F377133

General Info

Members Datasets Scaffolds Average Seq Length
270 140 540 222

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0012135|Ga0466963_0012135_65_706
Length 213
Sequence MRAVVFDVDFTIAKPGPDLGPDGYRRLGERYGLTLDPARYDDARRAALADLERHPELDHDEEIWVLFTRRIIEGMGGRAAVEMERAWSNAHHFELYDDALPTLDALRRRGVLIGLLSNTSRDLDDFVGHHGLSVDAVLTSRAHGKTKPHETIFRRMLELLEVDAGEALMVGDTLEDDVHGARAIGMHAVLVDRDGRYPGEESLDDLRAVAALV

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.26
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0012135 3300044694 Bacteria 5267
2 Ga0070658_10033489 3300005327 Bacteria 4134
3 Ga0070683_100007706 3300005329 Bacteria 9114
4 Ga0070683_100246130 3300005329 Unclassified 1701
5 Ga0070683_100573394 3300005329 Bacteria 1079
6 Ga0070680_100046895 3300005336 Bacteria 3516
7 Ga0070680_100069429 3300005336 Bacteria 2893
8 Ga0070680_100080170 3300005336 Bacteria 2692
9 Ga0070682_100046430 3300005337 Bacteria 2695
10 Ga0070682_100328996 3300005337 Bacteria 1132
11 Ga0070660_100003290 3300005339 Bacteria 11105
12 Ga0070660_100052724 3300005339 Bacteria 3136
13 Ga0070660_100166895 3300005339 Bacteria 1776
14 Ga0070661_100011552 3300005344 Bacteria 6153
15 Ga0070661_100087983 3300005344 Bacteria 2298
16 Ga0070674_100382007 3300005356 Unclassified 1146
17 Ga0070659_100131925 3300005366 Bacteria 2029
18 Ga0070714_100504519 3300005435 Unclassified 1154
19 Ga0070713_100533613 3300005436 Bacteria 1110
20 Ga0070681_10007496 3300005458 Bacteria 10665
21 Ga0070681_10049364 3300005458 Bacteria 4203
22 Ga0070681_10130268 3300005458 Bacteria 2448
23 Ga0070681_10140243 3300005458 Bacteria 2347
24 Ga0070685_10314234 3300005466 Bacteria 1060
25 Ga0070707_100284164 3300005468 Bacteria 1608
26 Ga0070679_100002971 3300005530 Bacteria 15469
27 Ga0070679_100016558 3300005530 Bacteria 7117
28 Ga0070679_100044088 3300005530 Bacteria 4443
29 Ga0070679_100107873 3300005530 Bacteria 2770
30 Ga0070679_100195389 3300005530 Bacteria 1991
31 Ga0070679_100271046 3300005530 Bacteria 1651
32 Ga0070684_100033067 3300005535 Bacteria 4412
33 Ga0070684_100508671 3300005535 Bacteria 1116
34 Ga0070696_100034099 3300005546 Bacteria 3501
35 Ga0070696_100124667 3300005546 Bacteria 1868
36 Ga0068855_100037506 3300005563 Bacteria 5763
37 Ga0068855_100110578 3300005563 Bacteria 3154
38 Ga0068855_100149042 3300005563 Bacteria 2661
39 Ga0068855_100310327 3300005563 Bacteria 1745
40 Ga0068855_100621982 3300005563 Bacteria 1163
41 Ga0068854_100554868 3300005578 Bacteria 975
42 Ga0068856_100121223 3300005614 Bacteria 2617
43 Ga0068856_100151643 3300005614 Bacteria 2327
44 Ga0068856_100247525 3300005614 Bacteria 1798
45 Ga0068852_100110083 3300005616 Bacteria 2502
46 Ga0070712_100024346 3300006175 Bacteria 4011
47 Ga0105240_10026689 3300009093 Bacteria 7577
48 Ga0105240_10182510 3300009093 Bacteria 2475
49 Ga0105238_10066056 3300009551 Bacteria 3619
50 Ga0105239_10146598 3300010375 Bacteria 2633
51 Ga0105239_11334384 3300010375 Unclassified 828
52 Ga0157373_10030099 3300013100 Bacteria 3907
53 Ga0157371_10061564 3300013102 Bacteria 2660
54 Ga0157370_10010927 3300013104 Bacteria 9533
55 Ga0157370_10046274 3300013104 Bacteria 4172
56 Ga0157370_10073389 3300013104 Bacteria 3228
57 Ga0157369_10092329 3300013105 Bacteria 3231
58 Ga0157369_10303853 3300013105 Bacteria 1659
59 Ga0157378_10516207 3300013297 Bacteria 1196
60 Ga0157372_10012605 3300013307 Bacteria 9002
61 Ga0157372_10229150 3300013307 Bacteria 2154
62 Ga0157372_10636849 3300013307 Bacteria 1242
63 Ga0206353_10533397 3300020082 Bacteria 2032
64 Ga0206353_10746989 3300020082 Bacteria 1753
65 Ga0206353_11343213 3300020082 Bacteria 2226
66 Ga0213876_10082294 3300021384 Bacteria 1703
67 Ga0213875_10055917 3300021388 Bacteria 1848
68 Ga0207705_10074196 3300025909 Bacteria 2469
69 Ga0207705_10217243 3300025909 Bacteria 1451
70 Ga0207705_10226171 3300025909 Bacteria 1422
71 Ga0207684_10343015 3300025910 Bacteria 1286
72 Ga0207707_10021141 3300025912 Bacteria 5686
73 Ga0207707_10030352 3300025912 Bacteria 4729
74 Ga0207707_10100470 3300025912 Bacteria 2528
75 Ga0207707_10124406 3300025912 Bacteria 2255
76 Ga0207695_10357611 3300025913 Bacteria 1347
77 Ga0207660_10275971 3300025917 Unclassified 1333
78 Ga0207660_10506488 3300025917 Bacteria 980
79 Ga0207660_10516103 3300025917 Unclassified 970
80 Ga0207657_10000486 3300025919 Bacteria 41915
81 Ga0207657_10004868 3300025919 Bacteria 14131
82 Ga0207657_10020332 3300025919 Bacteria 6276
83 Ga0207657_10112485 3300025919 Bacteria 2247
84 Ga0207649_10013505 3300025920 Bacteria 4559
85 Ga0207649_10119071 3300025920 Bacteria 1777
86 Ga0207652_10052012 3300025921 Bacteria 3514
87 Ga0207652_10242183 3300025921 Bacteria 1626
88 Ga0207646_10170888 3300025922 Unclassified 1963
89 Ga0207694_10045763 3300025924 Bacteria 3380
90 Ga0207694_10173613 3300025924 Bacteria 1746
91 Ga0207700_10236233 3300025928 Bacteria 1556
92 Ga0207664_10316739 3300025929 Bacteria 1376
93 Ga0207664_10441846 3300025929 Bacteria 1160
94 Ga0207690_10084807 3300025932 Bacteria 2222
95 Ga0207661_10112300 3300025944 Bacteria 2307
96 Ga0207661_10144089 3300025944 Bacteria 2053
97 Ga0207661_10156350 3300025944 Bacteria 1975
98 Ga0207661_10260055 3300025944 Bacteria 1546
99 Ga0207667_10157049 3300025949 Bacteria 2340
100 Ga0207667_10259907 3300025949 Bacteria 1775
101 Ga0207667_10342707 3300025949 Bacteria 1525
102 Ga0207678_10230318 3300026067 Bacteria 1586
103 Ga0207702_10226483 3300026078 Bacteria 1745
104 Ga0207702_10274899 3300026078 Bacteria 1590
105 Ga0207698_10115207 3300026142 Unclassified 2263
106 Ga0265318_10010086 3300028577 Bacteria 4127
107 Ga0265336_10049892 3300028666 Bacteria 1267
108 Ga0265338_10020534 3300028800 Bacteria 6945
109 Ga0265338_10070334 3300028800 Bacteria 3001
110 Ga0265330_10049948 3300031235 Bacteria 1835
111 Ga0265330_10122282 3300031235 Bacteria 1109
112 Ga0265325_10007808 3300031241 Bacteria 6371
113 Ga0265329_10011332 3300031242 Bacteria 3243
114 Ga0265327_10006558 3300031251 Bacteria 9263
115 Ga0265327_10033101 3300031251 Bacteria 2885
116 Ga0265316_10004699 3300031344 Bacteria 13532
117 Ga0265313_10011658 3300031595 Bacteria 5446
118 Ga0265314_10181474 3300031711 Unclassified 1261
119 Ga0265342_10006169 3300031712 Bacteria 8966
120 Ga0373944_0016538 3300035089 Bacteria 2082
121 Ga0373936_0004259 3300035113 Bacteria 5403
122 Ga0373945_0026118 3300035116 Bacteria 2033
123 Ga0373943_0006928 3300035170 Bacteria 5085
124 Ga0373935_0050076 3300035692 Bacteria 2650
125 Ga0373947_0001712 3300035725 Bacteria 13442
126 Ga0373925_0005713 3300037068 Bacteria 9247
127 Ga0395899_0040403 3300037312 Bacteria 3489
128 Ga0395900_0133528 3300037418 Bacteria 2543
129 Ga0395900_0197091 3300037418 Bacteria 2039
130 Ga0395900_0359519 3300037418 Bacteria 1428
131 Ga0395898_0002618 3300037466 Bacteria 20929
132 Ga0395898_0029485 3300037466 Bacteria 5496
133 Ga0395898_0045102 3300037466 Bacteria 4334
134 Ga0395898_0215926 3300037466 Bacteria 1829
135 Ga0395905_0050422 3300037471 Bacteria 3899
136 Ga0395905_0062445 3300037471 Bacteria 3485
137 Ga0395905_0173815 3300037471 Bacteria 2023
138 Ga0395905_0374489 3300037471 Bacteria 1317
139 Ga0395905_0481586 3300037471 Bacteria 1140
140 Ga0436364_0397233 3300037853 Bacteria 2544
141 Ga0395901_0001138 3300038443 Bacteria 28189
142 Ga0395901_0009017 3300038443 Bacteria 10100
143 Ga0395901_0029548 3300038443 Bacteria 5644
144 Ga0395901_0075994 3300038443 Bacteria 3504
145 Ga0395901_0297254 3300038443 Bacteria 1674
146 Ga0395901_0571383 3300038443 Bacteria 1143
147 Ga0436365_1340388 3300039437 Bacteria 3548
148 Ga0436363_0175533 3300039450 Bacteria 1121
149 Ga0439448_0010186 3300042005 Bacteria 2782
150 Ga0466969_0028358 3300044656 Bacteria 2862
151 Ga0466965_0088374 3300044683 Unclassified 1574
152 Ga0466966_0035871 3300044684 Bacteria 3203
153 Ga0466966_0145923 3300044684 Bacteria 1444
154 Ga0466961_0004798 3300044693 Bacteria 8510
155 Ga0466961_0043717 3300044693 Bacteria 2868
156 Ga0466961_0142357 3300044693 Bacteria 1501
157 Ga0466963_0004091 3300044694 Bacteria 8437
158 Ga0466963_0042143 3300044694 Bacteria 2996
159 Ga0466963_0053890 3300044694 Bacteria 2672
160 Ga0466963_0094178 3300044694 Bacteria 2043
161 Ga0466963_0228071 3300044694 Bacteria 1305
162 Ga0466963_0281432 3300044694 Bacteria 1169
163 Ga0466963_0396022 3300044694 Bacteria 974
164 Ga0466963_0534919 3300044694 Bacteria 827
165 Ga0466971_0008519 3300044719 Bacteria 4473
166 Ga0466971_0018701 3300044719 Bacteria 3072
167 Ga0466971_0094128 3300044719 Bacteria 1373
168 Ga0466968_0170901 3300044735 Bacteria 1007
169 Ga0466970_0032657 3300044765 Bacteria 2750
170 Ga0466970_0093412 3300044765 Bacteria 1634
171 Ga0466970_0124002 3300044765 Bacteria 1416
172 Ga0466957_0002584 3300044842 Bacteria 9749
173 Ga0466957_0026968 3300044842 Bacteria 3411
174 Ga0466957_0043807 3300044842 Bacteria 2711
175 Ga0466957_0056444 3300044842 Bacteria 2401
176 Ga0466957_0098531 3300044842 Bacteria 1840
177 Ga0466957_0343529 3300044842 Bacteria 1011
178 Ga0466959_0001566 3300045049 Bacteria 14087
179 Ga0466959_0021530 3300045049 Bacteria 4756
180 Ga0466959_0038135 3300045049 Bacteria 3551
181 Ga0466959_0091733 3300045049 Bacteria 2181
182 Ga0451576_1001859 3300045051 Unclassified 876
183 Ga0466958_0001411 3300045836 Bacteria 11368
184 Ga0466967_0003288 3300045976 Bacteria 10489
185 Ga0466967_0013793 3300045976 Bacteria 6263
186 Ga0466967_0058871 3300045976 Bacteria 3397
187 Ga0466967_0066581 3300045976 Bacteria 3210
188 Ga0466967_0112489 3300045976 Bacteria 2503
189 Ga0466967_0126768 3300045976 Bacteria 2365
190 Ga0466967_0135470 3300045976 Bacteria 2290
191 Ga0466967_0181170 3300045976 Bacteria 1987
192 Ga0466967_0264868 3300045976 Bacteria 1645
193 Ga0466967_0299871 3300045976 Bacteria 1546
194 Ga0466967_0485950 3300045976 Bacteria 1210
195 Ga0466967_0809546 3300045976 Bacteria 930
196 Ga0466967_0870359 3300045976 Bacteria 896
197 Ga0466967_1045708 3300045976 Bacteria 813
198 Ga0495629_0096726 3300046459 Bacteria 2060
199 Ga0495641_0030539 3300046461 Bacteria 2583
200 Ga0495651_0006492 3300046462 Bacteria 8938
201 Ga0495582_0067942 3300046473 Bacteria 1970
202 Ga0495664_0035738 3300046477 Bacteria 2927
203 Ga0495608_0006732 3300046511 Bacteria 8149
204 Ga0495618_0011881 3300046514 Bacteria 5284
205 Ga0495630_0002498 3300046517 Bacteria 12751
206 Ga0495630_0206972 3300046517 Bacteria 1498
207 Ga0495666_0045599 3300046526 Bacteria 2115
208 Ga0495652_0079877 3300046529 Bacteria 2703
209 Ga0495665_0083984 3300046531 Bacteria 1674
210 Ga0495640_0005060 3300046533 Bacteria 10466
211 Ga0495587_0065274 3300046536 Bacteria 2126
212 Ga0495587_0116380 3300046536 Bacteria 1533
213 Ga0495587_0132235 3300046536 Bacteria 1426
214 Ga0495645_0081909 3300046543 Bacteria 2315
215 Ga0495667_0026487 3300046559 Bacteria 3908
216 Ga0495658_0008622 3300046683 Bacteria 5059
217 Ga0495658_0023689 3300046683 Bacteria 3262
218 Ga0495658_0039805 3300046683 Bacteria 2610
219 Ga0495613_0061241 3300046689 Bacteria 2756
220 Ga0495624_0435377 3300046690 Bacteria 786
221 Ga0495600_0025148 3300046809 Bacteria 3837
222 Ga0495581_0394681 3300047315 Bacteria 807
223 Ga0495674_0025719 3300047319 Bacteria 5391
224 Ga0495676_0139311 3300047321 Bacteria 1740
225 Ga0495676_0207686 3300047321 Bacteria 1357
226 Ga0495680_0002487 3300047322 Bacteria 18843
227 Ga0495680_0517326 3300047322 Bacteria 808
228 Ga0495684_0011237 3300047471 Bacteria 6919
229 Ga0495614_0176859 3300048089 Bacteria 959
230 Ga0496100_0005017 3300048903 Bacteria 7082
231 Ga0496100_0029066 3300048903 Bacteria 3415
232 Ga0496101_0007238 3300048904 Bacteria 7180
233 Ga0496101_0069693 3300048904 Bacteria 2573
234 Ga0496102_0040195 3300048905 Bacteria 4229
235 Ga0496102_0087572 3300048905 Bacteria 2877
236 Ga0496103_0142309 3300048906 Bacteria 1534
237 Ga0496104_0006637 3300048907 Bacteria 10184
238 Ga0496105_0036476 3300048908 Bacteria 4050
239 Ga0496106_0002641 3300048909 Bacteria 13330
240 Ga0496107_0009294 3300048910 Bacteria 6814
241 Ga0496108_0060740 3300048911 Bacteria 3181
242 Ga0496108_0519174 3300048911 Bacteria 1040
243 Ga0496109_0017956 3300048912 Bacteria 6211
244 Ga0496109_0328910 3300048912 Bacteria 1443
245 Ga0496109_0840350 3300048912 Bacteria 856
246 Ga0496110_0002201 3300048913 Bacteria 14564
247 Ga0496112_0063085 3300048915 Bacteria 3655
248 Ga0496112_0197644 3300048915 Unclassified 1971
249 Ga0496112_0268800 3300048915 Bacteria 1653
250 Ga0496112_0276595 3300048915 Bacteria 1626
251 Ga0496113_0027030 3300048916 Bacteria 4109
252 Ga0496114_0049323 3300048917 Bacteria 3502
253 Ga0496114_0166867 3300048917 Bacteria 1917
254 Ga0496115_0067267 3300048918 Bacteria 2897
255 Ga0501034_0092200 3300049571 Bacteria 3027
256 Ga0501046_0170461 3300049580 Bacteria 1634
257 Ga0501047_0019348 3300049581 Bacteria 6532
258 Ga0501047_0035645 3300049581 Bacteria 4806
259 Ga0501069_0097582 3300049585 Bacteria 1666
260 Ga0501070_0000932 3300049586 Bacteria 26359
261 Ga0501070_0086135 3300049586 Bacteria 2601
262 Ga0501070_0303031 3300049586 Bacteria 1301
263 Ga0501074_0346648 3300049590 Bacteria 1054
264 Ga0501080_0079354 3300049742 Bacteria 3052
265 Ga0501080_0089452 3300049742 Bacteria 2860
266 Ga0501080_0341034 3300049742 Bacteria 1354
267 Ga0501080_0417707 3300049742 Bacteria 1205
268 Ga0495619_0204167 3300053085 Bacteria 1368
269 Ga0466962_0000349 3300061719 Bacteria 19818
270 Ga0466962_0009541 3300061719 Bacteria 4654
271 Ga0466963_0012135
272 Ga0070658_10033489
273 Ga0070683_100007706
274 Ga0070683_100246130
275 Ga0070683_100573394
276 Ga0070680_100046895
277 Ga0070680_100069429
278 Ga0070680_100080170
279 Ga0070682_100046430
280 Ga0070682_100328996
281 Ga0070660_100003290
282 Ga0070660_100052724
283 Ga0070660_100166895
284 Ga0070661_100011552
285 Ga0070661_100087983
286 Ga0070674_100382007
287 Ga0070659_100131925
288 Ga0070714_100504519
289 Ga0070713_100533613
290 Ga0070681_10007496
291 Ga0070681_10049364
292 Ga0070681_10130268
293 Ga0070681_10140243
294 Ga0070685_10314234
295 Ga0070707_100284164
296 Ga0070679_100002971
297 Ga0070679_100016558
298 Ga0070679_100044088
299 Ga0070679_100107873
300 Ga0070679_100195389
301 Ga0070679_100271046
302 Ga0070684_100033067
303 Ga0070684_100508671
304 Ga0070696_100034099
305 Ga0070696_100124667
306 Ga0068855_100037506
307 Ga0068855_100110578
308 Ga0068855_100149042
309 Ga0068855_100310327
310 Ga0068855_100621982
311 Ga0068854_100554868
312 Ga0068856_100121223
313 Ga0068856_100151643
314 Ga0068856_100247525
315 Ga0068852_100110083
316 Ga0070712_100024346
317 Ga0105240_10026689
318 Ga0105240_10182510
319 Ga0105238_10066056
320 Ga0105239_10146598
321 Ga0105239_11334384
322 Ga0157373_10030099
323 Ga0157371_10061564
324 Ga0157370_10010927
325 Ga0157370_10046274
326 Ga0157370_10073389
327 Ga0157369_10092329
328 Ga0157369_10303853
329 Ga0157378_10516207
330 Ga0157372_10012605
331 Ga0157372_10229150
332 Ga0157372_10636849
333 Ga0206353_10533397
334 Ga0206353_10746989
335 Ga0206353_11343213
336 Ga0213876_10082294
337 Ga0213875_10055917
338 Ga0207705_10074196
339 Ga0207705_10217243
340 Ga0207705_10226171
341 Ga0207684_10343015
342 Ga0207707_10021141
343 Ga0207707_10030352
344 Ga0207707_10100470
345 Ga0207707_10124406
346 Ga0207695_10357611
347 Ga0207660_10275971
348 Ga0207660_10506488
349 Ga0207660_10516103
350 Ga0207657_10000486
351 Ga0207657_10004868
352 Ga0207657_10020332
353 Ga0207657_10112485
354 Ga0207649_10013505
355 Ga0207649_10119071
356 Ga0207652_10052012
357 Ga0207652_10242183
358 Ga0207646_10170888
359 Ga0207694_10045763
360 Ga0207694_10173613
361 Ga0207700_10236233
362 Ga0207664_10316739
363 Ga0207664_10441846
364 Ga0207690_10084807
365 Ga0207661_10112300
366 Ga0207661_10144089
367 Ga0207661_10156350
368 Ga0207661_10260055
369 Ga0207667_10157049
370 Ga0207667_10259907
371 Ga0207667_10342707
372 Ga0207678_10230318
373 Ga0207702_10226483
374 Ga0207702_10274899
375 Ga0207698_10115207
376 Ga0265318_10010086
377 Ga0265336_10049892
378 Ga0265338_10020534
379 Ga0265338_10070334
380 Ga0265330_10049948
381 Ga0265330_10122282
382 Ga0265325_10007808
383 Ga0265329_10011332
384 Ga0265327_10006558
385 Ga0265327_10033101
386 Ga0265316_10004699
387 Ga0265313_10011658
388 Ga0265314_10181474
389 Ga0265342_10006169
390 Ga0373944_0016538
391 Ga0373936_0004259
392 Ga0373945_0026118
393 Ga0373943_0006928
394 Ga0373935_0050076
395 Ga0373947_0001712
396 Ga0373925_0005713
397 Ga0395899_0040403
398 Ga0395900_0133528
399 Ga0395900_0197091
400 Ga0395900_0359519
401 Ga0395898_0002618
402 Ga0395898_0029485
403 Ga0395898_0045102
404 Ga0395898_0215926
405 Ga0395905_0050422
406 Ga0395905_0062445
407 Ga0395905_0173815
408 Ga0395905_0374489
409 Ga0395905_0481586
410 Ga0436364_0397233
411 Ga0395901_0001138
412 Ga0395901_0009017
413 Ga0395901_0029548
414 Ga0395901_0075994
415 Ga0395901_0297254
416 Ga0395901_0571383
417 Ga0436365_1340388
418 Ga0436363_0175533
419 Ga0439448_0010186
420 Ga0466969_0028358
421 Ga0466965_0088374
422 Ga0466966_0035871
423 Ga0466966_0145923
424 Ga0466961_0004798
425 Ga0466961_0043717
426 Ga0466961_0142357
427 Ga0466963_0004091
428 Ga0466963_0042143
429 Ga0466963_0053890
430 Ga0466963_0094178
431 Ga0466963_0228071
432 Ga0466963_0281432
433 Ga0466963_0396022
434 Ga0466963_0534919
435 Ga0466971_0008519
436 Ga0466971_0018701
437 Ga0466971_0094128
438 Ga0466968_0170901
439 Ga0466970_0032657
440 Ga0466970_0093412
441 Ga0466970_0124002
442 Ga0466957_0002584
443 Ga0466957_0026968
444 Ga0466957_0043807
445 Ga0466957_0056444
446 Ga0466957_0098531
447 Ga0466957_0343529
448 Ga0466959_0001566
449 Ga0466959_0021530
450 Ga0466959_0038135
451 Ga0466959_0091733
452 Ga0451576_1001859
453 Ga0466958_0001411
454 Ga0466967_0003288
455 Ga0466967_0013793
456 Ga0466967_0058871
457 Ga0466967_0066581
458 Ga0466967_0112489
459 Ga0466967_0126768
460 Ga0466967_0135470
461 Ga0466967_0181170
462 Ga0466967_0264868
463 Ga0466967_0299871
464 Ga0466967_0485950
465 Ga0466967_0809546
466 Ga0466967_0870359
467 Ga0466967_1045708
468 Ga0495629_0096726
469 Ga0495641_0030539
470 Ga0495651_0006492
471 Ga0495582_0067942
472 Ga0495664_0035738
473 Ga0495608_0006732
474 Ga0495618_0011881
475 Ga0495630_0002498
476 Ga0495630_0206972
477 Ga0495666_0045599
478 Ga0495652_0079877
479 Ga0495665_0083984
480 Ga0495640_0005060
481 Ga0495587_0065274
482 Ga0495587_0116380
483 Ga0495587_0132235
484 Ga0495645_0081909
485 Ga0495667_0026487
486 Ga0495658_0008622
487 Ga0495658_0023689
488 Ga0495658_0039805
489 Ga0495613_0061241
490 Ga0495624_0435377
491 Ga0495600_0025148
492 Ga0495581_0394681
493 Ga0495674_0025719
494 Ga0495676_0139311
495 Ga0495676_0207686
496 Ga0495680_0002487
497 Ga0495680_0517326
498 Ga0495684_0011237
499 Ga0495614_0176859
500 Ga0496100_0005017
501 Ga0496100_0029066
502 Ga0496101_0007238
503 Ga0496101_0069693
504 Ga0496102_0040195
505 Ga0496102_0087572
506 Ga0496103_0142309
507 Ga0496104_0006637
508 Ga0496105_0036476
509 Ga0496106_0002641
510 Ga0496107_0009294
511 Ga0496108_0060740
512 Ga0496108_0519174
513 Ga0496109_0017956
514 Ga0496109_0328910
515 Ga0496109_0840350
516 Ga0496110_0002201
517 Ga0496112_0063085
518 Ga0496112_0197644
519 Ga0496112_0268800
520 Ga0496112_0276595
521 Ga0496113_0027030
522 Ga0496114_0049323
523 Ga0496114_0166867
524 Ga0496115_0067267
525 Ga0501034_0092200
526 Ga0501046_0170461
527 Ga0501047_0019348
528 Ga0501047_0035645
529 Ga0501069_0097582
530 Ga0501070_0000932
531 Ga0501070_0086135
532 Ga0501070_0303031
533 Ga0501074_0346648
534 Ga0501080_0079354
535 Ga0501080_0089452
536 Ga0501080_0341034
537 Ga0501080_0417707
538 Ga0495619_0204167
539 Ga0466962_0000349
540 Ga0466962_0009541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

145

210

0.89

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

4

191

0.8

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

1

185

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nrw-assembly1.cif.gz_A the structure of a haloacid dehalogenase-like hydrolase from b. subtilis 0.7633 100 147
1k1e-assembly1.cif.gz_A structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) 0.7379 109 198
2fi1-assembly1.cif.gz_A the crystal structure of a hydrolase from streptococcus pneumoniae tigr4 0.736 1 221
2voy-assembly1.cif.gz_I cryoem model of copa, the copper transporting atpase from archaeoglobus fulgidus 0.7293 104 220
2fi1-assembly1.cif.gz_A the crystal structure of a hydrolase from streptococcus pneumoniae tigr4 0.7293 1 221
ID Description Score Start End Superfamily
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8656 100 218 3.40.50.1000
af_Q94915_113_247_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8561 104 200 3.40.50.1000
af_B4F880_219_297_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8552 154 198 3.40.50.1000
3nasA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8487 106 197 3.40.50.1000
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8466 100 198 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y6CTR9-F1-model_v4 HAD-IA family hydrolase 0.9339 107 223 GO:0016791
GO:0044283
AF-A0A538FEX6-F1-model_v4 HAD-IIIA family hydrolase 0.9308 92 223 GO:0016787
AF-A0A7Y6CTR9-F1-model_v4 HAD-IA family hydrolase 0.8966 107 223 GO:0016791
GO:0044283
AF-A0A397CHG4-F1-model_v4 Uncharacterized protein 0.8579 107 213 GO:0005634
AF-A0A538FEX6-F1-model_v4 HAD-IIIA family hydrolase 0.8555 92 223 GO:0016787

Map