F377410

General Info

Members Datasets Scaffolds Average Seq Length
271 183 542 275

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10037509|Ga0065707_100375092
Length 301
Sequence MEHIRIAREGPVGIITIDRTARFNSLDVATAQDLRRAGLQMARDDAVRAVILRGEGGAFCSGADLKYIAAGGEDEDLAYLTPAGRDVPAGFGERFKQILEYLHSTISEIRRAPKPFIAAVDGIAAAGGFGLAMSCDLVIASSRASFEWAYGKTGLTGAESSTFLLPRLIGLRRCMELMLLNPRLGADQAVAMGLATRVVPVDLFDLAVLGIAHQLAEGPTRAFGTAKALINQAAGIDRLDFHLDQELQHLARSADSTEFHEGLRAFFEKRPANFSACARVDGSASSGETSPQPFRGGGGHA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 1.48
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10037509 3300005295 Bacteria 1080
2 Ga0065707_10084219 3300005295 Bacteria 7504
3 Ga0070676_10072087 3300005328 Bacteria 2076
4 Ga0070683_100000084 3300005329 Bacteria 64212
5 Ga0070690_100151812 3300005330 Bacteria 1581
6 Ga0070690_100211821 3300005330 Unclassified 1353
7 Ga0070670_100015746 3300005331 Bacteria 6491
8 Ga0070670_100108179 3300005331 Bacteria 2396
9 Ga0068869_100045543 3300005334 Bacteria 3159
10 Ga0068869_100126348 3300005334 Bacteria 1961
11 Ga0070689_100075706 3300005340 Bacteria 2636
12 Ga0070689_100083429 3300005340 Bacteria 2511
13 Ga0070689_100143124 3300005340 Bacteria 1924
14 Ga0070687_100036162 3300005343 Bacteria 2458
15 Ga0070692_10021466 3300005345 Bacteria 3141
16 Ga0070669_100103465 3300005353 Bacteria 2152
17 Ga0070675_100000026 3300005354 Bacteria 113553
18 Ga0070675_100000325 3300005354 Bacteria 32228
19 Ga0070675_100435623 3300005354 Bacteria 1174
20 Ga0070675_100541912 3300005354 Bacteria 1052
21 Ga0070671_100026751 3300005355 Bacteria 4745
22 Ga0070671_100198463 3300005355 Unclassified 1701
23 Ga0070674_100096917 3300005356 Bacteria 2141
24 Ga0070674_100271372 3300005356 Bacteria 1341
25 Ga0070673_100011118 3300005364 Bacteria 6136
26 Ga0070673_100062715 3300005364 Bacteria 2954
27 Ga0070688_100011060 3300005365 Bacteria 5006
28 Ga0070667_100156546 3300005367 Bacteria 2004
29 Ga0070709_10030667 3300005434 Bacteria 3229
30 Ga0070713_100062479 3300005436 Bacteria 3120
31 Ga0070713_100110446 3300005436 Unclassified 2397
32 Ga0070701_10000269 3300005438 Bacteria 16962
33 Ga0070705_100077385 3300005440 Unclassified 2031
34 Ga0070700_100047919 3300005441 Bacteria 2646
35 Ga0068867_100040884 3300005459 Bacteria 3387
36 Ga0070685_10267662 3300005466 Bacteria 1139
37 Ga0070707_100031746 3300005468 Bacteria 5032
38 Ga0070699_100126743 3300005518 Bacteria 2248
39 Ga0070684_100001150 3300005535 Bacteria 19031
40 Ga0070697_100343000 3300005536 Unclassified 1289
41 Ga0068853_100103323 3300005539 Unclassified 2522
42 Ga0070672_100083847 3300005543 Bacteria 2559
43 Ga0070672_100616217 3300005543 Unclassified 946
44 Ga0070686_100039662 3300005544 Bacteria 2935
45 Ga0070686_100059407 3300005544 Bacteria 2463
46 Ga0070695_100264667 3300005545 Bacteria 1257
47 Ga0070704_100176523 3300005549 Unclassified 1704
48 Ga0068857_100018435 3300005577 Bacteria 6123
49 Ga0068854_100002086 3300005578 Bacteria 12254
50 Ga0068854_100021026 3300005578 Bacteria 4423
51 Ga0068856_100267081 3300005614 Bacteria 1727
52 Ga0070702_100000514 3300005615 Bacteria 13931
53 Ga0068852_100453689 3300005616 Unclassified 1270
54 Ga0068859_100014395 3300005617 Bacteria 7937
55 Ga0068859_100065593 3300005617 Bacteria 3664
56 Ga0068861_100020451 3300005719 Bacteria 4742
57 Ga0068861_100101256 3300005719 Bacteria 2291
58 Ga0068863_100129272 3300005841 Bacteria 2411
59 Ga0068858_100423368 3300005842 Unclassified 1280
60 Ga0068862_100400691 3300005844 Unclassified 1283
61 Ga0070717_10000175 3300006028 Bacteria 47981
62 Ga0075365_10440841 3300006038 Bacteria 920
63 Ga0075364_10027918 3300006051 Bacteria 3608
64 Ga0075362_10015996 3300006177 Bacteria 3063
65 Ga0075367_10004021 3300006178 Bacteria 7109
66 Ga0075366_10085895 3300006195 Bacteria 1882
67 Ga0068871_100392445 3300006358 Unclassified 1235
68 Ga0075428_100346324 3300006844 Bacteria 1595
69 Ga0075430_100206060 3300006846 Bacteria 1632
70 Ga0075433_10132671 3300006852 Bacteria 2213
71 Ga0075429_100045232 3300006880 Bacteria 3830
72 Ga0075429_100072773 3300006880 Bacteria 2993
73 Ga0075429_100130518 3300006880 Bacteria 2198
74 Ga0075436_100005705 3300006914 Bacteria 8549
75 Ga0097620_100014395 3300006931 Bacteria 7937
76 Ga0097620_100065595 3300006931 Bacteria 3664
77 Ga0075435_100000403 3300007076 Bacteria 26488
78 Ga0075435_100005109 3300007076 Bacteria 9120
79 Ga0075435_100008463 3300007076 Bacteria 7383
80 Ga0105244_10035998 3300009036 Bacteria 2596
81 Ga0105240_10004685 3300009093 Bacteria 20681
82 Ga0111539_10000004 3300009094 Bacteria 751278
83 Ga0111539_10620516 3300009094 Bacteria 1259
84 Ga0105245_10000005 3300009098 Bacteria 335871
85 Ga0105245_10000112 3300009098 Bacteria 78964
86 Ga0105245_10054908 3300009098 Bacteria 3577
87 Ga0114129_10016584 3300009147 Bacteria 10493
88 Ga0105242_10001188 3300009176 Bacteria 20533
89 Ga0105242_10136912 3300009176 Unclassified 2120
90 Ga0105248_10118127 3300009177 Bacteria 2991
91 Ga0105248_10193151 3300009177 Bacteria 2294
92 Ga0157369_10000503 3300013105 Bacteria 51496
93 Ga0157378_10000013 3300013297 Bacteria 151930
94 Ga0157378_10000109 3300013297 Bacteria 78488
95 Ga0157378_10526555 3300013297 Bacteria 1184
96 Ga0163162_10148830 3300013306 Bacteria 2458
97 Ga0163162_10526098 3300013306 Unclassified 1312
98 Ga0157375_10000022 3300013308 Bacteria 239765
99 Ga0157375_10000247 3300013308 Bacteria 49223
100 Ga0157375_10351544 3300013308 Bacteria 1640
101 Ga0157380_10727133 3300014326 Bacteria 1001
102 Ga0157377_10000060 3300014745 Bacteria 82791
103 Ga0157379_10340795 3300014968 Bacteria 1371
104 Ga0157376_10000006 3300014969 Bacteria 368549
105 Ga0213876_10000177 3300021384 Bacteria 65884
106 Ga0213876_10025230 3300021384 Bacteria 3137
107 Ga0207697_10070848 3300025315 Unclassified 1461
108 Ga0207656_10038847 3300025321 Bacteria 2010
109 Ga0207656_10086651 3300025321 Bacteria 1416
110 Ga0207688_10134850 3300025901 Unclassified 1449
111 Ga0207680_10060127 3300025903 Unclassified 2311
112 Ga0207699_10350838 3300025906 Bacteria 1041
113 Ga0207645_10022609 3300025907 Bacteria 4088
114 Ga0207705_10322774 3300025909 Unclassified 1187
115 Ga0207684_10465009 3300025910 Unclassified 1086
116 Ga0207654_10165803 3300025911 Unclassified 1430
117 Ga0207695_10007244 3300025913 Bacteria 14170
118 Ga0207662_10001520 3300025918 Bacteria 11299
119 Ga0207662_10243151 3300025918 Bacteria 1179
120 Ga0207649_10081365 3300025920 Unclassified 2097
121 Ga0207681_10428134 3300025923 Unclassified 1073
122 Ga0207650_10000026 3300025925 Bacteria 264152
123 Ga0207650_10030406 3300025925 Bacteria 3890
124 Ga0207650_10148455 3300025925 Bacteria 1848
125 Ga0207659_10000002 3300025926 Bacteria 619441
126 Ga0207659_10000952 3300025926 Bacteria 17318
127 Ga0207659_10384979 3300025926 Bacteria 1170
128 Ga0207687_10000005 3300025927 Bacteria 770649
129 Ga0207687_10026677 3300025927 Bacteria 3870
130 Ga0207700_10007493 3300025928 Bacteria 6675
131 Ga0207644_10051704 3300025931 Bacteria 2950
132 Ga0207706_10095650 3300025933 Bacteria 2613
133 Ga0207686_10001668 3300025934 Bacteria 12365
134 Ga0207686_10027487 3300025934 Bacteria 3333
135 Ga0207709_10144861 3300025935 Bacteria 1638
136 Ga0207670_10115946 3300025936 Bacteria 1938
137 Ga0207704_10147311 3300025938 Bacteria 1656
138 Ga0207665_10184958 3300025939 Bacteria 1511
139 Ga0207691_10008012 3300025940 Bacteria 10156
140 Ga0207691_10131922 3300025940 Bacteria 2206
141 Ga0207711_10047513 3300025941 Bacteria 3670
142 Ga0207711_10594016 3300025941 Unclassified 1033
143 Ga0207689_10005211 3300025942 Bacteria 11666
144 Ga0207689_10107096 3300025942 Bacteria 2297
145 Ga0207661_10000037 3300025944 Bacteria 148458
146 Ga0207661_10002692 3300025944 Bacteria 12220
147 Ga0207661_10447794 3300025944 Bacteria 1176
148 Ga0207679_10192333 3300025945 Bacteria 1698
149 Ga0207679_10216301 3300025945 Bacteria 1610
150 Ga0207651_10007159 3300025960 Bacteria 5927
151 Ga0207651_10099944 3300025960 Bacteria 2150
152 Ga0207651_10112027 3300025960 Bacteria 2050
153 Ga0207640_10007527 3300025981 Bacteria 6014
154 Ga0207658_10012517 3300025986 Bacteria 5795
155 Ga0207658_10038966 3300025986 Bacteria 3427
156 Ga0207703_10054540 3300026035 Bacteria 3251
157 Ga0207639_10000005 3300026041 Bacteria 579948
158 Ga0207708_10036823 3300026075 Bacteria 3726
159 Ga0207648_10056277 3300026089 Bacteria 3433
160 Ga0207648_10058963 3300026089 Bacteria 3348
161 Ga0207676_10680560 3300026095 Bacteria 995
162 Ga0207674_10009956 3300026116 Bacteria 10817
163 Ga0207675_100006162 3300026118 Bacteria 11394
164 Ga0207675_100030036 3300026118 Bacteria 5059
165 Ga0209974_10032653 3300027876 Bacteria 1725
166 Ga0209974_10059653 3300027876 Bacteria 1290
167 Ga0207428_10000006 3300027907 Bacteria 491716
168 Ga0268264_10243939 3300028381 Unclassified 1665
169 Ga0307511_10002299 3300030521 Bacteria 19969
170 Ga0307509_10000069 3300031507 Bacteria 141246
171 Ga0307509_10026866 3300031507 Bacteria 6412
172 Ga0307508_10064921 3300031616 Bacteria 3217
173 Ga0307508_10084467 3300031616 Bacteria 2757
174 Ga0307410_10010573 3300031852 Bacteria 5234
175 Ga0307407_10012683 3300031903 Bacteria 4061
176 Ga0307409_100010666 3300031995 Bacteria 5733
177 Ga0307411_10130118 3300032005 Bacteria 1838
178 Ga0307507_10101710 3300033179 Bacteria 2402
179 Ga0373926_0008056 3300035083 Bacteria 3510
180 Ga0373949_0000125 3300035090 Bacteria 28484
181 Ga0373932_0000080 3300035112 Bacteria 24673
182 Ga0373941_0014489 3300035115 Bacteria 2108
183 Ga0373943_0137736 3300035170 Bacteria 1312
184 Ga0373924_0006812 3300035410 Bacteria 4106
185 Ga0373935_0039364 3300035692 Bacteria 2965
186 Ga0373935_0138393 3300035692 Bacteria 1643
187 Ga0373933_0013313 3300035724 Bacteria 4558
188 Ga0373937_0000507 3300036401 Bacteria 35568
189 Ga0373925_0003496 3300037068 Bacteria 12136
190 Ga0436365_0670421 3300039437 Bacteria 180224
191 Ga0436365_1251353 3300039437 Bacteria 4269
192 Ga0436362_0953783 3300039453 Bacteria 9541
193 Ga0439456_028705 3300042013 Bacteria 1187
194 Ga0450920_023658 3300042122 Bacteria 1191
195 Ga0439435_0086499 3300042436 Bacteria 947
196 Ga0453684_0227275 3300044712 Bacteria 2157
197 Ga0451576_0013533 3300045051 Bacteria 9126
198 Ga0451576_0218388 3300045051 Bacteria 1991
199 Ga0451576_0308742 3300045051 Bacteria 1655
200 Ga0495629_0229418 3300046459 Bacteria 1280
201 Ga0495580_0054355 3300046472 Bacteria 2825
202 Ga0495608_0182968 3300046511 Bacteria 1325
203 Ga0495628_0000013 3300046516 Bacteria 211823
204 Ga0495613_0239679 3300046689 Bacteria 1268
205 Ga0495680_0109997 3300047322 Bacteria 2043
206 Ga0496104_0302726 3300048907 Bacteria 1511
207 Ga0496109_0480812 3300048912 Bacteria 1173
208 Ga0496112_0089417 3300048915 Bacteria 3048
209 Ga0496112_0108097 3300048915 Bacteria 2751
210 Ga0501031_0094827 3300049568 Bacteria 1947
211 Ga0501031_0249657 3300049568 Bacteria 1153
212 Ga0501036_0053229 3300049572 Bacteria 3428
213 Ga0501038_0140737 3300049574 Bacteria 1974
214 Ga0501039_0291187 3300049575 Bacteria 1283
215 Ga0501040_0032572 3300049576 Bacteria 3527
216 Ga0501040_0080417 3300049576 Bacteria 2257
217 Ga0501041_0024609 3300049577 Bacteria 3615
218 Ga0501042_0019861 3300049578 Bacteria 4672
219 Ga0501042_0031313 3300049578 Bacteria 3762
220 Ga0501046_0102007 3300049580 Bacteria 2200
221 Ga0501048_0137693 3300049582 Bacteria 1725
222 Ga0501068_0146935 3300049584 Bacteria 1480
223 Ga0501070_0001373 3300049586 Bacteria 21768
224 Ga0501071_0042805 3300049587 Bacteria 3246
225 Ga0501072_0002945 3300049588 Bacteria 12813
226 Ga0501072_0056200 3300049588 Bacteria 3101
227 Ga0501072_0098294 3300049588 Bacteria 2327
228 Ga0501072_0227273 3300049588 Bacteria 1487
229 Ga0501073_0011332 3300049589 Bacteria 6521
230 Ga0501073_0257771 3300049589 Bacteria 1204
231 Ga0501075_0007434 3300049591 Bacteria 7597
232 Ga0501075_0017409 3300049591 Bacteria 5191
233 Ga0501075_0271919 3300049591 Bacteria 1291
234 Ga0501076_0014664 3300049592 Bacteria 5908
235 Ga0501076_0018263 3300049592 Bacteria 5344
236 Ga0501076_0064722 3300049592 Bacteria 2915
237 Ga0501076_0281379 3300049592 Bacteria 1363
238 Ga0501076_0283861 3300049592 Bacteria 1356
239 Ga0501076_0400462 3300049592 Bacteria 1129
240 Ga0501079_0026304 3300049741 Bacteria 4462
241 Ga0501079_0201590 3300049741 Unclassified 1554
242 Ga0501081_0014066 3300049743 Bacteria 5273
243 Ga0501081_0017225 3300049743 Bacteria 4780
244 Ga0501081_0036811 3300049743 Bacteria 3337
245 Ga0501081_0095990 3300049743 Bacteria 2091
246 Ga0501083_0053900 3300049744 Bacteria 2699
247 Ga0501035_0363291 3300049822 Bacteria 1210
248 Ga0501045_0050819 3300049824 Bacteria 3025
249 nmdc:mga03683_21232_c1 3300050489 Bacteria 2500
250 nmdc:mga00v17_29604_c1 3300050491 Bacteria 3215
251 nmdc:mga0k408_43075_c1 3300050493 Bacteria 2600
252 nmdc:mga06z11_1770_c1 3300050494 Bacteria 8117
253 nmdc:mga05p37_472540_c1 3300050507 Unclassified 1446
254 nmdc:mga09592_11656_c1 3300050508 Bacteria 6493
255 nmdc:mga09592_193730_c1 3300050508 Unclassified 1759
256 nmdc:mga09592_92294_c1 3300050508 Bacteria 2588
257 nmdc:mga09592_93211_c1 3300050508 Bacteria 2575
258 nmdc:mga0qj67_388247_c1 3300050509 Bacteria 1127
259 nmdc:mga08y16_468446_c1 3300050511 Unclassified 1283
260 nmdc:mga08y16_47760_c1 3300050511 Bacteria 4480
261 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
262 nmdc:mga0rr50_108646_c1 3300050513 Bacteria 2192
263 nmdc:mga0rr50_124_c1 3300050513 Bacteria 42824
264 nmdc:mga0rr50_4581_c1 3300050513 Bacteria 8138
265 nmdc:mga08x19_4159_c1 3300050514 Bacteria 8578
266 nmdc:mga0a205_64902_c2 3300050515 Bacteria 2249
267 Ga0500630_032317 3300053159 Bacteria 2570
268 Ga0501084_0270520 3300054114 Bacteria 1435
269 Ga0501084_0328756 3300054114 Bacteria 1291
270 Ga0501082_0094861 3300060353 Bacteria 2578
271 Ga0501082_0344533 3300060353 Unclassified 1299
272 Ga0065707_10037509
273 Ga0065707_10084219
274 Ga0070676_10072087
275 Ga0070683_100000084
276 Ga0070690_100151812
277 Ga0070690_100211821
278 Ga0070670_100015746
279 Ga0070670_100108179
280 Ga0068869_100045543
281 Ga0068869_100126348
282 Ga0070689_100075706
283 Ga0070689_100083429
284 Ga0070689_100143124
285 Ga0070687_100036162
286 Ga0070692_10021466
287 Ga0070669_100103465
288 Ga0070675_100000026
289 Ga0070675_100000325
290 Ga0070675_100435623
291 Ga0070675_100541912
292 Ga0070671_100026751
293 Ga0070671_100198463
294 Ga0070674_100096917
295 Ga0070674_100271372
296 Ga0070673_100011118
297 Ga0070673_100062715
298 Ga0070688_100011060
299 Ga0070667_100156546
300 Ga0070709_10030667
301 Ga0070713_100062479
302 Ga0070713_100110446
303 Ga0070701_10000269
304 Ga0070705_100077385
305 Ga0070700_100047919
306 Ga0068867_100040884
307 Ga0070685_10267662
308 Ga0070707_100031746
309 Ga0070699_100126743
310 Ga0070684_100001150
311 Ga0070697_100343000
312 Ga0068853_100103323
313 Ga0070672_100083847
314 Ga0070672_100616217
315 Ga0070686_100039662
316 Ga0070686_100059407
317 Ga0070695_100264667
318 Ga0070704_100176523
319 Ga0068857_100018435
320 Ga0068854_100002086
321 Ga0068854_100021026
322 Ga0068856_100267081
323 Ga0070702_100000514
324 Ga0068852_100453689
325 Ga0068859_100014395
326 Ga0068859_100065593
327 Ga0068861_100020451
328 Ga0068861_100101256
329 Ga0068863_100129272
330 Ga0068858_100423368
331 Ga0068862_100400691
332 Ga0070717_10000175
333 Ga0075365_10440841
334 Ga0075364_10027918
335 Ga0075362_10015996
336 Ga0075367_10004021
337 Ga0075366_10085895
338 Ga0068871_100392445
339 Ga0075428_100346324
340 Ga0075430_100206060
341 Ga0075433_10132671
342 Ga0075429_100045232
343 Ga0075429_100072773
344 Ga0075429_100130518
345 Ga0075436_100005705
346 Ga0097620_100014395
347 Ga0097620_100065595
348 Ga0075435_100000403
349 Ga0075435_100005109
350 Ga0075435_100008463
351 Ga0105244_10035998
352 Ga0105240_10004685
353 Ga0111539_10000004
354 Ga0111539_10620516
355 Ga0105245_10000005
356 Ga0105245_10000112
357 Ga0105245_10054908
358 Ga0114129_10016584
359 Ga0105242_10001188
360 Ga0105242_10136912
361 Ga0105248_10118127
362 Ga0105248_10193151
363 Ga0157369_10000503
364 Ga0157378_10000013
365 Ga0157378_10000109
366 Ga0157378_10526555
367 Ga0163162_10148830
368 Ga0163162_10526098
369 Ga0157375_10000022
370 Ga0157375_10000247
371 Ga0157375_10351544
372 Ga0157380_10727133
373 Ga0157377_10000060
374 Ga0157379_10340795
375 Ga0157376_10000006
376 Ga0213876_10000177
377 Ga0213876_10025230
378 Ga0207697_10070848
379 Ga0207656_10038847
380 Ga0207656_10086651
381 Ga0207688_10134850
382 Ga0207680_10060127
383 Ga0207699_10350838
384 Ga0207645_10022609
385 Ga0207705_10322774
386 Ga0207684_10465009
387 Ga0207654_10165803
388 Ga0207695_10007244
389 Ga0207662_10001520
390 Ga0207662_10243151
391 Ga0207649_10081365
392 Ga0207681_10428134
393 Ga0207650_10000026
394 Ga0207650_10030406
395 Ga0207650_10148455
396 Ga0207659_10000002
397 Ga0207659_10000952
398 Ga0207659_10384979
399 Ga0207687_10000005
400 Ga0207687_10026677
401 Ga0207700_10007493
402 Ga0207644_10051704
403 Ga0207706_10095650
404 Ga0207686_10001668
405 Ga0207686_10027487
406 Ga0207709_10144861
407 Ga0207670_10115946
408 Ga0207704_10147311
409 Ga0207665_10184958
410 Ga0207691_10008012
411 Ga0207691_10131922
412 Ga0207711_10047513
413 Ga0207711_10594016
414 Ga0207689_10005211
415 Ga0207689_10107096
416 Ga0207661_10000037
417 Ga0207661_10002692
418 Ga0207661_10447794
419 Ga0207679_10192333
420 Ga0207679_10216301
421 Ga0207651_10007159
422 Ga0207651_10099944
423 Ga0207651_10112027
424 Ga0207640_10007527
425 Ga0207658_10012517
426 Ga0207658_10038966
427 Ga0207703_10054540
428 Ga0207639_10000005
429 Ga0207708_10036823
430 Ga0207648_10056277
431 Ga0207648_10058963
432 Ga0207676_10680560
433 Ga0207674_10009956
434 Ga0207675_100006162
435 Ga0207675_100030036
436 Ga0209974_10032653
437 Ga0209974_10059653
438 Ga0207428_10000006
439 Ga0268264_10243939
440 Ga0307511_10002299
441 Ga0307509_10000069
442 Ga0307509_10026866
443 Ga0307508_10064921
444 Ga0307508_10084467
445 Ga0307410_10010573
446 Ga0307407_10012683
447 Ga0307409_100010666
448 Ga0307411_10130118
449 Ga0307507_10101710
450 Ga0373926_0008056
451 Ga0373949_0000125
452 Ga0373932_0000080
453 Ga0373941_0014489
454 Ga0373943_0137736
455 Ga0373924_0006812
456 Ga0373935_0039364
457 Ga0373935_0138393
458 Ga0373933_0013313
459 Ga0373937_0000507
460 Ga0373925_0003496
461 Ga0436365_0670421
462 Ga0436365_1251353
463 Ga0436362_0953783
464 Ga0439456_028705
465 Ga0450920_023658
466 Ga0439435_0086499
467 Ga0453684_0227275
468 Ga0451576_0013533
469 Ga0451576_0218388
470 Ga0451576_0308742
471 Ga0495629_0229418
472 Ga0495580_0054355
473 Ga0495608_0182968
474 Ga0495628_0000013
475 Ga0495613_0239679
476 Ga0495680_0109997
477 Ga0496104_0302726
478 Ga0496109_0480812
479 Ga0496112_0089417
480 Ga0496112_0108097
481 Ga0501031_0094827
482 Ga0501031_0249657
483 Ga0501036_0053229
484 Ga0501038_0140737
485 Ga0501039_0291187
486 Ga0501040_0032572
487 Ga0501040_0080417
488 Ga0501041_0024609
489 Ga0501042_0019861
490 Ga0501042_0031313
491 Ga0501046_0102007
492 Ga0501048_0137693
493 Ga0501068_0146935
494 Ga0501070_0001373
495 Ga0501071_0042805
496 Ga0501072_0002945
497 Ga0501072_0056200
498 Ga0501072_0098294
499 Ga0501072_0227273
500 Ga0501073_0011332
501 Ga0501073_0257771
502 Ga0501075_0007434
503 Ga0501075_0017409
504 Ga0501075_0271919
505 Ga0501076_0014664
506 Ga0501076_0018263
507 Ga0501076_0064722
508 Ga0501076_0281379
509 Ga0501076_0283861
510 Ga0501076_0400462
511 Ga0501079_0026304
512 Ga0501079_0201590
513 Ga0501081_0014066
514 Ga0501081_0017225
515 Ga0501081_0036811
516 Ga0501081_0095990
517 Ga0501083_0053900
518 Ga0501035_0363291
519 Ga0501045_0050819
520 nmdc:mga03683_21232_c1
521 nmdc:mga00v17_29604_c1
522 nmdc:mga0k408_43075_c1
523 nmdc:mga06z11_1770_c1
524 nmdc:mga05p37_472540_c1
525 nmdc:mga09592_11656_c1
526 nmdc:mga09592_193730_c1
527 nmdc:mga09592_92294_c1
528 nmdc:mga09592_93211_c1
529 nmdc:mga0qj67_388247_c1
530 nmdc:mga08y16_468446_c1
531 nmdc:mga08y16_47760_c1
532 nmdc:mga08y16_5_c1
533 nmdc:mga0rr50_108646_c1
534 nmdc:mga0rr50_124_c1
535 nmdc:mga0rr50_4581_c1
536 nmdc:mga08x19_4159_c1
537 nmdc:mga0a205_64902_c2
538 Ga0500630_032317
539 Ga0501084_0270520
540 Ga0501084_0328756
541 Ga0501082_0094861
542 Ga0501082_0344533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

12

218

0.92

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

7

277

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lk5-assembly1.cif.gz_C crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9444 3 274
4lk5-assembly1.cif.gz_B crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9436 3 273
4lk5-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from mycobacterium avium subsp. paratuberculosis k-10 0.9417 1 265
3p5m-assembly1.cif.gz_F crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9405 1 274
3p5m-assembly1.cif.gz_E crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9391 1 274
ID Description Score Start End Superfamily
4lk5A00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9469 1 265 3.90.226.10
4lk5B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9424 3 201 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9356 4 218 3.90.226.10
4lk5A00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9313 1 265 3.90.226.10
1jxzA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9303 1 216 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1F8XVI2-F1-model_v4 Enoyl-CoA hydratase 0.9666 1 274 GO:0006635
GO:0016829
AF-D7CKN9-F1-model_v4 Enoyl-CoA hydratase/isomerase 0.956 3 274
AF-A0A7C2W624-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9544 3 269 GO:0003824
AF-A0A7C2TEQ3-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9541 3 269
AF-A0A1I2RKE9-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9525 3 274 GO:0016853

Map