F377201

General Info

Members Datasets Scaffolds Average Seq Length
270 172 540 170

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0031655|Ga0496100_0031655_1083_1628
Length 181
Sequence MAEFKSSYLIEGLPGHPLHPPLTDATIGTYTFATLAAVLSKIGVADHAFAQAWWLALVIGLVATVFTATTGLVDWLKITWGSELWKTATLHLSAMLTATVFFLIAALVGHAGYVDREVTTGGLVLTLIGFVFLTAGGWLGGAVTFVHGMRVLSLSDEATGRAVSPAPTDEKVEAGKGRGGG

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 7.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.56
Rhizosphere 81.85
Stem 0
Stem Tuber 0
Unclassified 11.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0031655 3300048903 Bacteria 3290
2 Ga0058862_12841993 3300004803 Unclassified 1064
3 Ga0070658_10071560 3300005327 Bacteria 2840
4 Ga0070658_10108772 3300005327 Unclassified 2295
5 Ga0070658_10303428 3300005327 Bacteria 1362
6 Ga0070658_10677107 3300005327 Unclassified 895
7 Ga0070683_100000408 3300005329 Bacteria 29693
8 Ga0070683_100132341 3300005329 Bacteria 2361
9 Ga0070683_100843942 3300005329 Bacteria 878
10 Ga0070690_100906924 3300005330 Bacteria 690
11 Ga0070680_100007559 3300005336 Bacteria 8286
12 Ga0070680_100217375 3300005336 Bacteria 1613
13 Ga0070660_100001912 3300005339 Bacteria 14350
14 Ga0070671_100067693 3300005355 Bacteria 2977
15 Ga0070673_100221092 3300005364 Bacteria 1639
16 Ga0070659_100194718 3300005366 Bacteria 1667
17 Ga0070709_10103802 3300005434 Bacteria 1899
18 Ga0070709_10244294 3300005434 Unclassified 1290
19 Ga0070714_100055155 3300005435 Bacteria 3396
20 Ga0070713_100489746 3300005436 Bacteria 1159
21 Ga0070708_100075251 3300005445 Bacteria 3047
22 Ga0070663_100710170 3300005455 Unclassified 855
23 Ga0070678_100324536 3300005456 Bacteria 1315
24 Ga0070681_10012610 3300005458 Bacteria 8387
25 Ga0070681_10244127 3300005458 Unclassified 1709
26 Ga0070707_100152671 3300005468 Bacteria 2249
27 Ga0070699_100162273 3300005518 Unclassified 1978
28 Ga0070679_100029837 3300005530 Bacteria 5381
29 Ga0070684_100002425 3300005535 Bacteria 13745
30 Ga0070684_100074541 3300005535 Bacteria 2991
31 Ga0070684_100142966 3300005535 Bacteria 2164
32 Ga0070693_100296608 3300005547 Bacteria 1088
33 Ga0070704_100773497 3300005549 Bacteria 856
34 Ga0068854_100977894 3300005578 Unclassified 748
35 Ga0068856_100100911 3300005614 Bacteria 2879
36 Ga0068852_100114774 3300005616 Bacteria 2454
37 Ga0068861_101392772 3300005719 Bacteria 685
38 Ga0068870_10709080 3300005840 Bacteria 695
39 Ga0081455_10000621 3300005937 Bacteria 46024
40 Ga0081538_10001394 3300005981 Bacteria 24783
41 Ga0081538_10010466 3300005981 Bacteria 7607
42 Ga0070716_100011672 3300006173 Bacteria 4427
43 Ga0068871_100185655 3300006358 Bacteria 1789
44 Ga0068871_101335297 3300006358 Unclassified 675
45 Ga0075428_100228035 3300006844 Bacteria 2010
46 Ga0075431_100025642 3300006847 Bacteria 6043
47 Ga0075433_10305651 3300006852 Bacteria 1408
48 Ga0075433_10720124 3300006852 Bacteria 873
49 Ga0075433_10720126 3300006852 Unclassified 873
50 Ga0075434_100125785 3300006871 Bacteria 2580
51 Ga0075434_100951135 3300006871 Bacteria 873
52 Ga0075434_100951136 3300006871 Unclassified 873
53 Ga0075429_100291003 3300006880 Bacteria 1430
54 Ga0068865_100994700 3300006881 Bacteria 734
55 Ga0075436_100007832 3300006914 Bacteria 7308
56 Ga0075435_100150490 3300007076 Bacteria 1956
57 Ga0111539_10282145 3300009094 Bacteria 1933
58 Ga0111539_11342635 3300009094 Bacteria 830
59 Ga0105245_10179870 3300009098 Bacteria 2020
60 Ga0105245_10388889 3300009098 Bacteria 1391
61 Ga0105245_10506382 3300009098 Unclassified 1224
62 Ga0114129_10090128 3300009147 Bacteria 4251
63 Ga0105242_10028966 3300009176 Bacteria 4412
64 Ga0105248_10218695 3300009177 Bacteria 2145
65 Ga0105238_10985274 3300009551 Unclassified 863
66 Ga0105249_10120338 3300009553 Bacteria 2494
67 Ga0157370_10002580 3300013104 Bacteria 21763
68 Ga0157370_10960627 3300013104 Bacteria 774
69 Ga0157369_10019494 3300013105 Bacteria 7590
70 Ga0157369_10046225 3300013105 Bacteria 4731
71 Ga0157369_10097350 3300013105 Bacteria 3139
72 Ga0157374_10217978 3300013296 Bacteria 1872
73 Ga0157372_10494868 3300013307 Bacteria 1426
74 Ga0157372_10540023 3300013307 Bacteria 1359
75 Ga0157375_10043673 3300013308 Bacteria 4349
76 Ga0182008_10104069 3300014497 Bacteria 1404
77 Ga0157379_10312377 3300014968 Bacteria 1434
78 Ga0157376_10284957 3300014969 Bacteria 1557
79 Ga0197907_10710777 3300020069 Unclassified 1190
80 Ga0206356_10011615 3300020070 Bacteria 1516
81 Ga0206356_10033949 3300020070 Bacteria 2012
82 Ga0206356_11617213 3300020070 Bacteria 1233
83 Ga0206356_11797695 3300020070 Bacteria 899
84 Ga0206349_1482757 3300020075 Bacteria 1719
85 Ga0206355_1134943 3300020076 Bacteria 1479
86 Ga0206355_1285690 3300020076 Bacteria 1165
87 Ga0206351_10830140 3300020077 Unclassified 1080
88 Ga0206352_10565281 3300020078 Bacteria 729
89 Ga0206352_10862525 3300020078 Bacteria 1265
90 Ga0206350_10217700 3300020080 Bacteria 1732
91 Ga0206353_10272012 3300020082 Bacteria 3220
92 Ga0206353_11364517 3300020082 Bacteria 3894
93 Ga0154015_1247260 3300020610 Bacteria 1769
94 Ga0213876_10125063 3300021384 Bacteria 1366
95 Ga0213875_10110426 3300021388 Bacteria 1284
96 Ga0224712_10018200 3300022467 Bacteria 2344
97 Ga0224712_10209900 3300022467 Bacteria 888
98 Ga0207699_10091547 3300025906 Unclassified 1910
99 Ga0207705_10041116 3300025909 Bacteria 3316
100 Ga0207705_10168816 3300025909 Bacteria 1647
101 Ga0207705_10534601 3300025909 Unclassified 911
102 Ga0207707_10016774 3300025912 Bacteria 6380
103 Ga0207707_10131725 3300025912 Bacteria 2187
104 Ga0207693_10109129 3300025915 Bacteria 2171
105 Ga0207660_10016865 3300025917 Bacteria 4844
106 Ga0207660_10186474 3300025917 Bacteria 1614
107 Ga0207657_10002132 3300025919 Bacteria 21433
108 Ga0207652_10074729 3300025921 Bacteria 2951
109 Ga0207687_10174963 3300025927 Bacteria 1658
110 Ga0207644_10073444 3300025931 Bacteria 2508
111 Ga0207644_10206593 3300025931 Bacteria 1551
112 Ga0207690_10076247 3300025932 Unclassified 2327
113 Ga0207704_10603426 3300025938 Bacteria 899
114 Ga0207665_10007283 3300025939 Bacteria 7321
115 Ga0207711_10155576 3300025941 Bacteria 2066
116 Ga0207661_10222807 3300025944 Bacteria 1667
117 Ga0207661_10332175 3300025944 Bacteria 1368
118 Ga0207661_10717079 3300025944 Unclassified 920
119 Ga0207678_10990528 3300026067 Unclassified 744
120 Ga0207702_10098512 3300026078 Bacteria 2575
121 Ga0207683_10113479 3300026121 Bacteria 2427
122 Ga0207698_10136384 3300026142 Bacteria 2106
123 Ga0209966_1001313 3300027695 Bacteria 4388
124 Ga0209998_10006849 3300027717 Bacteria 2365
125 Ga0207428_10004378 3300027907 Bacteria 13466
126 Ga0307409_100037083 3300031995 Bacteria 3591
127 Ga0373926_0085509 3300035083 Bacteria 1170
128 Ga0373929_0083570 3300035085 Bacteria 782
129 Ga0373944_0038508 3300035089 Bacteria 1469
130 Ga0373936_0033534 3300035113 Bacteria 2035
131 Ga0373945_0018006 3300035116 Bacteria 2399
132 Ga0373931_0674873 3300035691 Unclassified 681
133 Ga0373935_0015539 3300035692 Bacteria 4603
134 Ga0373927_0200054 3300035695 Bacteria 1312
135 Ga0373925_0009350 3300037068 Bacteria 7138
136 Ga0395899_0001477 3300037312 Bacteria 20007
137 Ga0395899_0003284 3300037312 Bacteria 12824
138 Ga0395899_0004271 3300037312 Bacteria 11175
139 Ga0395899_0662956 3300037312 Unclassified 658
140 Ga0395900_0006264 3300037418 Bacteria 12413
141 Ga0395900_0010698 3300037418 Bacteria 9386
142 Ga0395900_0025682 3300037418 Bacteria 6030
143 Ga0395900_0057448 3300037418 Bacteria 4006
144 Ga0395900_0133944 3300037418 Bacteria 2538
145 Ga0395900_1057164 3300037418 Bacteria 730
146 Ga0395898_0003893 3300037466 Bacteria 16490
147 Ga0395898_0026518 3300037466 Bacteria 5828
148 Ga0395898_0039050 3300037466 Bacteria 4701
149 Ga0395898_0088919 3300037466 Bacteria 2973
150 Ga0395905_0001505 3300037471 Bacteria 27874
151 Ga0395905_0002846 3300037471 Bacteria 18925
152 Ga0395905_1493918 3300037471 Bacteria 580
153 Ga0436364_0834842 3300037853 Bacteria 2060
154 Ga0395901_0001627 3300038443 Bacteria 23226
155 Ga0395901_0010720 3300038443 Bacteria 9292
156 Ga0395901_0016291 3300038443 Bacteria 7571
157 Ga0395901_0067194 3300038443 Bacteria 3733
158 Ga0395901_0076806 3300038443 Bacteria 3485
159 Ga0395901_0133021 3300038443 Bacteria 2614
160 Ga0395901_0719672 3300038443 Bacteria 994
161 Ga0395901_1356590 3300038443 Bacteria 671
162 Ga0395901_1420940 3300038443 Bacteria 652
163 Ga0436363_0403702 3300039450 Bacteria 3739
164 Ga0451802_1980982 3300041460 Bacteria 1165
165 Ga0451807_1224012 3300041486 Bacteria 590
166 Ga0451845_0850279 3300041501 Bacteria 724
167 Ga0451851_1017182 3300041507 Unclassified 1467
168 Ga0451853_2938752 3300041512 Bacteria 804
169 Ga0439448_0004618 3300042005 Bacteria 3895
170 Ga0439448_0023272 3300042005 Bacteria 1931
171 Ga0439450_011343 3300042008 Bacteria 1744
172 Ga0439458_0023303 3300042157 Bacteria 1443
173 Ga0439459_0051102 3300042438 Bacteria 908
174 Ga0439460_0210013 3300042461 Bacteria 665
175 Ga0466966_0023976 3300044684 Bacteria 3993
176 Ga0466961_0006310 3300044693 Bacteria 7528
177 Ga0466963_0052257 3300044694 Bacteria 2711
178 Ga0466964_0040617 3300044706 Bacteria 1879
179 Ga0466964_0054478 3300044706 Bacteria 1649
180 Ga0466964_0213100 3300044706 Unclassified 934
181 Ga0466964_0244563 3300044706 Bacteria 882
182 Ga0466971_0010696 3300044719 Bacteria 4015
183 Ga0466957_0127708 3300044842 Bacteria 1626
184 Ga0466959_0019191 3300045049 Bacteria 5027
185 Ga0466958_0145377 3300045836 Bacteria 1494
186 Ga0466958_0217800 3300045836 Bacteria 1217
187 Ga0466967_0076150 3300045976 Bacteria 3017
188 Ga0466967_0101754 3300045976 Bacteria 2627
189 Ga0466967_0137364 3300045976 Bacteria 2274
190 Ga0466967_0287992 3300045976 Bacteria 1577
191 Ga0466967_0359206 3300045976 Bacteria 1411
192 Ga0495603_0243923 3300046455 Bacteria 1035
193 Ga0495641_0072412 3300046461 Bacteria 1546
194 Ga0495582_0025205 3300046473 Bacteria 3258
195 Ga0495628_0480521 3300046516 Unclassified 899
196 Ga0495630_0079314 3300046517 Bacteria 2477
197 Ga0495630_0254971 3300046517 Bacteria 1340
198 Ga0495665_0213436 3300046531 Bacteria 999
199 Ga0495658_0032342 3300046683 Bacteria 2855
200 Ga0495613_0650520 3300046689 Bacteria 697
201 Ga0495624_0337441 3300046690 Bacteria 907
202 Ga0495581_0420820 3300047315 Bacteria 779
203 Ga0495674_0177261 3300047319 Bacteria 1776
204 Ga0495676_0186016 3300047321 Bacteria 1452
205 Ga0495676_0613366 3300047321 Bacteria 708
206 Ga0496100_0031283 3300048903 Bacteria 3308
207 Ga0496100_0210919 3300048903 Bacteria 1420
208 Ga0496100_1449582 3300048903 Bacteria 542
209 Ga0496101_0001412 3300048904 Bacteria 14366
210 Ga0496101_0024776 3300048904 Bacteria 4158
211 Ga0496101_0030619 3300048904 Bacteria 3775
212 Ga0496101_0131160 3300048904 Bacteria 1903
213 Ga0496101_0133522 3300048904 Bacteria 1887
214 Ga0496102_0213034 3300048905 Bacteria 1821
215 Ga0496102_0366556 3300048905 Bacteria 1356
216 Ga0496102_0372164 3300048905 Bacteria 1344
217 Ga0496103_0042166 3300048906 Bacteria 2807
218 Ga0496104_0024674 3300048907 Bacteria 5533
219 Ga0496104_0137994 3300048907 Bacteria 2343
220 Ga0496105_0011169 3300048908 Bacteria 7083
221 Ga0496105_0196050 3300048908 Bacteria 1650
222 Ga0496105_0833569 3300048908 Bacteria 699
223 Ga0496105_0855994 3300048908 Unclassified 688
224 Ga0496106_0005337 3300048909 Bacteria 9510
225 Ga0496106_0006535 3300048909 Bacteria 8631
226 Ga0496106_0239574 3300048909 Bacteria 1449
227 Ga0496107_0004326 3300048910 Bacteria 9613
228 Ga0496107_0033300 3300048910 Bacteria 3686
229 Ga0496107_0040065 3300048910 Bacteria 3361
230 Ga0496107_0325900 3300048910 Bacteria 1143
231 Ga0496108_0201331 3300048911 Bacteria 1728
232 Ga0496108_0360258 3300048911 Unclassified 1269
233 Ga0496108_0422010 3300048911 Bacteria 1165
234 Ga0496110_0072710 3300048913 Bacteria 3052
235 Ga0496110_0215674 3300048913 Bacteria 1745
236 Ga0496110_0775716 3300048913 Unclassified 862
237 Ga0496110_0783323 3300048913 Unclassified 858
238 Ga0496111_0026977 3300048914 Bacteria 4059
239 Ga0496111_0061070 3300048914 Bacteria 2732
240 Ga0496112_0068071 3300048915 Bacteria 3516
241 Ga0496113_0000240 3300048916 Bacteria 25763
242 Ga0496114_0076647 3300048917 Bacteria 2817
243 Ga0496114_0105780 3300048917 Bacteria 2407
244 Ga0496114_1029298 3300048917 Bacteria 707
245 Ga0501040_0011657 3300049576 Bacteria 5754
246 Ga0501042_0094262 3300049578 Bacteria 2150
247 Ga0501048_0166236 3300049582 Bacteria 1562
248 Ga0501069_0141529 3300049585 Bacteria 1380
249 Ga0501069_0263297 3300049585 Bacteria 1007
250 Ga0501070_0568193 3300049586 Bacteria 906
251 Ga0501077_0117868 3300049593 Bacteria 1683
252 Ga0501079_0024552 3300049741 Bacteria 4626
253 Ga0501081_0021712 3300049743 Bacteria 4286
254 Ga0501045_0097812 3300049824 Bacteria 2171
255 nmdc:mga05p37_249844_c1 3300050507 Bacteria 2128
256 nmdc:mga09592_214592_c1 3300050508 Bacteria 1667
257 nmdc:mga06r32_206448_c1 3300050510 Unclassified 1953
258 nmdc:mga08y16_246629_c1 3300050511 Bacteria 1846
259 nmdc:mga08y16_80251_c1 3300050511 Bacteria 3402
260 nmdc:mga0n895_347731_c1 3300050512 Bacteria 1502
261 nmdc:mga0n895_43613_c1 3300050512 Bacteria 4371
262 nmdc:mga0rr50_134139_c1 3300050513 Bacteria 1986
263 nmdc:mga08x19_246523_c1 3300050514 Bacteria 1232
264 nmdc:mga0a205_128107_c1 3300050515 Bacteria 2438
265 Ga0495601_0232128 3300053077 Unclassified 1205
266 Ga0495612_0277867 3300053078 Bacteria 748
267 Ga0501084_0084641 3300054114 Bacteria 2662
268 Ga0587099_026568 3300059622 Bacteria 684
269 Ga0587075_017373 3300059644 Bacteria 1034
270 Ga0501082_0038512 3300060353 Bacteria 4126
271 Ga0496100_0031655
272 Ga0058862_12841993
273 Ga0070658_10071560
274 Ga0070658_10108772
275 Ga0070658_10303428
276 Ga0070658_10677107
277 Ga0070683_100000408
278 Ga0070683_100132341
279 Ga0070683_100843942
280 Ga0070690_100906924
281 Ga0070680_100007559
282 Ga0070680_100217375
283 Ga0070660_100001912
284 Ga0070671_100067693
285 Ga0070673_100221092
286 Ga0070659_100194718
287 Ga0070709_10103802
288 Ga0070709_10244294
289 Ga0070714_100055155
290 Ga0070713_100489746
291 Ga0070708_100075251
292 Ga0070663_100710170
293 Ga0070678_100324536
294 Ga0070681_10012610
295 Ga0070681_10244127
296 Ga0070707_100152671
297 Ga0070699_100162273
298 Ga0070679_100029837
299 Ga0070684_100002425
300 Ga0070684_100074541
301 Ga0070684_100142966
302 Ga0070693_100296608
303 Ga0070704_100773497
304 Ga0068854_100977894
305 Ga0068856_100100911
306 Ga0068852_100114774
307 Ga0068861_101392772
308 Ga0068870_10709080
309 Ga0081455_10000621
310 Ga0081538_10001394
311 Ga0081538_10010466
312 Ga0070716_100011672
313 Ga0068871_100185655
314 Ga0068871_101335297
315 Ga0075428_100228035
316 Ga0075431_100025642
317 Ga0075433_10305651
318 Ga0075433_10720124
319 Ga0075433_10720126
320 Ga0075434_100125785
321 Ga0075434_100951135
322 Ga0075434_100951136
323 Ga0075429_100291003
324 Ga0068865_100994700
325 Ga0075436_100007832
326 Ga0075435_100150490
327 Ga0111539_10282145
328 Ga0111539_11342635
329 Ga0105245_10179870
330 Ga0105245_10388889
331 Ga0105245_10506382
332 Ga0114129_10090128
333 Ga0105242_10028966
334 Ga0105248_10218695
335 Ga0105238_10985274
336 Ga0105249_10120338
337 Ga0157370_10002580
338 Ga0157370_10960627
339 Ga0157369_10019494
340 Ga0157369_10046225
341 Ga0157369_10097350
342 Ga0157374_10217978
343 Ga0157372_10494868
344 Ga0157372_10540023
345 Ga0157375_10043673
346 Ga0182008_10104069
347 Ga0157379_10312377
348 Ga0157376_10284957
349 Ga0197907_10710777
350 Ga0206356_10011615
351 Ga0206356_10033949
352 Ga0206356_11617213
353 Ga0206356_11797695
354 Ga0206349_1482757
355 Ga0206355_1134943
356 Ga0206355_1285690
357 Ga0206351_10830140
358 Ga0206352_10565281
359 Ga0206352_10862525
360 Ga0206350_10217700
361 Ga0206353_10272012
362 Ga0206353_11364517
363 Ga0154015_1247260
364 Ga0213876_10125063
365 Ga0213875_10110426
366 Ga0224712_10018200
367 Ga0224712_10209900
368 Ga0207699_10091547
369 Ga0207705_10041116
370 Ga0207705_10168816
371 Ga0207705_10534601
372 Ga0207707_10016774
373 Ga0207707_10131725
374 Ga0207693_10109129
375 Ga0207660_10016865
376 Ga0207660_10186474
377 Ga0207657_10002132
378 Ga0207652_10074729
379 Ga0207687_10174963
380 Ga0207644_10073444
381 Ga0207644_10206593
382 Ga0207690_10076247
383 Ga0207704_10603426
384 Ga0207665_10007283
385 Ga0207711_10155576
386 Ga0207661_10222807
387 Ga0207661_10332175
388 Ga0207661_10717079
389 Ga0207678_10990528
390 Ga0207702_10098512
391 Ga0207683_10113479
392 Ga0207698_10136384
393 Ga0209966_1001313
394 Ga0209998_10006849
395 Ga0207428_10004378
396 Ga0307409_100037083
397 Ga0373926_0085509
398 Ga0373929_0083570
399 Ga0373944_0038508
400 Ga0373936_0033534
401 Ga0373945_0018006
402 Ga0373931_0674873
403 Ga0373935_0015539
404 Ga0373927_0200054
405 Ga0373925_0009350
406 Ga0395899_0001477
407 Ga0395899_0003284
408 Ga0395899_0004271
409 Ga0395899_0662956
410 Ga0395900_0006264
411 Ga0395900_0010698
412 Ga0395900_0025682
413 Ga0395900_0057448
414 Ga0395900_0133944
415 Ga0395900_1057164
416 Ga0395898_0003893
417 Ga0395898_0026518
418 Ga0395898_0039050
419 Ga0395898_0088919
420 Ga0395905_0001505
421 Ga0395905_0002846
422 Ga0395905_1493918
423 Ga0436364_0834842
424 Ga0395901_0001627
425 Ga0395901_0010720
426 Ga0395901_0016291
427 Ga0395901_0067194
428 Ga0395901_0076806
429 Ga0395901_0133021
430 Ga0395901_0719672
431 Ga0395901_1356590
432 Ga0395901_1420940
433 Ga0436363_0403702
434 Ga0451802_1980982
435 Ga0451807_1224012
436 Ga0451845_0850279
437 Ga0451851_1017182
438 Ga0451853_2938752
439 Ga0439448_0004618
440 Ga0439448_0023272
441 Ga0439450_011343
442 Ga0439458_0023303
443 Ga0439459_0051102
444 Ga0439460_0210013
445 Ga0466966_0023976
446 Ga0466961_0006310
447 Ga0466963_0052257
448 Ga0466964_0040617
449 Ga0466964_0054478
450 Ga0466964_0213100
451 Ga0466964_0244563
452 Ga0466971_0010696
453 Ga0466957_0127708
454 Ga0466959_0019191
455 Ga0466958_0145377
456 Ga0466958_0217800
457 Ga0466967_0076150
458 Ga0466967_0101754
459 Ga0466967_0137364
460 Ga0466967_0287992
461 Ga0466967_0359206
462 Ga0495603_0243923
463 Ga0495641_0072412
464 Ga0495582_0025205
465 Ga0495628_0480521
466 Ga0495630_0079314
467 Ga0495630_0254971
468 Ga0495665_0213436
469 Ga0495658_0032342
470 Ga0495613_0650520
471 Ga0495624_0337441
472 Ga0495581_0420820
473 Ga0495674_0177261
474 Ga0495676_0186016
475 Ga0495676_0613366
476 Ga0496100_0031283
477 Ga0496100_0210919
478 Ga0496100_1449582
479 Ga0496101_0001412
480 Ga0496101_0024776
481 Ga0496101_0030619
482 Ga0496101_0131160
483 Ga0496101_0133522
484 Ga0496102_0213034
485 Ga0496102_0366556
486 Ga0496102_0372164
487 Ga0496103_0042166
488 Ga0496104_0024674
489 Ga0496104_0137994
490 Ga0496105_0011169
491 Ga0496105_0196050
492 Ga0496105_0833569
493 Ga0496105_0855994
494 Ga0496106_0005337
495 Ga0496106_0006535
496 Ga0496106_0239574
497 Ga0496107_0004326
498 Ga0496107_0033300
499 Ga0496107_0040065
500 Ga0496107_0325900
501 Ga0496108_0201331
502 Ga0496108_0360258
503 Ga0496108_0422010
504 Ga0496110_0072710
505 Ga0496110_0215674
506 Ga0496110_0775716
507 Ga0496110_0783323
508 Ga0496111_0026977
509 Ga0496111_0061070
510 Ga0496112_0068071
511 Ga0496113_0000240
512 Ga0496114_0076647
513 Ga0496114_0105780
514 Ga0496114_1029298
515 Ga0501040_0011657
516 Ga0501042_0094262
517 Ga0501048_0166236
518 Ga0501069_0141529
519 Ga0501069_0263297
520 Ga0501070_0568193
521 Ga0501077_0117868
522 Ga0501079_0024552
523 Ga0501081_0021712
524 Ga0501045_0097812
525 nmdc:mga05p37_249844_c1
526 nmdc:mga09592_214592_c1
527 nmdc:mga06r32_206448_c1
528 nmdc:mga08y16_246629_c1
529 nmdc:mga08y16_80251_c1
530 nmdc:mga0n895_347731_c1
531 nmdc:mga0n895_43613_c1
532 nmdc:mga0rr50_134139_c1
533 nmdc:mga08x19_246523_c1
534 nmdc:mga0a205_128107_c1
535 Ga0495601_0232128
536 Ga0495612_0277867
537 Ga0501084_0084641
538 Ga0587099_026568
539 Ga0587075_017373
540 Ga0501082_0038512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09990

DUF2231

Predicted membrane protein (DUF2231)

15

153

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mk4-assembly1.cif.gz_A co-bound crystal structure of the engineered cyt cb562 variant, dicyt2 0.7051 24 139
7uuw-assembly1.cif.gz_G cryogenic electron microscopy 3d map of f-actin bound by the actin binding domain of alpha-catenin ortholog, hmp1 0.6806 25 149
3tol-assembly2.cif.gz_D crystal structure of an engineered cytochrome cb562 that forms 1d, zn-mediated coordination polymers 0.6769 24 138
7mk4-assembly1.cif.gz_A co-bound crystal structure of the engineered cyt cb562 variant, dicyt2 0.6726 24 139
6dyf-assembly2.cif.gz_B cu(ii)-bound structure of the engineered cyt cb562 variant, ch3y 0.6694 24 138
ID Description Score Start End Superfamily
af_A4HUD2_134_280_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8591 85 143 1.20.140.150
af_P56788_6_183_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.781 86 143 2.30.29.30
af_A4I3I9_159_313_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7256 75 145 1.20.140.150
af_Q54TU2_879_984_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7107 24 143 1.20.120.230
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7075 19 148 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A538C9I3-F1-model_v4 DUF2231 domain-containing protein 0.9345 18 157 GO:0016020
AF-A0A7W0T7J6-F1-model_v4 DUF2231 domain-containing protein 0.9345 3 130 GO:0016020
AF-Q1AS96-F1-model_v4 Membrane protein-like protein 0.9293 16 143 GO:0016020
AF-A0A1G9S1A0-F1-model_v4 DUF2231 domain-containing protein 0.9289 19 145 GO:0016020
AF-A0A1W2FTX2-F1-model_v4 Predicted membrane protein 0.928 26 147 GO:0016020

Map