F377513

General Info

Members Datasets Scaffolds Average Seq Length
271 153 542 88

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_101568784|Ga0070679_1015687841
Length 101
Sequence MNGGGPRDAAKEEPYMNQQAHSHVSADRIYPFDARGVAKRFRHAAIFGALDALTPGDTMRFVNDHDPLPLLAQLRDRYGEAVSIEYRQRDPGAIVIDFVRL

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
77 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
80 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0.74
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_101568784 3300005530 Bacteria 606
2 Ga0070658_10007312 3300005327 Bacteria 8921
3 Ga0070658_10168956 3300005327 Bacteria 1837
4 Ga0070680_100105527 3300005336 Bacteria 2342
5 Ga0070680_100274014 3300005336 Bacteria 1429
6 Ga0070682_100369238 3300005337 Bacteria 1075
7 Ga0070660_100174817 3300005339 Bacteria 1736
8 Ga0070660_101234465 3300005339 Bacteria 634
9 Ga0070687_101367288 3300005343 Bacteria 528
10 Ga0070659_100033200 3300005366 Bacteria 4007
11 Ga0070659_100043943 3300005366 Bacteria 3496
12 Ga0070659_100204571 3300005366 Bacteria 1626
13 Ga0070659_101884946 3300005366 Bacteria 536
14 Ga0070667_100419100 3300005367 Bacteria 1220
15 Ga0070714_100083323 3300005435 Bacteria 2788
16 Ga0070711_100523584 3300005439 Bacteria 980
17 Ga0070705_100291640 3300005440 Bacteria 1165
18 Ga0070681_10002564 3300005458 Bacteria 16669
19 Ga0070681_10078415 3300005458 Bacteria 3260
20 Ga0070681_10139629 3300005458 Bacteria 2353
21 Ga0070681_11009391 3300005458 Bacteria 752
22 Ga0070679_100020328 3300005530 Bacteria 6470
23 Ga0070679_100032967 3300005530 Bacteria 5126
24 Ga0070679_100136466 3300005530 Bacteria 2434
25 Ga0070679_100137214 3300005530 Bacteria 2427
26 Ga0070679_100293214 3300005530 Bacteria 1578
27 Ga0070679_100411074 3300005530 Bacteria 1299
28 Ga0070684_100543029 3300005535 Bacteria 1078
29 Ga0070684_100865292 3300005535 Bacteria 846
30 Ga0068853_100471949 3300005539 Bacteria 1182
31 Ga0070704_100317037 3300005549 Bacteria 1305
32 Ga0068855_100037482 3300005563 Bacteria 5765
33 Ga0068855_100159730 3300005563 Bacteria 2559
34 Ga0068855_100163411 3300005563 Bacteria 2525
35 Ga0068855_100885229 3300005563 Bacteria 944
36 Ga0068855_101165209 3300005563 Bacteria 803
37 Ga0070664_101059188 3300005564 Bacteria 763
38 Ga0070664_101329363 3300005564 Bacteria 679
39 Ga0070664_101479926 3300005564 Bacteria 642
40 Ga0068857_100001372 3300005577 Bacteria 19197
41 Ga0068857_100888465 3300005577 Bacteria 854
42 Ga0068854_100742148 3300005578 Bacteria 851
43 Ga0068856_100459320 3300005614 Bacteria 1294
44 Ga0070702_100984362 3300005615 Bacteria 666
45 Ga0068852_100030308 3300005616 Bacteria 4452
46 Ga0068863_100308366 3300005841 Bacteria 1536
47 Ga0068858_100350835 3300005842 Bacteria 1413
48 Ga0097621_100177396 3300006237 Bacteria 1840
49 Ga0097621_101828692 3300006237 Bacteria 579
50 Ga0105240_10003519 3300009093 Bacteria 24297
51 Ga0105240_10113145 3300009093 Bacteria 3280
52 Ga0105240_10237809 3300009093 Bacteria 2113
53 Ga0105240_10398065 3300009093 Bacteria 1552
54 Ga0105240_12104210 3300009093 Bacteria 586
55 Ga0105243_10563412 3300009148 Bacteria 1091
56 Ga0105241_10006759 3300009174 Bacteria 8438
57 Ga0105237_10115452 3300009545 Bacteria 2678
58 Ga0105238_10003760 3300009551 Bacteria 15075
59 Ga0105238_10012544 3300009551 Bacteria 8554
60 Ga0105238_10017773 3300009551 Bacteria 7230
61 Ga0105238_11096092 3300009551 Bacteria 819
62 Ga0105239_10116014 3300010375 Bacteria 2971
63 Ga0105246_10147993 3300011119 Bacteria 1774
64 Ga0157371_10421103 3300013102 Bacteria 979
65 Ga0157370_10005540 3300013104 Bacteria 14154
66 Ga0157370_10194528 3300013104 Bacteria 1882
67 Ga0157370_10577757 3300013104 Bacteria 1030
68 Ga0157369_10040861 3300013105 Bacteria 5063
69 Ga0157369_10044907 3300013105 Bacteria 4807
70 Ga0163162_10566573 3300013306 Bacteria 1263
71 Ga0157372_10001008 3300013307 Bacteria 30796
72 Ga0157372_10656983 3300013307 Bacteria 1221
73 Ga0157372_11738722 3300013307 Bacteria 717
74 Ga0157375_10159920 3300013308 Bacteria 2394
75 Ga0157379_10781638 3300014968 Bacteria 900
76 Ga0157379_11208326 3300014968 Bacteria 727
77 Ga0157376_10131314 3300014969 Bacteria 2235
78 Ga0206353_10487905 3300020082 Bacteria 671
79 Ga0206353_10514258 3300020082 Bacteria 859
80 Ga0207705_10057884 3300025909 Bacteria 2796
81 Ga0207705_10109166 3300025909 Bacteria 2043
82 Ga0207705_10181047 3300025909 Bacteria 1590
83 Ga0207705_10222225 3300025909 Bacteria 1435
84 Ga0207654_10111285 3300025911 Bacteria 1704
85 Ga0207707_10021709 3300025912 Bacteria 5612
86 Ga0207707_10095826 3300025912 Bacteria 2593
87 Ga0207707_10412539 3300025912 Bacteria 1159
88 Ga0207707_11021802 3300025912 Bacteria 677
89 Ga0207707_11027432 3300025912 Bacteria 675
90 Ga0207695_10048847 3300025913 Bacteria 4465
91 Ga0207695_10054080 3300025913 Bacteria 4195
92 Ga0207695_10284041 3300025913 Bacteria 1548
93 Ga0207695_11374836 3300025913 Bacteria 586
94 Ga0207671_10033150 3300025914 Bacteria 3843
95 Ga0207663_10802831 3300025916 Bacteria 749
96 Ga0207660_10169151 3300025917 Bacteria 1691
97 Ga0207660_10307221 3300025917 Bacteria 1264
98 Ga0207660_10889276 3300025917 Unclassified 727
99 Ga0207657_10009930 3300025919 Bacteria 9527
100 Ga0207657_10063057 3300025919 Bacteria 3171
101 Ga0207657_10166453 3300025919 Bacteria 1788
102 Ga0207657_10186121 3300025919 Bacteria 1677
103 Ga0207657_10574530 3300025919 Bacteria 880
104 Ga0207649_10120453 3300025920 Bacteria 1768
105 Ga0207652_10019894 3300025921 Bacteria 5526
106 Ga0207652_10031047 3300025921 Bacteria 4483
107 Ga0207652_10031561 3300025921 Bacteria 4451
108 Ga0207652_10201100 3300025921 Bacteria 1793
109 Ga0207652_10506715 3300025921 Bacteria 1086
110 Ga0207652_10889322 3300025921 Bacteria 787
111 Ga0207694_10033281 3300025924 Bacteria 3949
112 Ga0207694_10193522 3300025924 Bacteria 1653
113 Ga0207694_10633470 3300025924 Bacteria 900
114 Ga0207694_11452197 3300025924 Bacteria 579
115 Ga0207659_10642477 3300025926 Bacteria 907
116 Ga0207664_10551854 3300025929 Bacteria 1034
117 Ga0207664_10997360 3300025929 Bacteria 751
118 Ga0207690_10016105 3300025932 Bacteria 4545
119 Ga0207690_10113581 3300025932 Bacteria 1955
120 Ga0207690_10277382 3300025932 Bacteria 1304
121 Ga0207690_10365192 3300025932 Bacteria 1144
122 Ga0207690_11221724 3300025932 Bacteria 628
123 Ga0207709_10610994 3300025935 Bacteria 864
124 Ga0207689_10446287 3300025942 Bacteria 1081
125 Ga0207679_10645710 3300025945 Bacteria 957
126 Ga0207679_10779943 3300025945 Bacteria 871
127 Ga0207679_11245325 3300025945 Bacteria 683
128 Ga0207667_10023042 3300025949 Bacteria 6862
129 Ga0207667_10057400 3300025949 Bacteria 4086
130 Ga0207667_10076948 3300025949 Bacteria 3462
131 Ga0207667_10169144 3300025949 Bacteria 2247
132 Ga0207667_10943195 3300025949 Bacteria 853
133 Ga0207703_11704628 3300026035 Bacteria 606
134 Ga0207678_10173561 3300026067 Bacteria 1840
135 Ga0207678_10219670 3300026067 Bacteria 1627
136 Ga0207702_10850659 3300026078 Bacteria 903
137 Ga0207702_11961346 3300026078 Bacteria 576
138 Ga0207702_12261462 3300026078 Bacteria 532
139 Ga0207674_10002919 3300026116 Bacteria 21222
140 Ga0207698_10634984 3300026142 Bacteria 1056
141 Ga0207698_12081705 3300026142 Bacteria 581
142 Ga0209999_1097013 3300027543 Bacteria 573
143 Ga0316182_1270126 3300030745 Bacteria 1395
144 Ga0316182_1322054 3300030745 Bacteria 912
145 Ga0265332_10000015 3300031238 Bacteria 243944
146 Ga0265328_10024290 3300031239 Bacteria 2291
147 Ga0265331_10391104 3300031250 Bacteria 623
148 Ga0265316_10268463 3300031344 Bacteria 1249
149 Ga0307509_10000033 3300031507 Bacteria 194363
150 Ga0307410_11220540 3300031852 Bacteria 656
151 Ga0307409_101216726 3300031995 Bacteria 777
152 Ga0307409_101389529 3300031995 Bacteria 728
153 Ga0307411_10991315 3300032005 Bacteria 752
154 Ga0373928_0089741 3300035084 Bacteria 787
155 Ga0373951_0043871 3300035091 Bacteria 1085
156 Ga0373952_0001886 3300035092 Bacteria 3808
157 Ga0373923_0633580 3300035111 Bacteria 528
158 Ga0373960_0131259 3300035121 Bacteria 840
159 Ga0373961_0107780 3300035241 Bacteria 909
160 Ga0373931_0538675 3300035691 Bacteria 757
161 Ga0395899_0078144 3300037312 Bacteria 2413
162 Ga0395900_0065872 3300037418 Bacteria 3722
163 Ga0395901_0640576 3300038443 Bacteria 1067
164 Ga0451807_2187714 3300041486 Bacteria 1150
165 Ga0451853_0859349 3300041512 Bacteria 563
166 Ga0439449_0027547 3300042007 Bacteria 2121
167 Ga0439435_0186342 3300042436 Bacteria 679
168 Ga0451577_0492644 3300042876 Bacteria 1113
169 Ga0451577_0660777 3300042876 Bacteria 948
170 Ga0451577_1132046 3300042876 Bacteria 700
171 Ga0451577_1189079 3300042876 Unclassified 680
172 Ga0451577_1451420 3300042876 Bacteria 608
173 Ga0451577_1744955 3300042876 Bacteria 547
174 Ga0453683_0186680 3300044673 Bacteria 1315
175 Ga0453683_0458325 3300044673 Bacteria 825
176 Ga0453684_0008924 3300044712 Bacteria 17750
177 Ga0453684_0110339 3300044712 Bacteria 3344
178 Ga0453684_0772878 3300044712 Bacteria 1038
179 Ga0453684_1552257 3300044712 Bacteria 681
180 Ga0453684_2453251 3300044712 Bacteria 515
181 Ga0451576_0162877 3300045051 Bacteria 2328
182 Ga0451576_0871527 3300045051 Bacteria 945
183 Ga0495627_051649 3300046453 Bacteria 1234
184 Ga0495629_0217668 3300046459 Bacteria 1318
185 Ga0495580_0583128 3300046472 Bacteria 740
186 Ga0495584_0001088 3300046491 Bacteria 16888
187 Ga0495584_0004590 3300046491 Bacteria 7401
188 Ga0495584_0016069 3300046491 Bacteria 3819
189 Ga0495585_0025216 3300046492 Bacteria 3408
190 Ga0495585_0043962 3300046492 Bacteria 2496
191 Ga0495585_0413500 3300046492 Bacteria 648
192 Ga0495594_0001450 3300046499 Bacteria 12301
193 Ga0495594_0009310 3300046499 Bacteria 5073
194 Ga0495616_0067023 3300046513 Bacteria 1746
195 Ga0495631_0034303 3300046518 Bacteria 2275
196 Ga0495631_0072439 3300046518 Bacteria 1488
197 Ga0495644_0034977 3300046523 Bacteria 1896
198 Ga0495644_0164885 3300046523 Bacteria 850
199 Ga0495663_0156695 3300046525 Bacteria 779
200 Ga0495663_0273397 3300046525 Bacteria 604
201 Ga0495666_0533931 3300046526 Bacteria 523
202 Ga0495642_0007598 3300046528 Bacteria 4153
203 Ga0495609_0010706 3300046538 Bacteria 4389
204 Ga0495597_0000845 3300046542 Bacteria 24087
205 Ga0495597_0087736 3300046542 Bacteria 1323
206 Ga0495622_0046283 3300046557 Bacteria 2021
207 Ga0495633_0039459 3300046558 Bacteria 2253
208 Ga0495633_0070449 3300046558 Bacteria 1632
209 Ga0495656_0112284 3300046615 Bacteria 1276
210 Ga0495668_0027664 3300046616 Bacteria 3213
211 Ga0495611_0005088 3300046648 Bacteria 5636
212 Ga0495611_0285054 3300046648 Bacteria 762
213 Ga0495611_0455998 3300046648 Bacteria 582
214 Ga0495661_0160061 3300046665 Bacteria 1209
215 Ga0495661_0403276 3300046665 Bacteria 664
216 Ga0495588_0134046 3300046674 Bacteria 1307
217 Ga0495670_0006248 3300046691 Bacteria 5846
218 Ga0495670_0369960 3300046691 Bacteria 772
219 Ga0495671_0092491 3300046692 Bacteria 1480
220 Ga0495589_0002383 3300046794 Bacteria 10561
221 Ga0495589_0091043 3300046794 Bacteria 1481
222 Ga0495636_0005432 3300047318 Bacteria 5008
223 Ga0495676_0284219 3300047321 Bacteria 1119
224 Ga0495683_0076762 3300047323 Bacteria 1634
225 Ga0495677_0001559 3300047445 Bacteria 9244
226 Ga0495677_0006657 3300047445 Bacteria 4355
227 Ga0495681_0043400 3300047470 Bacteria 2168
228 Ga0495681_0096280 3300047470 Bacteria 1300
229 Ga0495626_0001315 3300048091 Bacteria 20219
230 Ga0496115_0185316 3300048918 Bacteria 1720
231 Ga0496115_1264699 3300048918 Bacteria 551
232 Ga0501032_0443369 3300049569 Bacteria 832
233 Ga0501033_0369001 3300049570 Bacteria 1004
234 Ga0501034_0000535 3300049571 Bacteria 60322
235 Ga0501034_0096883 3300049571 Bacteria 2946
236 Ga0501036_0168352 3300049572 Bacteria 1847
237 Ga0501038_0670853 3300049574 Bacteria 779
238 Ga0501040_0212287 3300049576 Bacteria 1376
239 Ga0501041_0062175 3300049577 Bacteria 2286
240 Ga0501041_0939859 3300049577 Bacteria 556
241 Ga0501042_0444807 3300049578 Bacteria 940
242 Ga0501043_0719048 3300049579 Bacteria 728
243 Ga0501046_0363003 3300049580 Bacteria 1050
244 Ga0501047_0014672 3300049581 Bacteria 7456
245 Ga0501047_1205302 3300049581 Bacteria 571
246 Ga0501048_0106727 3300049582 Bacteria 1977
247 Ga0501067_0204709 3300049583 Bacteria 1099
248 Ga0501068_0217653 3300049584 Bacteria 1213
249 Ga0501069_0008854 3300049585 Bacteria 5304
250 Ga0501069_0886766 3300049585 Bacteria 542
251 Ga0501070_0015742 3300049586 Bacteria 6359
252 Ga0501070_0428603 3300049586 Bacteria 1068
253 Ga0501070_0683966 3300049586 Bacteria 812
254 Ga0501071_0430172 3300049587 Bacteria 1009
255 Ga0501072_0115630 3300049588 Bacteria 2136
256 Ga0501072_0744358 3300049588 Bacteria 769
257 Ga0501073_0001729 3300049589 Bacteria 16235
258 Ga0501073_0231318 3300049589 Bacteria 1277
259 Ga0501074_0003682 3300049590 Bacteria 10868
260 Ga0501076_0232905 3300049592 Bacteria 1506
261 Ga0501077_0710712 3300049593 Bacteria 646
262 Ga0501079_0018481 3300049741 Bacteria 5326
263 Ga0501080_0174607 3300049742 Bacteria 1980
264 Ga0501083_0002362 3300049744 Bacteria 12921
265 Ga0501266_026066 3300049763 Bacteria 817
266 Ga0501045_0020165 3300049824 Bacteria 4760
267 Ga0501084_0664804 3300054114 Bacteria 879
268 Ga0501084_1184097 3300054114 Bacteria 641
269 Ga0501082_0616628 3300060353 Bacteria 949
270 Ga0501082_1635676 3300060353 Bacteria 562
271 2597031847 2596583598 Bacteria 5251611
272 Ga0070679_101568784
273 Ga0070658_10007312
274 Ga0070658_10168956
275 Ga0070680_100105527
276 Ga0070680_100274014
277 Ga0070682_100369238
278 Ga0070660_100174817
279 Ga0070660_101234465
280 Ga0070687_101367288
281 Ga0070659_100033200
282 Ga0070659_100043943
283 Ga0070659_100204571
284 Ga0070659_101884946
285 Ga0070667_100419100
286 Ga0070714_100083323
287 Ga0070711_100523584
288 Ga0070705_100291640
289 Ga0070681_10002564
290 Ga0070681_10078415
291 Ga0070681_10139629
292 Ga0070681_11009391
293 Ga0070679_100020328
294 Ga0070679_100032967
295 Ga0070679_100136466
296 Ga0070679_100137214
297 Ga0070679_100293214
298 Ga0070679_100411074
299 Ga0070684_100543029
300 Ga0070684_100865292
301 Ga0068853_100471949
302 Ga0070704_100317037
303 Ga0068855_100037482
304 Ga0068855_100159730
305 Ga0068855_100163411
306 Ga0068855_100885229
307 Ga0068855_101165209
308 Ga0070664_101059188
309 Ga0070664_101329363
310 Ga0070664_101479926
311 Ga0068857_100001372
312 Ga0068857_100888465
313 Ga0068854_100742148
314 Ga0068856_100459320
315 Ga0070702_100984362
316 Ga0068852_100030308
317 Ga0068863_100308366
318 Ga0068858_100350835
319 Ga0097621_100177396
320 Ga0097621_101828692
321 Ga0105240_10003519
322 Ga0105240_10113145
323 Ga0105240_10237809
324 Ga0105240_10398065
325 Ga0105240_12104210
326 Ga0105243_10563412
327 Ga0105241_10006759
328 Ga0105237_10115452
329 Ga0105238_10003760
330 Ga0105238_10012544
331 Ga0105238_10017773
332 Ga0105238_11096092
333 Ga0105239_10116014
334 Ga0105246_10147993
335 Ga0157371_10421103
336 Ga0157370_10005540
337 Ga0157370_10194528
338 Ga0157370_10577757
339 Ga0157369_10040861
340 Ga0157369_10044907
341 Ga0163162_10566573
342 Ga0157372_10001008
343 Ga0157372_10656983
344 Ga0157372_11738722
345 Ga0157375_10159920
346 Ga0157379_10781638
347 Ga0157379_11208326
348 Ga0157376_10131314
349 Ga0206353_10487905
350 Ga0206353_10514258
351 Ga0207705_10057884
352 Ga0207705_10109166
353 Ga0207705_10181047
354 Ga0207705_10222225
355 Ga0207654_10111285
356 Ga0207707_10021709
357 Ga0207707_10095826
358 Ga0207707_10412539
359 Ga0207707_11021802
360 Ga0207707_11027432
361 Ga0207695_10048847
362 Ga0207695_10054080
363 Ga0207695_10284041
364 Ga0207695_11374836
365 Ga0207671_10033150
366 Ga0207663_10802831
367 Ga0207660_10169151
368 Ga0207660_10307221
369 Ga0207660_10889276
370 Ga0207657_10009930
371 Ga0207657_10063057
372 Ga0207657_10166453
373 Ga0207657_10186121
374 Ga0207657_10574530
375 Ga0207649_10120453
376 Ga0207652_10019894
377 Ga0207652_10031047
378 Ga0207652_10031561
379 Ga0207652_10201100
380 Ga0207652_10506715
381 Ga0207652_10889322
382 Ga0207694_10033281
383 Ga0207694_10193522
384 Ga0207694_10633470
385 Ga0207694_11452197
386 Ga0207659_10642477
387 Ga0207664_10551854
388 Ga0207664_10997360
389 Ga0207690_10016105
390 Ga0207690_10113581
391 Ga0207690_10277382
392 Ga0207690_10365192
393 Ga0207690_11221724
394 Ga0207709_10610994
395 Ga0207689_10446287
396 Ga0207679_10645710
397 Ga0207679_10779943
398 Ga0207679_11245325
399 Ga0207667_10023042
400 Ga0207667_10057400
401 Ga0207667_10076948
402 Ga0207667_10169144
403 Ga0207667_10943195
404 Ga0207703_11704628
405 Ga0207678_10173561
406 Ga0207678_10219670
407 Ga0207702_10850659
408 Ga0207702_11961346
409 Ga0207702_12261462
410 Ga0207674_10002919
411 Ga0207698_10634984
412 Ga0207698_12081705
413 Ga0209999_1097013
414 Ga0316182_1270126
415 Ga0316182_1322054
416 Ga0265332_10000015
417 Ga0265328_10024290
418 Ga0265331_10391104
419 Ga0265316_10268463
420 Ga0307509_10000033
421 Ga0307410_11220540
422 Ga0307409_101216726
423 Ga0307409_101389529
424 Ga0307411_10991315
425 Ga0373928_0089741
426 Ga0373951_0043871
427 Ga0373952_0001886
428 Ga0373923_0633580
429 Ga0373960_0131259
430 Ga0373961_0107780
431 Ga0373931_0538675
432 Ga0395899_0078144
433 Ga0395900_0065872
434 Ga0395901_0640576
435 Ga0451807_2187714
436 Ga0451853_0859349
437 Ga0439449_0027547
438 Ga0439435_0186342
439 Ga0451577_0492644
440 Ga0451577_0660777
441 Ga0451577_1132046
442 Ga0451577_1189079
443 Ga0451577_1451420
444 Ga0451577_1744955
445 Ga0453683_0186680
446 Ga0453683_0458325
447 Ga0453684_0008924
448 Ga0453684_0110339
449 Ga0453684_0772878
450 Ga0453684_1552257
451 Ga0453684_2453251
452 Ga0451576_0162877
453 Ga0451576_0871527
454 Ga0495627_051649
455 Ga0495629_0217668
456 Ga0495580_0583128
457 Ga0495584_0001088
458 Ga0495584_0004590
459 Ga0495584_0016069
460 Ga0495585_0025216
461 Ga0495585_0043962
462 Ga0495585_0413500
463 Ga0495594_0001450
464 Ga0495594_0009310
465 Ga0495616_0067023
466 Ga0495631_0034303
467 Ga0495631_0072439
468 Ga0495644_0034977
469 Ga0495644_0164885
470 Ga0495663_0156695
471 Ga0495663_0273397
472 Ga0495666_0533931
473 Ga0495642_0007598
474 Ga0495609_0010706
475 Ga0495597_0000845
476 Ga0495597_0087736
477 Ga0495622_0046283
478 Ga0495633_0039459
479 Ga0495633_0070449
480 Ga0495656_0112284
481 Ga0495668_0027664
482 Ga0495611_0005088
483 Ga0495611_0285054
484 Ga0495611_0455998
485 Ga0495661_0160061
486 Ga0495661_0403276
487 Ga0495588_0134046
488 Ga0495670_0006248
489 Ga0495670_0369960
490 Ga0495671_0092491
491 Ga0495589_0002383
492 Ga0495589_0091043
493 Ga0495636_0005432
494 Ga0495676_0284219
495 Ga0495683_0076762
496 Ga0495677_0001559
497 Ga0495677_0006657
498 Ga0495681_0043400
499 Ga0495681_0096280
500 Ga0495626_0001315
501 Ga0496115_0185316
502 Ga0496115_1264699
503 Ga0501032_0443369
504 Ga0501033_0369001
505 Ga0501034_0000535
506 Ga0501034_0096883
507 Ga0501036_0168352
508 Ga0501038_0670853
509 Ga0501040_0212287
510 Ga0501041_0062175
511 Ga0501041_0939859
512 Ga0501042_0444807
513 Ga0501043_0719048
514 Ga0501046_0363003
515 Ga0501047_0014672
516 Ga0501047_1205302
517 Ga0501048_0106727
518 Ga0501067_0204709
519 Ga0501068_0217653
520 Ga0501069_0008854
521 Ga0501069_0886766
522 Ga0501070_0015742
523 Ga0501070_0428603
524 Ga0501070_0683966
525 Ga0501071_0430172
526 Ga0501072_0115630
527 Ga0501072_0744358
528 Ga0501073_0001729
529 Ga0501073_0231318
530 Ga0501074_0003682
531 Ga0501076_0232905
532 Ga0501077_0710712
533 Ga0501079_0018481
534 Ga0501080_0174607
535 Ga0501083_0002362
536 Ga0501266_026066
537 Ga0501045_0020165
538 Ga0501084_0664804
539 Ga0501084_1184097
540 Ga0501082_0616628
541 Ga0501082_1635676
542 2597031847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10006

DUF2249

Uncharacterized conserved protein (DUF2249)

31

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lxr-assembly1.cif.gz_A solution structure of hp1264 from helicobacter pylori 0.7422 16 86
3dul-assembly1.cif.gz_A crystal structure analysis of the o-methyltransferase from bacillus cereus 0.7031 11 86
7wdq-assembly1.cif.gz_C dsyb in complex with sam 0.7008 10 86
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.6984 11 86
5c37-assembly2.cif.gz_C structure of the beta-ketoacyl reductase domain of human fatty acid synthase bound to a spiro-imidazolone inhibitor 0.6972 13 85
ID Description Score Start End Superfamily
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.7765 13 85 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.7587 13 85 3.30.110.40
2lxrA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.7422 16 86 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.7362 15 85 3.30.110.40
af_Q6DHC5_5_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7344 13 86 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6G7ZY28-F1-model_v4 DUF2249 domain-containing protein 1.003 13 85
AF-N6ZFQ0-F1-model_v4 DUF2249 domain-containing protein 1.002 13 85
AF-A0A522KMC3-F1-model_v4 DUF2249 domain-containing protein 0.9985 13 86
AF-A0A5C7UMD6-F1-model_v4 DUF2249 domain-containing protein 0.9921 28 86
AF-A0A522TVH9-F1-model_v4 DUF2249 domain-containing protein 0.9915 13 86

Map