F377279

General Info

Members Datasets Scaffolds Average Seq Length
270 149 540 256

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_123663_c1|nmdc:mga08x19_123663_c1_22_885
Length 287
Sequence MSSRNKYATATLAGLSLVTTLCLAPPTFAQAARNATAQPAPTATSPDYVEEKGFKGKIFEIKYRDPYGLLQVIRPLGSGFKGATISVEQAFKTLTVRDFPENIAAIEEAIKRLDMPEAPRPDIEFTIHILIATNAESVPRDARGTFTDFPPELSDVIKQLQSTLRYKSYGMMTSAVHRAKEGPSGVSNSGVAESILFSNVPTPPNPIFYEYSLDRISIDSATGTPTVQVGGFRFSMRVPLSLGSNVQYQNVGFGSPVSLRQGEKVVVGSTTMGDKGLIVVVSAKVLK

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
127 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
128 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
129 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
132 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
135 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
136 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
137 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
138 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.37
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_123663_c1 3300050514 Bacteria 1736
2 JGI25406J46586_10001350 3300003203 Bacteria 11544
3 JGI25406J46586_10017014 3300003203 Unclassified 3014
4 rootL2_10102471 3300003322 Bacteria 1683
5 Ga0065707_10013092 3300005295 Bacteria 3088
6 Ga0065707_10165927 3300005295 Bacteria 1523
7 Ga0065707_10309172 3300005295 Unclassified 988
8 Ga0070690_100009886 3300005330 Bacteria 5534
9 Ga0068869_100008522 3300005334 Bacteria 6615
10 Ga0070680_100211003 3300005336 Bacteria 1638
11 Ga0068868_100293620 3300005338 Unclassified 1379
12 Ga0070689_100519775 3300005340 Bacteria 1022
13 Ga0070687_100259141 3300005343 Bacteria 1084
14 Ga0070692_10201377 3300005345 Unclassified 1166
15 Ga0070669_100002263 3300005353 Bacteria 13965
16 Ga0070669_100366945 3300005353 Bacteria 1172
17 Ga0070675_100000003 3300005354 Bacteria 422595
18 Ga0070671_100140388 3300005355 Bacteria 2039
19 Ga0070674_100090406 3300005356 Unclassified 2208
20 Ga0070703_10000895 3300005406 Bacteria 9499
21 Ga0070710_10340483 3300005437 Bacteria 990
22 Ga0070701_10121562 3300005438 Bacteria 1472
23 Ga0070701_10133578 3300005438 Unclassified 1412
24 Ga0070711_100000004 3300005439 Bacteria 188789
25 Ga0070705_100000074 3300005440 Bacteria 54239
26 Ga0070705_100080473 3300005440 Unclassified 1999
27 Ga0070705_100272522 3300005440 Unclassified 1199
28 Ga0070700_100000455 3300005441 Bacteria 20642
29 Ga0070694_100003832 3300005444 Bacteria 8985
30 Ga0070694_100066891 3300005444 Bacteria 2466
31 Ga0070694_100072835 3300005444 Bacteria 2371
32 Ga0070694_100334618 3300005444 Bacteria 1169
33 Ga0070708_100017775 3300005445 Bacteria 5938
34 Ga0070708_100581639 3300005445 Unclassified 1056
35 Ga0068867_100584115 3300005459 Unclassified 972
36 Ga0070706_100000174 3300005467 Bacteria 81375
37 Ga0070706_100073454 3300005467 Bacteria 3166
38 Ga0070706_100163683 3300005467 Unclassified 2077
39 Ga0070706_100208535 3300005467 Bacteria 1824
40 Ga0070707_100000128 3300005468 Bacteria 71110
41 Ga0070707_100019975 3300005468 Bacteria 6316
42 Ga0070707_100423277 3300005468 Bacteria 1292
43 Ga0070707_100611151 3300005468 Bacteria 1053
44 Ga0070698_100023449 3300005471 Bacteria 6451
45 Ga0070698_100289193 3300005471 Unclassified 1570
46 Ga0070698_100292260 3300005471 Bacteria 1561
47 Ga0070698_100297145 3300005471 Unclassified 1546
48 Ga0070698_100425006 3300005471 Unclassified 1263
49 Ga0070699_100000674 3300005518 Bacteria 31941
50 Ga0070699_100806609 3300005518 Unclassified 859
51 Ga0070697_100000619 3300005536 Bacteria 27010
52 Ga0070697_100046458 3300005536 Bacteria 3519
53 Ga0070697_100351704 3300005536 Bacteria 1273
54 Ga0070686_100075455 3300005544 Bacteria 2218
55 Ga0070686_100088345 3300005544 Bacteria 2068
56 Ga0070695_100202027 3300005545 Bacteria 1421
57 Ga0070696_100000111 3300005546 Bacteria 41669
58 Ga0070696_100050393 3300005546 Bacteria 2894
59 Ga0070693_100003378 3300005547 Bacteria 7427
60 Ga0070693_100272827 3300005547 Unclassified 1130
61 Ga0070704_100005408 3300005549 Bacteria 7437
62 Ga0070704_100014561 3300005549 Bacteria 4915
63 Ga0070704_100024120 3300005549 Unclassified 3987
64 Ga0070704_100073301 3300005549 Bacteria 2494
65 Ga0070704_100431457 3300005549 Bacteria 1131
66 Ga0070704_100482859 3300005549 Bacteria 1072
67 Ga0070704_100496504 3300005549 Bacteria 1058
68 Ga0070704_100566044 3300005549 Unclassified 995
69 Ga0068857_100413083 3300005577 Bacteria 1257
70 Ga0070702_100045137 3300005615 Bacteria 2491
71 Ga0070702_100595049 3300005615 Bacteria 828
72 Ga0068859_100000016 3300005617 Bacteria 261719
73 Ga0068859_100011312 3300005617 Bacteria 8980
74 Ga0068859_100608496 3300005617 Bacteria 1185
75 Ga0068864_100162223 3300005618 Bacteria 2032
76 Ga0068864_100419124 3300005618 Unclassified 1275
77 Ga0068866_10001509 3300005718 Bacteria 9903
78 Ga0068861_100134485 3300005719 Bacteria 2010
79 Ga0068861_100384169 3300005719 Bacteria 1241
80 Ga0068870_10035601 3300005840 Bacteria 2556
81 Ga0068870_10086397 3300005840 Bacteria 1745
82 Ga0068858_100035008 3300005842 Bacteria 4658
83 Ga0068860_100148775 3300005843 Bacteria 2254
84 Ga0068860_100187894 3300005843 Bacteria 1998
85 Ga0068862_100051135 3300005844 Unclassified 3533
86 Ga0068862_100152206 3300005844 Unclassified 2059
87 Ga0068862_100490638 3300005844 Unclassified 1164
88 Ga0081455_10005359 3300005937 Bacteria 14082
89 Ga0081455_10011979 3300005937 Bacteria 8681
90 Ga0081455_10023741 3300005937 Bacteria 5698
91 Ga0081539_10000073 3300005985 Bacteria 231470
92 Ga0081539_10001067 3300005985 Bacteria 50172
93 Ga0070716_100067159 3300006173 Bacteria 2094
94 Ga0097621_100667570 3300006237 Bacteria 955
95 Ga0075428_100029327 3300006844 Bacteria 6087
96 Ga0075428_100073898 3300006844 Bacteria 3724
97 Ga0075428_100169617 3300006844 Bacteria 2366
98 Ga0075428_100196983 3300006844 Bacteria 2179
99 Ga0075431_100045379 3300006847 Unclassified 4531
100 Ga0075431_100187436 3300006847 Bacteria 2121
101 Ga0075431_100189824 3300006847 Bacteria 2106
102 Ga0075433_10039796 3300006852 Bacteria 4066
103 Ga0075433_10102875 3300006852 Unclassified 2530
104 Ga0075433_10160269 3300006852 Bacteria 2002
105 Ga0075433_10222350 3300006852 Bacteria 1677
106 Ga0075434_100026473 3300006871 Bacteria 5682
107 Ga0075434_100109456 3300006871 Bacteria 2773
108 Ga0075434_100174530 3300006871 Bacteria 2169
109 Ga0075434_100531766 3300006871 Bacteria 1196
110 Ga0075434_100558803 3300006871 Bacteria 1164
111 Ga0075436_100044348 3300006914 Bacteria 3066
112 Ga0097620_100000016 3300006931 Bacteria 261719
113 Ga0097620_100011312 3300006931 Bacteria 8980
114 Ga0097620_100608532 3300006931 Bacteria 1185
115 Ga0075435_100017728 3300007076 Bacteria 5396
116 Ga0075435_100214207 3300007076 Bacteria 1635
117 Ga0099794_10035321 3300007265 Bacteria 2359
118 Ga0099795_10141021 3300007788 Unclassified 980
119 Ga0105244_10013588 3300009036 Bacteria 4750
120 Ga0111539_10125839 3300009094 Bacteria 3003
121 Ga0111539_10144347 3300009094 Unclassified 2786
122 Ga0105245_10012903 3300009098 Bacteria 7283
123 Ga0105245_10018950 3300009098 Bacteria 6024
124 Ga0105245_10112703 3300009098 Unclassified 2532
125 Ga0114129_10040487 3300009147 Bacteria 6569
126 Ga0114129_10060317 3300009147 Bacteria 5304
127 Ga0114129_10060628 3300009147 Bacteria 5289
128 Ga0114129_10326354 3300009147 Bacteria 2039
129 Ga0114129_10331775 3300009147 Bacteria 2019
130 Ga0114129_10336896 3300009147 Bacteria 2002
131 Ga0114129_10421564 3300009147 Bacteria 1755
132 Ga0114129_10436423 3300009147 Bacteria 1720
133 Ga0114129_10637550 3300009147 Bacteria 1376
134 Ga0114129_10751108 3300009147 Bacteria 1249
135 Ga0105243_10000039 3300009148 Bacteria 166207
136 Ga0105243_10269098 3300009148 Unclassified 1529
137 Ga0105243_10611640 3300009148 Bacteria 1050
138 Ga0105243_11165762 3300009148 Bacteria 782
139 Ga0105241_10299339 3300009174 Bacteria 1380
140 Ga0105242_10000140 3300009176 Bacteria 52361
141 Ga0105242_10001617 3300009176 Bacteria 17749
142 Ga0105242_10076415 3300009176 Unclassified 2792
143 Ga0105242_10305384 3300009176 Bacteria 1454
144 Ga0105248_10381561 3300009177 Bacteria 1587
145 Ga0105249_10120658 3300009553 Bacteria 2491
146 Ga0105249_10295852 3300009553 Bacteria 1622
147 Ga0105239_10042923 3300010375 Bacteria 4955
148 Ga0157378_10011824 3300013297 Bacteria 7640
149 Ga0157378_10057070 3300013297 Bacteria 3479
150 Ga0157378_10068894 3300013297 Bacteria 3173
151 Ga0157378_10406764 3300013297 Unclassified 1342
152 Ga0163162_10002121 3300013306 Bacteria 18632
153 Ga0163162_10057129 3300013306 Bacteria 3930
154 Ga0163162_10172162 3300013306 Bacteria 2290
155 Ga0163162_10261925 3300013306 Unclassified 1861
156 Ga0157375_10289311 3300013308 Viruses 1801
157 Ga0163163_10012851 3300014325 Bacteria 7641
158 Ga0157380_10142231 3300014326 Bacteria 2063
159 Ga0157377_10000049 3300014745 Bacteria 93091
160 Ga0157376_10314851 3300014969 Unclassified 1486
161 Ga0163161_10238643 3300017792 Bacteria 1413
162 Ga0163161_10281228 3300017792 Bacteria 1305
163 Ga0207655_1060193 3300025728 Bacteria 1473
164 Ga0207653_10000038 3300025885 Bacteria 98555
165 Ga0207642_10008559 3300025899 Bacteria 3517
166 Ga0207688_10197157 3300025901 Unclassified 1206
167 Ga0207699_10079453 3300025906 Bacteria 2029
168 Ga0207643_10052378 3300025908 Bacteria 2318
169 Ga0207684_10000510 3300025910 Bacteria 48332
170 Ga0207684_10543353 3300025910 Bacteria 994
171 Ga0207654_10208214 3300025911 Bacteria 1291
172 Ga0207663_10000007 3300025916 Bacteria 208566
173 Ga0207662_10206201 3300025918 Bacteria 1274
174 Ga0207646_10001101 3300025922 Bacteria 34421
175 Ga0207646_10016249 3300025922 Bacteria 6987
176 Ga0207646_10112576 3300025922 Unclassified 2443
177 Ga0207681_10003900 3300025923 Bacteria 9260
178 Ga0207650_10021886 3300025925 Bacteria 4523
179 Ga0207659_10000006 3300025926 Bacteria 384976
180 Ga0207687_10006756 3300025927 Bacteria 7558
181 Ga0207644_10242093 3300025931 Bacteria 1437
182 Ga0207686_10000006 3300025934 Bacteria 259583
183 Ga0207686_10000653 3300025934 Bacteria 21390
184 Ga0207686_10006540 3300025934 Bacteria 6275
185 Ga0207709_10000037 3300025935 Bacteria 279771
186 Ga0207709_10181097 3300025935 Bacteria 1488
187 Ga0207709_10482831 3300025935 Bacteria 964
188 Ga0207670_10358910 3300025936 Bacteria 1156
189 Ga0207670_10382349 3300025936 Bacteria 1122
190 Ga0207665_10028461 3300025939 Bacteria 3690
191 Ga0207665_10105983 3300025939 Bacteria 1969
192 Ga0207665_10217894 3300025939 Bacteria 1397
193 Ga0207689_10002511 3300025942 Bacteria 17054
194 Ga0207689_10429698 3300025942 Unclassified 1103
195 Ga0207712_10063347 3300025961 Bacteria 2632
196 Ga0207712_10615405 3300025961 Unclassified 941
197 Ga0207708_10000012 3300026075 Bacteria 207611
198 Ga0207708_10615284 3300026075 Unclassified 921
199 Ga0207676_10034934 3300026095 Bacteria 3809
200 Ga0207674_10261048 3300026116 Bacteria 1679
201 Ga0207675_100005265 3300026118 Bacteria 12443
202 Ga0207675_100013377 3300026118 Bacteria 7656
203 Ga0207675_100121868 3300026118 Bacteria 2468
204 Ga0207675_100320938 3300026118 Bacteria 1512
205 Ga0209588_1098970 3300027671 Unclassified 939
206 Ga0207428_10062550 3300027907 Bacteria 2943
207 Ga0268265_10172805 3300028380 Bacteria 1849
208 Ga0268264_10088459 3300028381 Unclassified 2666
209 Ga0307515_10253140 3300028794 Bacteria 1510
210 Ga0265327_10008398 3300031251 Bacteria 7698
211 Ga0373932_0000559 3300035112 Bacteria 11424
212 Ga0373924_0087969 3300035410 Bacteria 1327
213 Ga0373925_0007553 3300037068 Bacteria 7922
214 Ga0373925_0014896 3300037068 Bacteria 5619
215 Ga0242420_002922 3300038996 Bacteria 2486
216 Ga0451577_0191521 3300042876 Bacteria 1845
217 Ga0453683_0010108 3300044673 Bacteria 6269
218 Ga0451576_0234606 3300045051 Bacteria 1916
219 Ga0451576_0777574 3300045051 Bacteria 1005
220 Ga0495580_0268844 3300046472 Bacteria 1165
221 Ga0495662_0208004 3300046476 Unclassified 964
222 Ga0495588_0334917 3300046674 Unclassified 796
223 Ga0495647_0018850 3300046681 Bacteria 2462
224 Ga0495647_0175898 3300046681 Bacteria 929
225 Ga0495658_0013387 3300046683 Bacteria 4174
226 Ga0495658_0035043 3300046683 Bacteria 2758
227 Ga0495600_0246545 3300046809 Unclassified 1137
228 Ga0495581_0252086 3300047315 Bacteria 1032
229 Ga0495672_0178615 3300047320 Unclassified 1077
230 Ga0496109_0000425 3300048912 Bacteria 37065
231 Ga0501041_0035635 3300049577 Bacteria 3015
232 Ga0501048_0132665 3300049582 Bacteria 1760
233 Ga0501198_007490 3300049649 Bacteria 1571
234 Ga0501199_006165 3300049650 Bacteria 1216
235 Ga0501209_059105 3300049656 Bacteria 1065
236 Ga0501217_032705 3300049661 Bacteria 1288
237 Ga0501227_017091 3300049665 Bacteria 1634
238 Ga0501235_011183 3300049669 Bacteria 1966
239 Ga0501238_015103 3300049671 Bacteria 1062
240 Ga0501249_030211 3300049679 Bacteria 1206
241 Ga0501234_016649 3300049707 Bacteria 1160
242 Ga0501265_019296 3300049762 Bacteria 909
243 Ga0501268_017545 3300049765 Bacteria 1195
244 Ga0501272_011082 3300049769 Bacteria 1012
245 Ga0501274_004837 3300049771 Bacteria 1124
246 Ga0501045_0044654 3300049824 Bacteria 3228
247 Ga0501212_008312 3300049851 Bacteria 1441
248 nmdc:mga05p37_22621_c1 3300050507 Bacteria 7623
249 nmdc:mga05p37_3890_c1 3300050507 Bacteria 17465
250 nmdc:mga05p37_559980_c1 3300050507 Bacteria 1299
251 nmdc:mga09592_26573_c1 3300050508 Bacteria 4797
252 nmdc:mga09592_271505_c1 3300050508 Unclassified 1471
253 nmdc:mga06r32_117288_c1 3300050510 Unclassified 2624
254 nmdc:mga06r32_19648_c1 3300050510 Bacteria 6205
255 nmdc:mga06r32_89021_c1 3300050510 Bacteria 3013
256 nmdc:mga08y16_166110_c1 3300050511 Bacteria 2293
257 nmdc:mga08y16_6749_c1 3300050511 Bacteria 12038
258 nmdc:mga0n895_199586_c1 3300050512 Bacteria 2032
259 nmdc:mga0n895_324220_c1 3300050512 Bacteria 1561
260 nmdc:mga0n895_407981_c1 3300050512 Bacteria 1374
261 nmdc:mga0n895_502132_c1 3300050512 Unclassified 1222
262 nmdc:mga0rr50_47801_c1 3300050513 Bacteria 3159
263 nmdc:mga08x19_115447_c1 3300050514 Bacteria 1795
264 nmdc:mga0a205_107182_c1 3300050515 Unclassified 2692
265 nmdc:mga0a205_111114_c1 3300050515 Bacteria 2639
266 nmdc:mga0a205_135243_c1 3300050515 Bacteria 2365
267 nmdc:mga0a205_324255_c1 3300050515 Bacteria 1411
268 nmdc:mga0a205_413032_c1 3300050515 Unclassified 1212
269 Ga0501084_0107361 3300054114 Bacteria 2345
270 Ga0501082_0445781 3300060353 Unclassified 1131
271 nmdc:mga08x19_123663_c1
272 JGI25406J46586_10001350
273 JGI25406J46586_10017014
274 rootL2_10102471
275 Ga0065707_10013092
276 Ga0065707_10165927
277 Ga0065707_10309172
278 Ga0070690_100009886
279 Ga0068869_100008522
280 Ga0070680_100211003
281 Ga0068868_100293620
282 Ga0070689_100519775
283 Ga0070687_100259141
284 Ga0070692_10201377
285 Ga0070669_100002263
286 Ga0070669_100366945
287 Ga0070675_100000003
288 Ga0070671_100140388
289 Ga0070674_100090406
290 Ga0070703_10000895
291 Ga0070710_10340483
292 Ga0070701_10121562
293 Ga0070701_10133578
294 Ga0070711_100000004
295 Ga0070705_100000074
296 Ga0070705_100080473
297 Ga0070705_100272522
298 Ga0070700_100000455
299 Ga0070694_100003832
300 Ga0070694_100066891
301 Ga0070694_100072835
302 Ga0070694_100334618
303 Ga0070708_100017775
304 Ga0070708_100581639
305 Ga0068867_100584115
306 Ga0070706_100000174
307 Ga0070706_100073454
308 Ga0070706_100163683
309 Ga0070706_100208535
310 Ga0070707_100000128
311 Ga0070707_100019975
312 Ga0070707_100423277
313 Ga0070707_100611151
314 Ga0070698_100023449
315 Ga0070698_100289193
316 Ga0070698_100292260
317 Ga0070698_100297145
318 Ga0070698_100425006
319 Ga0070699_100000674
320 Ga0070699_100806609
321 Ga0070697_100000619
322 Ga0070697_100046458
323 Ga0070697_100351704
324 Ga0070686_100075455
325 Ga0070686_100088345
326 Ga0070695_100202027
327 Ga0070696_100000111
328 Ga0070696_100050393
329 Ga0070693_100003378
330 Ga0070693_100272827
331 Ga0070704_100005408
332 Ga0070704_100014561
333 Ga0070704_100024120
334 Ga0070704_100073301
335 Ga0070704_100431457
336 Ga0070704_100482859
337 Ga0070704_100496504
338 Ga0070704_100566044
339 Ga0068857_100413083
340 Ga0070702_100045137
341 Ga0070702_100595049
342 Ga0068859_100000016
343 Ga0068859_100011312
344 Ga0068859_100608496
345 Ga0068864_100162223
346 Ga0068864_100419124
347 Ga0068866_10001509
348 Ga0068861_100134485
349 Ga0068861_100384169
350 Ga0068870_10035601
351 Ga0068870_10086397
352 Ga0068858_100035008
353 Ga0068860_100148775
354 Ga0068860_100187894
355 Ga0068862_100051135
356 Ga0068862_100152206
357 Ga0068862_100490638
358 Ga0081455_10005359
359 Ga0081455_10011979
360 Ga0081455_10023741
361 Ga0081539_10000073
362 Ga0081539_10001067
363 Ga0070716_100067159
364 Ga0097621_100667570
365 Ga0075428_100029327
366 Ga0075428_100073898
367 Ga0075428_100169617
368 Ga0075428_100196983
369 Ga0075431_100045379
370 Ga0075431_100187436
371 Ga0075431_100189824
372 Ga0075433_10039796
373 Ga0075433_10102875
374 Ga0075433_10160269
375 Ga0075433_10222350
376 Ga0075434_100026473
377 Ga0075434_100109456
378 Ga0075434_100174530
379 Ga0075434_100531766
380 Ga0075434_100558803
381 Ga0075436_100044348
382 Ga0097620_100000016
383 Ga0097620_100011312
384 Ga0097620_100608532
385 Ga0075435_100017728
386 Ga0075435_100214207
387 Ga0099794_10035321
388 Ga0099795_10141021
389 Ga0105244_10013588
390 Ga0111539_10125839
391 Ga0111539_10144347
392 Ga0105245_10012903
393 Ga0105245_10018950
394 Ga0105245_10112703
395 Ga0114129_10040487
396 Ga0114129_10060317
397 Ga0114129_10060628
398 Ga0114129_10326354
399 Ga0114129_10331775
400 Ga0114129_10336896
401 Ga0114129_10421564
402 Ga0114129_10436423
403 Ga0114129_10637550
404 Ga0114129_10751108
405 Ga0105243_10000039
406 Ga0105243_10269098
407 Ga0105243_10611640
408 Ga0105243_11165762
409 Ga0105241_10299339
410 Ga0105242_10000140
411 Ga0105242_10001617
412 Ga0105242_10076415
413 Ga0105242_10305384
414 Ga0105248_10381561
415 Ga0105249_10120658
416 Ga0105249_10295852
417 Ga0105239_10042923
418 Ga0157378_10011824
419 Ga0157378_10057070
420 Ga0157378_10068894
421 Ga0157378_10406764
422 Ga0163162_10002121
423 Ga0163162_10057129
424 Ga0163162_10172162
425 Ga0163162_10261925
426 Ga0157375_10289311
427 Ga0163163_10012851
428 Ga0157380_10142231
429 Ga0157377_10000049
430 Ga0157376_10314851
431 Ga0163161_10238643
432 Ga0163161_10281228
433 Ga0207655_1060193
434 Ga0207653_10000038
435 Ga0207642_10008559
436 Ga0207688_10197157
437 Ga0207699_10079453
438 Ga0207643_10052378
439 Ga0207684_10000510
440 Ga0207684_10543353
441 Ga0207654_10208214
442 Ga0207663_10000007
443 Ga0207662_10206201
444 Ga0207646_10001101
445 Ga0207646_10016249
446 Ga0207646_10112576
447 Ga0207681_10003900
448 Ga0207650_10021886
449 Ga0207659_10000006
450 Ga0207687_10006756
451 Ga0207644_10242093
452 Ga0207686_10000006
453 Ga0207686_10000653
454 Ga0207686_10006540
455 Ga0207709_10000037
456 Ga0207709_10181097
457 Ga0207709_10482831
458 Ga0207670_10358910
459 Ga0207670_10382349
460 Ga0207665_10028461
461 Ga0207665_10105983
462 Ga0207665_10217894
463 Ga0207689_10002511
464 Ga0207689_10429698
465 Ga0207712_10063347
466 Ga0207712_10615405
467 Ga0207708_10000012
468 Ga0207708_10615284
469 Ga0207676_10034934
470 Ga0207674_10261048
471 Ga0207675_100005265
472 Ga0207675_100013377
473 Ga0207675_100121868
474 Ga0207675_100320938
475 Ga0209588_1098970
476 Ga0207428_10062550
477 Ga0268265_10172805
478 Ga0268264_10088459
479 Ga0307515_10253140
480 Ga0265327_10008398
481 Ga0373932_0000559
482 Ga0373924_0087969
483 Ga0373925_0007553
484 Ga0373925_0014896
485 Ga0242420_002922
486 Ga0451577_0191521
487 Ga0453683_0010108
488 Ga0451576_0234606
489 Ga0451576_0777574
490 Ga0495580_0268844
491 Ga0495662_0208004
492 Ga0495588_0334917
493 Ga0495647_0018850
494 Ga0495647_0175898
495 Ga0495658_0013387
496 Ga0495658_0035043
497 Ga0495600_0246545
498 Ga0495581_0252086
499 Ga0495672_0178615
500 Ga0496109_0000425
501 Ga0501041_0035635
502 Ga0501048_0132665
503 Ga0501198_007490
504 Ga0501199_006165
505 Ga0501209_059105
506 Ga0501217_032705
507 Ga0501227_017091
508 Ga0501235_011183
509 Ga0501238_015103
510 Ga0501249_030211
511 Ga0501234_016649
512 Ga0501265_019296
513 Ga0501268_017545
514 Ga0501272_011082
515 Ga0501274_004837
516 Ga0501045_0044654
517 Ga0501212_008312
518 nmdc:mga05p37_22621_c1
519 nmdc:mga05p37_3890_c1
520 nmdc:mga05p37_559980_c1
521 nmdc:mga09592_26573_c1
522 nmdc:mga09592_271505_c1
523 nmdc:mga06r32_117288_c1
524 nmdc:mga06r32_19648_c1
525 nmdc:mga06r32_89021_c1
526 nmdc:mga08y16_166110_c1
527 nmdc:mga08y16_6749_c1
528 nmdc:mga0n895_199586_c1
529 nmdc:mga0n895_324220_c1
530 nmdc:mga0n895_407981_c1
531 nmdc:mga0n895_502132_c1
532 nmdc:mga0rr50_47801_c1
533 nmdc:mga08x19_115447_c1
534 nmdc:mga0a205_107182_c1
535 nmdc:mga0a205_111114_c1
536 nmdc:mga0a205_135243_c1
537 nmdc:mga0a205_324255_c1
538 nmdc:mga0a205_413032_c1
539 Ga0501084_0107361
540 Ga0501082_0445781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gr5-assembly1.cif.gz_A periplasmic domain of the outer membrane secretin escc from enteropathogenic e.coli (epec) 0.8186 11 73
2y3m-assembly1.cif.gz_B structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans 0.7848 13 74
2y3m-assembly1.cif.gz_A structure of the extra-membranous domain of the secretin hofq from actinobacillus actinomycetemcomitans 0.7739 13 74
8axk-assembly1.cif.gz_X type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri 0.7564 14 74
8axn-assembly1.cif.gz_0 inner membrane ring and secretin n0 n1 domains of the type 3 secretion system of shigella flexneri 0.7549 11 74
ID Description Score Start End Superfamily
4ec5B01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9442 13 74 3.30.1370.120
af_P45758_21_186_3.30.1370.120 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.901 13 74 3.30.1370.120
af_P45758_190_260_3.30.1370.120 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8357 14 74 3.30.1370.120
5wlnJ01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8282 14 74 3.30.1370.120
5wq7A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.825 13 73 3.30.1370.120
ID Description Score Start End GO Terms
AF-A0A6V8P5X5-F1-model_v4 Type IV pilus assembly protein PilQ 0.9309 13 78 GO:0009279
AF-A0A1W9LJU6-F1-model_v4 Secretin/TonB short N-terminal domain-containing protein 0.9298 13 79 GO:0009279
AF-A0A2V5ZMI0-F1-model_v4 Uncharacterized protein 0.9204 87 242
AF-A0A523W5D3-F1-model_v4 NolW-like domain-containing protein 0.9163 13 77 GO:0009306
GO:0015627
AF-A0A2V5ZMI0-F1-model_v4 Uncharacterized protein 0.9083 87 242

Map