteria | 571 |
| 243 | Ga0501039_0052073 | 3300049575 | Bacteria | 3167 |
| 244 | Ga0501040_0433726 | 3300049576 | Bacteria | 945 |
| 245 | Ga0501043_0059025 | 3300049579 | Bacteria | 3010 |
| 246 | Ga0501047_0192536 | 3300049581 | Bacteria | 1902 |
| 247 | Ga0501047_1294856 | 3300049581 | Bacteria | 543 |
| 248 | Ga0501072_0181683 | 3300049588 | Bacteria | 1678 |
| 249 | Ga0501072_0236468 | 3300049588 | Unclassified | 1455 |
| 250 | Ga0501259_050185 | 3300049688 | Bacteria | 845 |
| 251 | Ga0501219_000072 | 3300049703 | Bacteria | 17183 |
| 252 | Ga0501080_0148846 | 3300049742 | Bacteria | 2165 |
| 253 | Ga0501080_0399209 | 3300049742 | Unclassified | 1237 |
| 254 | Ga0501241_004071 | 3300049758 | Bacteria | 2750 |
| 255 | Ga0501035_0026074 | 3300049822 | Bacteria | 5353 |
| 256 | Ga0501044_0004343 | 3300049823 | Bacteria | 15878 |
| 257 | Ga0501044_0082753 | 3300049823 | Bacteria | 3247 |
| 258 | Ga0501284_00059 | 3300050005 | Bacteria | 39196 |
| 259 | nmdc:mga05p37_613070_c1 | 3300050507 | Bacteria | 1226 |
| 260 | nmdc:mga09592_44385_c1 | 3300050508 | Bacteria | 3742 |
| 261 | nmdc:mga09592_907053_c1 | 3300050508 | Bacteria | 740 |
| 262 | nmdc:mga0qj67_5946_c1 | 3300050509 | Bacteria | 8940 |
| 263 | nmdc:mga06r32_9171_c1 | 3300050510 | Bacteria | 8917 |
| 264 | nmdc:mga08y16_682350_c1 | 3300050511 | Bacteria | 1029 |
| 265 | Ga0500562_000094 | 3300053108 | Bacteria | 36637 |
| 266 | Ga0500616_0054941 | 3300053153 | Bacteria | 2084 |
| 267 | Ga0500622_0000652 | 3300053156 | Bacteria | 30940 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049688 | Ga0501259_050185 | Ga0501259_050185_23_460 | 145 |
| 2 | 3300046514 | Ga0495618_0541799 | Ga0495618_0541799_167_625 | 152 |
| 3 | 3300050507 | nmdc:mga05p37_613070_c1 | nmdc:mga05p37_613070_c1_691_1152 | 153 |
| 4 | 3300049574 | Ga0501038_1130009 | Ga0501038_1130009_75_557 | 160 |
| 5 | 3300049581 | Ga0501047_1294856 | Ga0501047_1294856_26_508 | 160 |
| 6 | 3300005985 | Ga0081539_10025801 | Ga0081539_100258013 | 162 |
| 7 | 3300025961 | Ga0207712_10400703 | Ga0207712_104007031 | 164 |
| 8 | 3300037418 | Ga0395900_1251911 | Ga0395900_1251911_47_544 | 164 |
| 9 | 3300005347 | Ga0070668_100031183 | Ga0070668_1000311833 | 165 |
| 10 | 3300005356 | Ga0070674_100056375 | Ga0070674_1000563753 | 165 |
| 11 | 3300005459 | Ga0068867_100329834 | Ga0068867_1003298342 | 165 |
| 12 | 3300005719 | Ga0068861_100895982 | Ga0068861_1008959822 | 165 |
| 13 | 3300006237 | Ga0097621_100187601 | Ga0097621_1001876012 | 165 |
| 14 | 3300006881 | Ga0068865_100046602 | Ga0068865_1000466024 | 165 |
| 15 | 3300025938 | Ga0207704_10416118 | Ga0207704_104161182 | 165 |
| 16 | 3300025942 | Ga0207689_10046577 | Ga0207689_100465773 | 165 |
| 17 | 3300025972 | Ga0207668_10212732 | Ga0207668_102127322 | 165 |
| 18 | 3300026118 | Ga0207675_100056759 | Ga0207675_1000567591 | 165 |
| 19 | 3300005466 | Ga0070685_10050704 | Ga0070685_100507043 | 166 |
| 20 | 3300011119 | Ga0105246_10640558 | Ga0105246_106405582 | 168 |
| 21 | 3300049570 | Ga0501033_0313306 | Ga0501033_0313306_459_971 | 170 |
| 22 | iso_pu_bacteria | 2946013367 | 2946017168 | 170 |
| 23 | 3300005535 | Ga0070684_101164170 | Ga0070684_1011641702 | 171 |
| 24 | 3300050508 | nmdc:mga09592_907053_c1 | nmdc:mga09592_907053_c1_177_692 | 171 |
| 25 | 3300005339 | Ga0070660_100244638 | Ga0070660_1002446382 | 172 |
| 26 | 3300005344 | Ga0070661_100020017 | Ga0070661_1000200173 | 172 |
| 27 | 3300005366 | Ga0070659_100025511 | Ga0070659_1000255112 | 172 |
| 28 | 3300005539 | Ga0068853_100284271 | Ga0068853_1002842712 | 172 |
| 29 | 3300005616 | Ga0068852_100004522 | Ga0068852_10000452211 | 172 |
| 30 | 3300013105 | Ga0157369_10074444 | Ga0157369_100744443 | 172 |
| 31 | 3300013296 | Ga0157374_10073767 | Ga0157374_100737673 | 172 |
| 32 | 3300014745 | Ga0157377_10175301 | Ga0157377_101753011 | 172 |
| 33 | 3300025904 | Ga0207647_10000208 | Ga0207647_1000020810 | 172 |
| 34 | 3300025919 | Ga0207657_10258569 | Ga0207657_102585692 | 172 |
| 35 | 3300025920 | Ga0207649_10036057 | Ga0207649_100360573 | 172 |
| 36 | 3300025932 | Ga0207690_10136075 | Ga0207690_101360752 | 172 |
| 37 | 3300026041 | Ga0207639_10814865 | Ga0207639_108148651 | 172 |
| 38 | 3300026142 | Ga0207698_11265177 | Ga0207698_112651772 | 172 |
| 39 | 3300005329 | Ga0070683_100011519 | Ga0070683_1000115196 | 173 |
| 40 | 3300005331 | Ga0070670_100074075 | Ga0070670_1000740753 | 173 |
| 41 | 3300005344 | Ga0070661_100473781 | Ga0070661_1004737813 | 173 |
| 42 | 3300005355 | Ga0070671_100159642 | Ga0070671_1001596421 | 173 |
| 43 | 3300005539 | Ga0068853_100320819 | Ga0068853_1003208192 | 173 |
| 44 | 3300005564 | Ga0070664_100033995 | Ga0070664_1000339953 | 173 |
| 45 | 3300005564 | Ga0070664_100801117 | Ga0070664_1008011172 | 173 |
| 46 | 3300005834 | Ga0068851_10070426 | Ga0068851_100704262 | 173 |
| 47 | 3300006237 | Ga0097621_100888476 | Ga0097621_1008884761 | 173 |
| 48 | 3300013307 | Ga0157372_10315634 | Ga0157372_103156341 | 173 |
| 49 | 3300014325 | Ga0163163_10002472 | Ga0163163_1000247216 | 173 |
| 50 | 3300014969 | Ga0157376_10739788 | Ga0157376_107397882 | 173 |
| 51 | 3300025925 | Ga0207650_10308824 | Ga0207650_103088242 | 173 |
| 52 | 3300025926 | Ga0207659_10552809 | Ga0207659_105528091 | 173 |
| 53 | 3300025931 | Ga0207644_10202147 | Ga0207644_102021471 | 173 |
| 54 | 3300025944 | Ga0207661_10037888 | Ga0207661_100378885 | 173 |
| 55 | 3300025945 | Ga0207679_10030471 | Ga0207679_100304713 | 173 |
| 56 | 3300025945 | Ga0207679_10713080 | Ga0207679_107130802 | 173 |
| 57 | 3300026023 | Ga0207677_10164780 | Ga0207677_101647801 | 173 |
| 58 | 3300026095 | Ga0207676_10627085 | Ga0207676_106270851 | 173 |
| 59 | 3300009545 | Ga0105237_10236416 | Ga0105237_102364163 | 174 |
| 60 | 3300013102 | Ga0157371_10024670 | Ga0157371_100246703 | 174 |
| 61 | 3300013307 | Ga0157372_10095381 | Ga0157372_100953812 | 174 |
| 62 | 3300013307 | Ga0157372_10271219 | Ga0157372_102712191 | 174 |
| 63 | 3300013307 | Ga0157372_10418417 | Ga0157372_104184172 | 174 |
| 64 | iso_pu_bacteria | 2929177148 | 2929181040 | 175 |
| 65 | iso_pu_bacteria | 2945977869 | 2945983441 | 175 |
| 66 | iso_pu_bacteria | 2818991460 | 2819678262 | 176 |
| 67 | 3300025284 | Ga0209130_1002115 | Ga0209130_10021159 | 178 |
| 68 | 3300025302 | Ga0207426_1000137 | Ga0207426_100013731 | 178 |
| 69 | 3300049571 | Ga0501034_0210133 | Ga0501034_0210133_136_675 | 178 |
| 70 | 3300049576 | Ga0501040_0433726 | Ga0501040_0433726_72_611 | 178 |
| 71 | 3300005456 | Ga0070678_100252185 | Ga0070678_1002521852 | 179 |
| 72 | 3300005459 | Ga0068867_100092510 | Ga0068867_1000925101 | 179 |
| 73 | 3300005577 | Ga0068857_100076312 | Ga0068857_1000763122 | 179 |
| 74 | 3300006237 | Ga0097621_100005328 | Ga0097621_1000053285 | 179 |
| 75 | 3300006358 | Ga0068871_100003060 | Ga0068871_1000030602 | 179 |
| 76 | 3300013102 | Ga0157371_10454870 | Ga0157371_104548702 | 179 |
| 77 | 3300013297 | Ga0157378_10012677 | Ga0157378_100126778 | 179 |
| 78 | 3300013306 | Ga0163162_10324674 | Ga0163162_103246742 | 179 |
| 79 | 3300017792 | Ga0163161_10093413 | Ga0163161_100934133 | 179 |
| 80 | 3300025907 | Ga0207645_10249618 | Ga0207645_102496182 | 179 |
| 81 | 3300026089 | Ga0207648_10180531 | Ga0207648_101805312 | 179 |
| 82 | 3300026116 | Ga0207674_10409689 | Ga0207674_104096892 | 179 |
| 83 | 3300026121 | Ga0207683_10547918 | Ga0207683_105479182 | 179 |
| 84 | 3300041458 | Ga0451798_1063746 | Ga0451798_1063746_423_962 | 179 |
| 85 | 3300048907 | Ga0496104_0091638 | Ga0496104_0091638_1991_2530 | 179 |
| 86 | 3300005471 | Ga0070698_100009662 | Ga0070698_1000096626 | 180 |
| 87 | 3300031251 | Ga0265327_10000219 | Ga0265327_1000021945 | 180 |
| 88 | 3300049571 | Ga0501034_0062956 | Ga0501034_0062956_2919_3470 | 180 |
| 89 | 3300049823 | Ga0501044_0082753 | Ga0501044_0082753_1661_2212 | 180 |
| 90 | 3300005327 | Ga0070658_10233036 | Ga0070658_102330362 | 181 |
| 91 | 3300005331 | Ga0070670_100169832 | Ga0070670_1001698322 | 181 |
| 92 | 3300005336 | Ga0070680_100010184 | Ga0070680_1000101843 | 181 |
| 93 | 3300005337 | Ga0070682_100000306 | Ga0070682_10000030628 | 181 |
| 94 | 3300005340 | Ga0070689_100225913 | Ga0070689_1002259131 | 181 |
| 95 | 3300005354 | Ga0070675_100495487 | Ga0070675_1004954872 | 181 |
| 96 | 3300005364 | Ga0070673_100096124 | Ga0070673_1000961242 | 181 |
| 97 | 3300005364 | Ga0070673_100190746 | Ga0070673_1001907463 | 181 |
| 98 | 3300005365 | Ga0070688_100010004 | Ga0070688_1000100042 | 181 |
| 99 | 3300005455 | Ga0070663_100116798 | Ga0070663_1001167982 | 181 |
| 100 | 3300005455 | Ga0070663_100482546 | Ga0070663_1004825462 | 181 |
| 101 | 3300005456 | Ga0070678_100011522 | Ga0070678_1000115226 | 181 |
| 102 | 3300005466 | Ga0070685_10064140 | Ga0070685_100641401 | 181 |
| 103 | 3300005466 | Ga0070685_10131671 | Ga0070685_101316711 | 181 |
| 104 | 3300005466 | Ga0070685_10314398 | Ga0070685_103143981 | 181 |
| 105 | 3300005530 | Ga0070679_100186555 | Ga0070679_1001865552 | 181 |
| 106 | 3300005539 | Ga0068853_100098518 | Ga0068853_1000985182 | 181 |
| 107 | 3300005543 | Ga0070672_100184079 | Ga0070672_1001840791 | 181 |
| 108 | 3300005544 | Ga0070686_100419704 | Ga0070686_1004197042 | 181 |
| 109 | 3300005548 | Ga0070665_100020327 | Ga0070665_1000203273 | 181 |
| 110 | 3300005563 | Ga0068855_100222779 | Ga0068855_1002227792 | 181 |
| 111 | 3300005617 | Ga0068859_100048072 | Ga0068859_1000480723 | 181 |
| 112 | 3300005617 | Ga0068859_100112412 | Ga0068859_1001124124 | 181 |
| 113 | 3300005617 | Ga0068859_100437230 | Ga0068859_1004372301 | 181 |
| 114 | 3300005718 | Ga0068866_10068999 | Ga0068866_100689992 | 181 |
| 115 | 3300005840 | Ga0068870_10050376 | Ga0068870_100503763 | 181 |
| 116 | 3300005841 | Ga0068863_100009683 | Ga0068863_1000096833 | 181 |
| 117 | 3300005841 | Ga0068863_100087180 | Ga0068863_1000871802 | 181 |
| 118 | 3300005841 | Ga0068863_100274815 | Ga0068863_1002748152 | 181 |
| 119 | 3300005841 | Ga0068863_100803969 | Ga0068863_1008039691 | 181 |
| 120 | 3300005844 | Ga0068862_100281289 | Ga0068862_1002812892 | 181 |
| 121 | 3300005844 | Ga0068862_101095205 | Ga0068862_1010952052 | 181 |
| 122 | 3300006163 | Ga0070715_10138344 | Ga0070715_101383442 | 181 |
| 123 | 3300006237 | Ga0097621_100040839 | Ga0097621_1000408393 | 181 |
| 124 | 3300006237 | Ga0097621_100099918 | Ga0097621_1000999183 | 181 |
| 125 | 3300006237 | Ga0097621_100322893 | Ga0097621_1003228931 | 181 |
| 126 | 3300006358 | Ga0068871_100002623 | Ga0068871_1000026237 | 181 |
| 127 | 3300006358 | Ga0068871_100117365 | Ga0068871_1001173652 | 181 |
| 128 | 3300006881 | Ga0068865_100267176 | Ga0068865_1002671762 | 181 |
| 129 | 3300006931 | Ga0097620_100048071 | Ga0097620_1000480713 | 181 |
| 130 | 3300006931 | Ga0097620_100112414 | Ga0097620_1001124144 | 181 |
| 131 | 3300006931 | Ga0097620_100437203 | Ga0097620_1004372031 | 181 |
| 132 | 3300009094 | Ga0111539_10298322 | Ga0111539_102983222 | 181 |
| 133 | 3300009094 | Ga0111539_10336846 | Ga0111539_103368463 | 181 |
| 134 | 3300009174 | Ga0105241_10055619 | Ga0105241_100556193 | 181 |
| 135 | 3300009176 | Ga0105242_10008487 | Ga0105242_100084873 | 181 |
| 136 | 3300009176 | Ga0105242_10084008 | Ga0105242_100840082 | 181 |
| 137 | 3300009176 | Ga0105242_10515925 | Ga0105242_105159252 | 181 |
| 138 | 3300009553 | Ga0105249_10000793 | Ga0105249_1000079318 | 181 |
| 139 | 3300009553 | Ga0105249_11374511 | Ga0105249_113745112 | 181 |
| 140 | 3300011119 | Ga0105246_10079617 | Ga0105246_100796173 | 181 |
| 141 | 3300011119 | Ga0105246_10217980 | Ga0105246_102179802 | 181 |
| 142 | 3300013102 | Ga0157371_10059348 | Ga0157371_100593483 | 181 |
| 143 | 3300013104 | Ga0157370_10032729 | Ga0157370_100327294 | 181 |
| 144 | 3300013105 | Ga0157369_10191191 | Ga0157369_101911913 | 181 |
| 145 | 3300013306 | Ga0163162_10743220 | Ga0163162_107432202 | 181 |
| 146 | 3300013307 | Ga0157372_10225698 | Ga0157372_102256983 | 181 |
| 147 | 3300013308 | Ga0157375_10592705 | Ga0157375_105927051 | 181 |
| 148 | 3300014325 | Ga0163163_10090458 | Ga0163163_100904583 | 181 |
| 149 | 3300014326 | Ga0157380_10131808 | Ga0157380_101318082 | 181 |
| 150 | 3300014326 | Ga0157380_10136582 | Ga0157380_101365823 | 181 |
| 151 | 3300014326 | Ga0157380_11599326 | Ga0157380_115993261 | 181 |
| 152 | 3300014745 | Ga0157377_10482985 | Ga0157377_104829851 | 181 |
| 153 | 3300014968 | Ga0157379_10139007 | Ga0157379_101390072 | 181 |
| 154 | 3300014969 | Ga0157376_10298870 | Ga0157376_102988702 | 181 |
| 155 | 3300014969 | Ga0157376_10835676 | Ga0157376_108356761 | 181 |
| 156 | 3300017792 | Ga0163161_10074768 | Ga0163161_100747682 | 181 |
| 157 | 3300017792 | Ga0163161_10222885 | Ga0163161_102228851 | 181 |
| 158 | 3300017792 | Ga0163161_10577182 | Ga0163161_105771822 | 181 |
| 159 | 3300025321 | Ga0207656_10033609 | Ga0207656_100336092 | 181 |
| 160 | 3300025893 | Ga0207682_10016323 | Ga0207682_100163232 | 181 |
| 161 | 3300025899 | Ga0207642_10191560 | Ga0207642_101915602 | 181 |
| 162 | 3300025903 | Ga0207680_10033147 | Ga0207680_100331473 | 181 |
| 163 | 3300025904 | Ga0207647_10251664 | Ga0207647_102516642 | 181 |
| 164 | 3300025907 | Ga0207645_10000198 | Ga0207645_1000019831 | 181 |
| 165 | 3300025909 | Ga0207705_10095703 | Ga0207705_100957032 | 181 |
| 166 | 3300025917 | Ga0207660_10008387 | Ga0207660_100083876 | 181 |
| 167 | 3300025921 | Ga0207652_10141529 | Ga0207652_101415292 | 181 |
| 168 | 3300025923 | Ga0207681_10178319 | Ga0207681_101783192 | 181 |
| 169 | 3300025925 | Ga0207650_10095361 | Ga0207650_100953614 | 181 |
| 170 | 3300025925 | Ga0207650_10536593 | Ga0207650_105365932 | 181 |
| 171 | 3300025925 | Ga0207650_10966564 | Ga0207650_109665641 | 181 |
| 172 | 3300025926 | Ga0207659_10032435 | Ga0207659_100324352 | 181 |
| 173 | 3300025934 | Ga0207686_10016163 | Ga0207686_100161633 | 181 |
| 174 | 3300025936 | Ga0207670_10778402 | Ga0207670_107784021 | 181 |
| 175 | 3300025937 | Ga0207669_10103112 | Ga0207669_101031122 | 181 |
| 176 | 3300025938 | Ga0207704_10353207 | Ga0207704_103532072 | 181 |
| 177 | 3300025940 | Ga0207691_10007801 | Ga0207691_1000780110 | 181 |
| 178 | 3300025940 | Ga0207691_10124504 | Ga0207691_101245042 | 181 |
| 179 | 3300025940 | Ga0207691_10493679 | Ga0207691_104936792 | 181 |
| 180 | 3300025942 | Ga0207689_10002649 | Ga0207689_100026493 | 181 |
| 181 | 3300025942 | Ga0207689_10118800 | Ga0207689_101188004 | 181 |
| 182 | 3300025949 | Ga0207667_10009282 | Ga0207667_100092827 | 181 |
| 183 | 3300025960 | Ga0207651_10056188 | Ga0207651_100561883 | 181 |
| 184 | 3300025960 | Ga0207651_10056911 | Ga0207651_100569113 | 181 |
| 185 | 3300025961 | Ga0207712_10001144 | Ga0207712_1000114415 | 181 |
| 186 | 3300025986 | Ga0207658_10217955 | Ga0207658_102179553 | 181 |
| 187 | 3300026023 | Ga0207677_10736951 | Ga0207677_107369511 | 181 |
| 188 | 3300026067 | Ga0207678_10026912 | Ga0207678_100269124 | 181 |
| 189 | 3300026088 | Ga0207641_10001688 | Ga0207641_100016886 | 181 |
| 190 | 3300026088 | Ga0207641_10329503 | Ga0207641_103295031 | 181 |
| 191 | 3300026088 | Ga0207641_10455222 | Ga0207641_104552221 | 181 |
| 192 | 3300026089 | Ga0207648_10001098 | Ga0207648_100010986 | 181 |
| 193 | 3300026089 | Ga0207648_10083289 | Ga0207648_100832892 | 181 |
| 194 | 3300026121 | Ga0207683_10005504 | Ga0207683_100055044 | 181 |
| 195 | 3300026121 | Ga0207683_10075759 | Ga0207683_100757593 | 181 |
| 196 | 3300028380 | Ga0268265_10109219 | Ga0268265_101092192 | 181 |
| 197 | 3300028380 | Ga0268265_10319064 | Ga0268265_103190642 | 181 |
| 198 | 3300041452 | Ga0451793_1435008 | Ga0451793_1435008_189_734 | 181 |
| 199 | 3300041486 | Ga0451807_0389271 | Ga0451807_0389271_165_710 | 181 |
| 200 | 3300044658 | Ga0466972_0138254 | Ga0466972_0138254_119_664 | 181 |
| 201 | 3300044712 | Ga0453684_0528607 | Ga0453684_0528607_517_1071 | 181 |
| 202 | 3300045051 | Ga0451576_1093975 | Ga0451576_1093975_270_824 | 181 |
| 203 | 3300046539 | Ga0495621_0043287 | Ga0495621_0043287_188_733 | 181 |
| 204 | 3300046539 | Ga0495621_0158220 | Ga0495621_0158220_260_805 | 181 |
| 205 | 3300050511 | nmdc:mga08y16_682350_c1 | nmdc:mga08y16_682350_c1_196_741 | 181 |
| 206 | 3300005338 | Ga0068868_101149289 | Ga0068868_1011492891 | 182 |
| 207 | 3300005444 | Ga0070694_100989064 | Ga0070694_1009890641 | 182 |
| 208 | 3300005471 | Ga0070698_100000392 | Ga0070698_1000003924 | 182 |
| 209 | 3300005471 | Ga0070698_100228023 | Ga0070698_1002280232 | 182 |
| 210 | 3300005518 | Ga0070699_100265266 | Ga0070699_1002652663 | 182 |
| 211 | 3300025922 | Ga0207646_10255742 | Ga0207646_102557423 | 182 |
| 212 | 3300036401 | Ga0373937_0860469 | Ga0373937_0860469_153_701 | 182 |
| 213 | 3300047472 | Ga0495686_0130570 | Ga0495686_0130570_186_737 | 182 |
| 214 | 3300049568 | Ga0501031_0039883 | Ga0501031_0039883_1066_1617 | 182 |
| 215 | 3300049569 | Ga0501032_0022835 | Ga0501032_0022835_201_752 | 182 |
| 216 | 3300049571 | Ga0501034_0758124 | Ga0501034_0758124_139_687 | 182 |
| 217 | 3300049572 | Ga0501036_0009447 | Ga0501036_0009447_7259_7810 | 182 |
| 218 | 3300049573 | Ga0501037_0053547 | Ga0501037_0053547_212_763 | 182 |
| 219 | 3300049574 | Ga0501038_0024681 | Ga0501038_0024681_1385_1936 | 182 |
| 220 | 3300049575 | Ga0501039_0052073 | Ga0501039_0052073_2234_2785 | 182 |
| 221 | 3300049579 | Ga0501043_0059025 | Ga0501043_0059025_2013_2564 | 182 |
| 222 | 3300049581 | Ga0501047_0192536 | Ga0501047_0192536_93_644 | 182 |
| 223 | 3300049588 | Ga0501072_0181683 | Ga0501072_0181683_36_587 | 182 |
| 224 | 3300049742 | Ga0501080_0148846 | Ga0501080_0148846_204_755 | 182 |
| 225 | 3300049822 | Ga0501035_0026074 | Ga0501035_0026074_2323_2874 | 182 |
| 226 | 3300049823 | Ga0501044_0004343 | Ga0501044_0004343_14894_15445 | 182 |
| 227 | 3300053108 | Ga0500562_000094 | Ga0500562_000094_4575_5129 | 182 |
| 228 | 3300053153 | Ga0500616_0054941 | Ga0500616_0054941_1025_1579 | 182 |
| 229 | 3300053156 | Ga0500622_0000652 | Ga0500622_0000652_25666_26217 | 182 |
| 230 | 3300005290 | Ga0065712_10002201 | Ga0065712_100022017 | 183 |
| 231 | 3300005365 | Ga0070688_100059275 | Ga0070688_1000592751 | 183 |
| 232 | 3300005441 | Ga0070700_100055925 | Ga0070700_1000559252 | 183 |
| 233 | 3300005468 | Ga0070707_100104556 | Ga0070707_1001045563 | 183 |
| 234 | 3300005471 | Ga0070698_100018803 | Ga0070698_1000188038 | 183 |
| 235 | 3300005544 | Ga0070686_100107009 | Ga0070686_1001070092 | 183 |
| 236 | 3300005577 | Ga0068857_100074551 | Ga0068857_1000745513 | 183 |
| 237 | 3300005577 | Ga0068857_100960949 | Ga0068857_1009609491 | 183 |
| 238 | 3300005616 | Ga0068852_100075537 | Ga0068852_1000755376 | 183 |
| 239 | 3300005618 | Ga0068864_100058315 | Ga0068864_1000583152 | 183 |
| 240 | 3300005719 | Ga0068861_100369368 | Ga0068861_1003693682 | 183 |
| 241 | 3300006844 | Ga0075428_100491736 | Ga0075428_1004917361 | 183 |
| 242 | 3300006846 | Ga0075430_100013464 | Ga0075430_1000134643 | 183 |
| 243 | 3300006847 | Ga0075431_100031956 | Ga0075431_1000319566 | 183 |
| 244 | 3300006880 | Ga0075429_100023258 | Ga0075429_1000232587 | 183 |
| 245 | 3300009147 | Ga0114129_10040254 | Ga0114129_100402546 | 183 |
| 246 | 3300009177 | Ga0105248_10238209 | Ga0105248_102382094 | 183 |
| 247 | 3300009553 | Ga0105249_10015473 | Ga0105249_100154733 | 183 |
| 248 | 3300017792 | Ga0163161_10029749 | Ga0163161_100297496 | 183 |
| 249 | 3300025923 | Ga0207681_10360665 | Ga0207681_103606652 | 183 |
| 250 | 3300025926 | Ga0207659_10599515 | Ga0207659_105995152 | 183 |
| 251 | 3300025936 | Ga0207670_10180505 | Ga0207670_101805053 | 183 |
| 252 | 3300025961 | Ga0207712_10056695 | Ga0207712_100566953 | 183 |
| 253 | 3300026075 | Ga0207708_10036716 | Ga0207708_100367166 | 183 |
| 254 | 3300026116 | Ga0207674_10130640 | Ga0207674_101306403 | 183 |
| 255 | 3300026116 | Ga0207674_10982681 | Ga0207674_109826812 | 183 |
| 256 | 3300026118 | Ga0207675_100272382 | Ga0207675_1002723822 | 183 |
| 257 | 3300031595 | Ga0265313_10054388 | Ga0265313_100543882 | 183 |
| 258 | 3300042001 | Ga0439441_013409 | Ga0439441_013409_218_769 | 183 |
| 259 | 3300050508 | nmdc:mga09592_44385_c1 | nmdc:mga09592_44385_c1_590_1141 | 183 |
| 260 | 3300050509 | nmdc:mga0qj67_5946_c1 | nmdc:mga0qj67_5946_c1_3480_4031 | 183 |
| 261 | 3300050510 | nmdc:mga06r32_9171_c1 | nmdc:mga06r32_9171_c1_4872_5423 | 183 |
| 262 | 3300005340 | Ga0070689_100963148 | Ga0070689_1009631481 | 184 |
| 263 | 3300032005 | Ga0307411_10579973 | Ga0307411_105799732 | 184 |
| 264 | 3300049588 | Ga0501072_0236468 | Ga0501072_0236468_836_1393 | 184 |
| 265 | 3300049703 | Ga0501219_000072 | Ga0501219_000072_9134_9694 | 184 |
| 266 | 3300049742 | Ga0501080_0399209 | Ga0501080_0399209_382_939 | 184 |
| 267 | 3300049758 | Ga0501241_004071 | Ga0501241_004071_1500_2060 | 184 |
| 268 | 3300050005 | Ga0501284_00059 | Ga0501284_00059_9620_10180 | 184 |
| 269 | 3300005288 | Ga0065714_10095965 | Ga0065714_100959652 | 185 |
| 270 | 3300013100 | Ga0157373_10102012 | Ga0157373_101020122 | 185 |
| 271 | 3300032004 | Ga0307414_10001096 | Ga0307414_100010968 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fk8-assembly1.cif.gz_A | the crystal structure of disulphide isomerase from xylella fastidiosa temecula1 | 0.8403 | 20 | 128 |
| 7bzk-assembly1.cif.gz_B | crystal structure of ferredoxin: thioredoxin reductase and thioredoxin y1 complex | 0.7857 | 26 | 128 |
| 4kca-assembly2.cif.gz_B | crystal structure of endo-1,5-alpha-l-arabinanase from a bovine ruminal metagenomic library | 0.7806 | 24 | 128 |
| 7ysi-assembly1.cif.gz_A | crystal structure of thioredoxin 2 | 0.7764 | 44 | 128 |
| 4pob-assembly1.cif.gz_B | crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus | 0.756 | 24 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O17657_141_389_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.8554 | 153 | 184 | 1.10.565.10 |
| af_O44668_157_360_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.8508 | 152 | 184 | 1.10.565.10 |
| af_Q9NAJ2_47_214_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.8473 | 152 | 182 | 1.10.565.10 |
| 3fk8A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8403 | 20 | 128 | 3.40.30.10 |
| af_Q2G203_11_180_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8195 | 44 | 84 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V9FYL3-F1-model_v4 | Thioredoxin domain-containing protein | 0.9837 | 21 | 180 |
|
| AF-A0A537JEZ1-F1-model_v4 | Thioredoxin family protein | 0.9833 | 20 | 181 |
|
| AF-A0A4V2TP26-F1-model_v4 | deleted | 0.9822 | 21 | 181 |
|
| AF-A0A4Y4M693-F1-model_v4 | Thioredoxin domain-containing protein | 0.9811 | 20 | 179 |
|
| AF-A0A848FSC0-F1-model_v4 | Thioredoxin family protein | 0.9801 | 20 | 181 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar