F377098

General Info

Members Datasets Scaffolds Average Seq Length
270 197 540 325

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_05772|Ga0400485_05772_11825_12928
Length 367
Sequence MVKQGLFFFSSSNGDFFLLYAVFHPVTNTERSHNKNGGPMKKRTLGANGPEVSTIGLGCMAMSEFYGKSDDTVSKKVILRALELGITMLDTADTYGLGHNETLIGKVIKEWPEEVFVATKFGIVRKPGEYTRTICGKPEYVRSSVEGSLTRLQVEAIDLYYIHRIDQNVPIEETVGAMSDLVHEGKIKYIGLSEPSAATVLKAHSVHPIIAVQSEYSLFTRDMEKELFPTLRQNKIGFVSYSPLGRGFLTSKINKESVSRADDFRQFLPRNRGDNYVRNMKLVNDLKQFSKDRDVTPAQVALAWVLAKGEDIVPIPGTRHLTYLEENIAAVGTRLSQEEIEQLETIFYPGAVVGERYTAEGMVGVNV

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
121 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
122 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
186 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
187 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
196 2738543009 Luteibacter sp. OK325 Isolate Unclassified
197 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0.74
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 2.96
Rhizosphere 78.89
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_05772 3300038735 Bacteria 33496
2 Ga0065715_10111179 3300005293 Bacteria 2585
3 Ga0065707_10135048 3300005295 Bacteria 1855
4 Ga0070658_10010416 3300005327 Bacteria 7455
5 Ga0070683_100431960 3300005329 Bacteria 1256
6 Ga0070670_100003815 3300005331 Bacteria 12558
7 Ga0070670_100346617 3300005331 Bacteria 1304
8 Ga0068869_100004168 3300005334 Bacteria 8966
9 Ga0070689_100026424 3300005340 Bacteria 4371
10 Ga0070669_100100425 3300005353 Bacteria 2182
11 Ga0070675_100005632 3300005354 Bacteria 9592
12 Ga0070671_100001033 3300005355 Bacteria 20484
13 Ga0070671_100380510 3300005355 Bacteria 1206
14 Ga0070674_100274377 3300005356 Bacteria 1334
15 Ga0070673_100003767 3300005364 Bacteria 9509
16 Ga0070688_100236220 3300005365 Bacteria 1295
17 Ga0070667_100019204 3300005367 Bacteria 5668
18 Ga0070705_100188971 3300005440 Bacteria 1402
19 Ga0070678_100034192 3300005456 Bacteria 3538
20 Ga0070678_100079524 3300005456 Bacteria 2480
21 Ga0070662_100017783 3300005457 Bacteria 4797
22 Ga0070662_100264875 3300005457 Bacteria 1386
23 Ga0070681_10061246 3300005458 Bacteria 3739
24 Ga0068867_100449545 3300005459 Bacteria 1097
25 Ga0070707_100024842 3300005468 Bacteria 5679
26 Ga0070707_100027860 3300005468 Bacteria 5374
27 Ga0070707_100079762 3300005468 Bacteria 3160
28 Ga0070698_100032847 3300005471 Bacteria 5375
29 Ga0070698_100169407 3300005471 Bacteria 2125
30 Ga0070699_100007210 3300005518 Bacteria 9671
31 Ga0070699_100356957 3300005518 Bacteria 1317
32 Ga0070679_100316695 3300005530 Bacteria 1510
33 Ga0070684_100024021 3300005535 Bacteria 5109
34 Ga0070697_100023458 3300005536 Bacteria 4906
35 Ga0068853_100017213 3300005539 Bacteria 5966
36 Ga0070672_100003282 3300005543 Bacteria 10475
37 Ga0070664_100006945 3300005564 Bacteria 9122
38 Ga0068857_100028631 3300005577 Bacteria 4915
39 Ga0068856_100026676 3300005614 Bacteria 5633
40 Ga0068856_100605930 3300005614 Bacteria 1116
41 Ga0070702_100070004 3300005615 Bacteria 2069
42 Ga0068852_100036283 3300005616 Bacteria 4123
43 Ga0068859_100363141 3300005617 Bacteria 1543
44 Ga0068861_100043852 3300005719 Bacteria 3360
45 Ga0068851_10061758 3300005834 Bacteria 1921
46 Ga0068863_100050142 3300005841 Bacteria 3958
47 Ga0068863_100264855 3300005841 Bacteria 1662
48 Ga0068862_100170954 3300005844 Bacteria 1946
49 Ga0068862_100303719 3300005844 Bacteria 1469
50 Ga0068862_100421472 3300005844 Bacteria 1253
51 Ga0081455_10000859 3300005937 Bacteria 39137
52 Ga0081455_10071596 3300005937 Bacteria 2873
53 Ga0081539_10000123 3300005985 Bacteria 181245
54 Ga0075369_10053229 3300006186 Bacteria 1756
55 Ga0075366_10043567 3300006195 Bacteria 2658
56 Ga0075428_100000810 3300006844 Bacteria 32679
57 Ga0075428_100016582 3300006844 Bacteria 8135
58 Ga0075428_100400996 3300006844 Bacteria 1470
59 Ga0075431_100001541 3300006847 Bacteria 21356
60 Ga0075431_100085312 3300006847 Bacteria 3259
61 Ga0075429_100009532 3300006880 Bacteria 8422
62 Ga0075429_100134726 3300006880 Bacteria 2162
63 Ga0068865_100171372 3300006881 Bacteria 1664
64 Ga0075436_100001352 3300006914 Bacteria 16679
65 Ga0097620_100363140 3300006931 Bacteria 1543
66 Ga0105240_10366369 3300009093 Bacteria 1631
67 Ga0105240_10394440 3300009093 Bacteria 1560
68 Ga0111539_10000575 3300009094 Bacteria 47142
69 Ga0111539_10001545 3300009094 Bacteria 30641
70 Ga0111539_10033114 3300009094 Bacteria 6275
71 Ga0105245_10000176 3300009098 Bacteria 60974
72 Ga0114129_10003641 3300009147 Bacteria 21681
73 Ga0114129_10056221 3300009147 Bacteria 5513
74 Ga0114129_10256934 3300009147 Bacteria 2343
75 Ga0114129_10820333 3300009147 Bacteria 1185
76 Ga0105243_10188442 3300009148 Bacteria 1800
77 Ga0105248_10014771 3300009177 Bacteria 8598
78 Ga0105238_10050514 3300009551 Bacteria 4186
79 Ga0105238_10112718 3300009551 Bacteria 2699
80 Ga0105249_10307574 3300009553 Bacteria 1592
81 Ga0105249_10416520 3300009553 Bacteria 1376
82 Ga0105239_10231997 3300010375 Bacteria 2071
83 Ga0157373_10201461 3300013100 Bacteria 1403
84 Ga0157370_10071688 3300013104 Bacteria 3269
85 Ga0157370_10205102 3300013104 Bacteria 1828
86 Ga0157370_10230021 3300013104 Bacteria 1716
87 Ga0157369_10001929 3300013105 Bacteria 25003
88 Ga0157369_10151904 3300013105 Bacteria 2447
89 Ga0157374_10041422 3300013296 Bacteria 4244
90 Ga0163162_10452175 3300013306 Unclassified 1416
91 Ga0163162_10569360 3300013306 Bacteria 1260
92 Ga0157372_10201323 3300013307 Bacteria 2306
93 Ga0157375_10310967 3300013308 Bacteria 1740
94 Ga0157380_10155504 3300014326 Bacteria 1981
95 Ga0157380_10343007 3300014326 Bacteria 1394
96 Ga0157379_10077916 3300014968 Unclassified 2968
97 Ga0157379_10283045 3300014968 Bacteria 1509
98 Ga0206353_10599544 3300020082 Bacteria 4621
99 Ga0207656_10055297 3300025321 Bacteria 1727
100 Ga0207705_10038036 3300025909 Bacteria 3444
101 Ga0207684_10001826 3300025910 Bacteria 22233
102 Ga0207684_10150632 3300025910 Bacteria 2001
103 Ga0207707_10015611 3300025912 Bacteria 6615
104 Ga0207695_10219286 3300025913 Bacteria 1810
105 Ga0207660_10150986 3300025917 Bacteria 1785
106 Ga0207660_10245067 3300025917 Bacteria 1413
107 Ga0207652_10076785 3300025921 Bacteria 2914
108 Ga0207646_10017076 3300025922 Bacteria 6799
109 Ga0207646_10126821 3300025922 Bacteria 2295
110 Ga0207681_10020183 3300025923 Bacteria 4219
111 Ga0207681_10107643 3300025923 Bacteria 2022
112 Ga0207650_10003916 3300025925 Bacteria 10181
113 Ga0207687_10001486 3300025927 Bacteria 16059
114 Ga0207644_10003425 3300025931 Bacteria 10245
115 Ga0207706_10012758 3300025933 Bacteria 7648
116 Ga0207706_10259059 3300025933 Bacteria 1519
117 Ga0207670_10015015 3300025936 Bacteria 4616
118 Ga0207669_10001755 3300025937 Bacteria 9207
119 Ga0207669_10054012 3300025937 Bacteria 2424
120 Ga0207691_10005053 3300025940 Bacteria 12728
121 Ga0207711_10163813 3300025941 Bacteria 2014
122 Ga0207689_10050101 3300025942 Bacteria 3444
123 Ga0207661_10003982 3300025944 Bacteria 10323
124 Ga0207679_10005437 3300025945 Bacteria 7980
125 Ga0207651_10002439 3300025960 Bacteria 8897
126 Ga0207712_10496397 3300025961 Bacteria 1043
127 Ga0207658_10062243 3300025986 Bacteria 2792
128 Ga0207703_10128111 3300026035 Bacteria 2188
129 Ga0207639_10027351 3300026041 Bacteria 4155
130 Ga0207678_10379073 3300026067 Bacteria 1222
131 Ga0207708_10241226 3300026075 Bacteria 1454
132 Ga0207702_10559009 3300026078 Bacteria 1120
133 Ga0207641_10053005 3300026088 Bacteria 3437
134 Ga0207641_10182182 3300026088 Bacteria 1925
135 Ga0207676_10123842 3300026095 Bacteria 2185
136 Ga0207674_10016317 3300026116 Bacteria 8135
137 Ga0207674_10198026 3300026116 Bacteria 1958
138 Ga0207675_100009217 3300026118 Bacteria 9256
139 Ga0207675_100038698 3300026118 Bacteria 4450
140 Ga0207683_10053607 3300026121 Bacteria 3537
141 Ga0207683_10058926 3300026121 Bacteria 3372
142 Ga0207683_10089594 3300026121 Bacteria 2738
143 Ga0207428_10013152 3300027907 Bacteria 7245
144 Ga0207428_10020501 3300027907 Bacteria 5615
145 Ga0268266_10105573 3300028379 Bacteria 2489
146 Ga0268265_10017744 3300028380 Bacteria 4920
147 Ga0268265_10326261 3300028380 Bacteria 1392
148 Ga0268265_10402489 3300028380 Bacteria 1266
149 Ga0307515_10003942 3300028794 Bacteria 30969
150 Ga0307515_10020456 3300028794 Bacteria 11805
151 Ga0265338_10005340 3300028800 Bacteria 16808
152 Ga0265338_10053379 3300028800 Bacteria 3616
153 Ga0307511_10000269 3300030521 Bacteria 54080
154 Ga0307512_10000737 3300030522 Bacteria 48583
155 Ga0265327_10057101 3300031251 Bacteria 2009
156 Ga0307509_10179450 3300031507 Bacteria 1985
157 Ga0307508_10001670 3300031616 Bacteria 24662
158 Ga0307508_10005504 3300031616 Bacteria 12036
159 Ga0316576_10126467 3300031727 Bacteria 1921
160 Ga0316593_10032807 3300032168 Bacteria 1698
161 Ga0373949_0000001 3300035090 Bacteria 103947
162 Ga0373960_0033588 3300035121 Bacteria 1447
163 Ga0395899_0017986 3300037312 Bacteria 5378
164 Ga0395900_0058009 3300037418 Unclassified 3985
165 Ga0395898_0004914 3300037466 Bacteria 14512
166 Ga0395905_0004287 3300037471 Bacteria 14873
167 Ga0436364_0799577 3300037853 Bacteria 1149
168 Ga0400485_19459 3300038735 Bacteria 3934
169 Ga0400485_21906 3300038735 Bacteria 6792
170 Ga0400486_09530 3300038742 Bacteria 13718
171 Ga0400486_24213 3300038742 Bacteria 3956
172 Ga0400486_28350 3300038742 Bacteria 17710
173 Ga0400489_32649 3300039093 Bacteria 22688
174 Ga0400487_40977 3300039110 Bacteria 3948
175 Ga0400487_43016 3300039110 Bacteria 20766
176 Ga0400487_45202 3300039110 Unclassified 2692
177 Ga0436363_0420444 3300039450 Bacteria 1788
178 Ga0466961_0013795 3300044693 Bacteria 5178
179 Ga0466971_0011067 3300044719 Bacteria 3950
180 Ga0466971_0051732 3300044719 Bacteria 1849
181 Ga0466957_0003646 3300044842 Bacteria 8495
182 Ga0451576_0002277 3300045051 Bacteria 29297
183 Ga0466967_0072194 3300045976 Bacteria 3093
184 Ga0466967_0257081 3300045976 Bacteria 1670
185 Ga0495592_0211179 3300046454 Bacteria 1303
186 Ga0495629_0026506 3300046459 Bacteria 4117
187 Ga0495638_0000282 3300046460 Bacteria 68051
188 Ga0495610_0021832 3300046512 Bacteria 3513
189 Ga0495632_0028891 3300046519 Bacteria 2892
190 Ga0495654_0000214 3300046530 Bacteria 54530
191 Ga0495625_0021927 3300046660 Bacteria 4906
192 Ga0495669_0012431 3300046684 Bacteria 3624
193 Ga0495676_0011510 3300047321 Bacteria 7979
194 Ga0496106_0182998 3300048909 Bacteria 1664
195 Ga0496107_0101092 3300048910 Bacteria 2114
196 Ga0496109_0021524 3300048912 Bacteria 5703
197 Ga0496110_0011828 3300048913 Bacteria 7165
198 Ga0496111_0006336 3300048914 Bacteria 7673
199 Ga0496112_0650586 3300048915 Bacteria 984
200 Ga0496114_0147930 3300048917 Bacteria 2037
201 Ga0496114_0153082 3300048917 Bacteria 2001
202 Ga0496119_0002226 3300048922 Bacteria 21613
203 Ga0496120_0000332 3300048923 Bacteria 78876
204 Ga0496122_0012889 3300048925 Bacteria 8257
205 Ga0496123_0104453 3300048926 Bacteria 1638
206 Ga0496124_0000656 3300048927 Bacteria 57087
207 Ga0496125_0099362 3300048928 Bacteria 2150
208 Ga0501034_0002404 3300049571 Bacteria 22667
209 Ga0501034_0009009 3300049571 Bacteria 10482
210 Ga0501036_0032553 3300049572 Bacteria 4406
211 Ga0501037_0032528 3300049573 Bacteria 3852
212 Ga0501038_0058080 3300049574 Bacteria 3319
213 Ga0501039_0016104 3300049575 Bacteria 5726
214 Ga0501039_0025832 3300049575 Bacteria 4515
215 Ga0501040_0016339 3300049576 Bacteria 4911
216 Ga0501042_0039959 3300049578 Bacteria 3335
217 Ga0501046_0049290 3300049580 Bacteria 3331
218 Ga0501070_0044198 3300049586 Bacteria 3707
219 Ga0501071_0077176 3300049587 Bacteria 2433
220 Ga0501071_0171890 3300049587 Bacteria 1622
221 Ga0501073_0051124 3300049589 Bacteria 2895
222 Ga0501074_0057884 3300049590 Bacteria 2792
223 Ga0501075_0008463 3300049591 Bacteria 7176
224 Ga0501075_0074595 3300049591 Bacteria 2566
225 Ga0501076_0104420 3300049592 Bacteria 2286
226 Ga0501079_0031588 3300049741 Bacteria 4070
227 Ga0501080_0001405 3300049742 Bacteria 20173
228 Ga0501080_0087404 3300049742 Bacteria 2896
229 Ga0501081_0008864 3300049743 Bacteria 6539
230 Ga0501081_0069466 3300049743 Bacteria 2454
231 Ga0501083_0032778 3300049744 Bacteria 3561
232 nmdc:mga0k408_48163_c1 3300050493 Bacteria 2465
233 nmdc:mga06z11_28375_c1 3300050494 Bacteria 2685
234 nmdc:mga04h51_9820_c1 3300050495 Bacteria 2609
235 nmdc:mga05p37_25650_c1 3300050507 Bacteria 7170
236 nmdc:mga05p37_44635_c1 3300050507 Bacteria 5453
237 nmdc:mga05p37_719_c1 3300050507 Bacteria 36641
238 nmdc:mga09592_236121_c1 3300050508 Bacteria 1584
239 nmdc:mga09592_6577_c1 3300050508 Bacteria 9464
240 nmdc:mga0qj67_102280_c1 3300050509 Bacteria 1597
241 nmdc:mga06r32_63571_c1 3300050510 Bacteria 3558
242 nmdc:mga06r32_773_c1 3300050510 Bacteria 28238
243 nmdc:mga08y16_1028_c1 3300050511 Bacteria 27344
244 nmdc:mga08y16_3215_c1 3300050511 Bacteria 16905
245 nmdc:mga0n895_464034_c1 3300050512 Bacteria 1278
246 nmdc:mga0n895_8458_c1 3300050512 Bacteria 8910
247 nmdc:mga08x19_257431_c1 3300050514 Bacteria 1206
248 nmdc:mga08x19_5582_c1 3300050514 Bacteria 7435
249 nmdc:mga0a205_265375_c1 3300050515 Bacteria 1594
250 Ga0500646_0000478 3300053090 Bacteria 11767
251 Ga0500583_0001347 3300053092 Bacteria 7022
252 Ga0500583_0003496 3300053092 Bacteria 4948
253 Ga0500583_0020495 3300053092 Bacteria 2730
254 Ga0500641_0016831 3300053096 Bacteria 2726
255 Ga0500641_0021635 3300053096 Bacteria 2455
256 Ga0500650_0059674 3300053098 Bacteria 1780
257 Ga0500594_0017312 3300053118 Bacteria 1763
258 Ga0500597_076487 3300053120 Bacteria 1450
259 Ga0500614_006652 3300053123 Bacteria 2430
260 Ga0500617_097441 3300053124 Bacteria 1248
261 Ga0500652_009314 3300053131 Bacteria 3317
262 Ga0500658_0095548 3300053134 Bacteria 1291
263 Ga0500568_0035483 3300053139 Bacteria 2035
264 Ga0500588_0003006 3300053146 Bacteria 3514
265 Ga0500590_000970 3300053148 Bacteria 11078
266 Ga0500604_0007652 3300053151 Bacteria 2863
267 Ga0501082_0033904 3300060353 Bacteria 4403
268 2585325138 2582581315 Bacteria 7318924
269 2739229300 2738543009 Bacteria 4944499
270 2919708770 2919704043 Bacteria 5560311
271 Ga0400485_05772
272 Ga0065715_10111179
273 Ga0065707_10135048
274 Ga0070658_10010416
275 Ga0070683_100431960
276 Ga0070670_100003815
277 Ga0070670_100346617
278 Ga0068869_100004168
279 Ga0070689_100026424
280 Ga0070669_100100425
281 Ga0070675_100005632
282 Ga0070671_100001033
283 Ga0070671_100380510
284 Ga0070674_100274377
285 Ga0070673_100003767
286 Ga0070688_100236220
287 Ga0070667_100019204
288 Ga0070705_100188971
289 Ga0070678_100034192
290 Ga0070678_100079524
291 Ga0070662_100017783
292 Ga0070662_100264875
293 Ga0070681_10061246
294 Ga0068867_100449545
295 Ga0070707_100024842
296 Ga0070707_100027860
297 Ga0070707_100079762
298 Ga0070698_100032847
299 Ga0070698_100169407
300 Ga0070699_100007210
301 Ga0070699_100356957
302 Ga0070679_100316695
303 Ga0070684_100024021
304 Ga0070697_100023458
305 Ga0068853_100017213
306 Ga0070672_100003282
307 Ga0070664_100006945
308 Ga0068857_100028631
309 Ga0068856_100026676
310 Ga0068856_100605930
311 Ga0070702_100070004
312 Ga0068852_100036283
313 Ga0068859_100363141
314 Ga0068861_100043852
315 Ga0068851_10061758
316 Ga0068863_100050142
317 Ga0068863_100264855
318 Ga0068862_100170954
319 Ga0068862_100303719
320 Ga0068862_100421472
321 Ga0081455_10000859
322 Ga0081455_10071596
323 Ga0081539_10000123
324 Ga0075369_10053229
325 Ga0075366_10043567
326 Ga0075428_100000810
327 Ga0075428_100016582
328 Ga0075428_100400996
329 Ga0075431_100001541
330 Ga0075431_100085312
331 Ga0075429_100009532
332 Ga0075429_100134726
333 Ga0068865_100171372
334 Ga0075436_100001352
335 Ga0097620_100363140
336 Ga0105240_10366369
337 Ga0105240_10394440
338 Ga0111539_10000575
339 Ga0111539_10001545
340 Ga0111539_10033114
341 Ga0105245_10000176
342 Ga0114129_10003641
343 Ga0114129_10056221
344 Ga0114129_10256934
345 Ga0114129_10820333
346 Ga0105243_10188442
347 Ga0105248_10014771
348 Ga0105238_10050514
349 Ga0105238_10112718
350 Ga0105249_10307574
351 Ga0105249_10416520
352 Ga0105239_10231997
353 Ga0157373_10201461
354 Ga0157370_10071688
355 Ga0157370_10205102
356 Ga0157370_10230021
357 Ga0157369_10001929
358 Ga0157369_10151904
359 Ga0157374_10041422
360 Ga0163162_10452175
361 Ga0163162_10569360
362 Ga0157372_10201323
363 Ga0157375_10310967
364 Ga0157380_10155504
365 Ga0157380_10343007
366 Ga0157379_10077916
367 Ga0157379_10283045
368 Ga0206353_10599544
369 Ga0207656_10055297
370 Ga0207705_10038036
371 Ga0207684_10001826
372 Ga0207684_10150632
373 Ga0207707_10015611
374 Ga0207695_10219286
375 Ga0207660_10150986
376 Ga0207660_10245067
377 Ga0207652_10076785
378 Ga0207646_10017076
379 Ga0207646_10126821
380 Ga0207681_10020183
381 Ga0207681_10107643
382 Ga0207650_10003916
383 Ga0207687_10001486
384 Ga0207644_10003425
385 Ga0207706_10012758
386 Ga0207706_10259059
387 Ga0207670_10015015
388 Ga0207669_10001755
389 Ga0207669_10054012
390 Ga0207691_10005053
391 Ga0207711_10163813
392 Ga0207689_10050101
393 Ga0207661_10003982
394 Ga0207679_10005437
395 Ga0207651_10002439
396 Ga0207712_10496397
397 Ga0207658_10062243
398 Ga0207703_10128111
399 Ga0207639_10027351
400 Ga0207678_10379073
401 Ga0207708_10241226
402 Ga0207702_10559009
403 Ga0207641_10053005
404 Ga0207641_10182182
405 Ga0207676_10123842
406 Ga0207674_10016317
407 Ga0207674_10198026
408 Ga0207675_100009217
409 Ga0207675_100038698
410 Ga0207683_10053607
411 Ga0207683_10058926
412 Ga0207683_10089594
413 Ga0207428_10013152
414 Ga0207428_10020501
415 Ga0268266_10105573
416 Ga0268265_10017744
417 Ga0268265_10326261
418 Ga0268265_10402489
419 Ga0307515_10003942
420 Ga0307515_10020456
421 Ga0265338_10005340
422 Ga0265338_10053379
423 Ga0307511_10000269
424 Ga0307512_10000737
425 Ga0265327_10057101
426 Ga0307509_10179450
427 Ga0307508_10001670
428 Ga0307508_10005504
429 Ga0316576_10126467
430 Ga0316593_10032807
431 Ga0373949_0000001
432 Ga0373960_0033588
433 Ga0395899_0017986
434 Ga0395900_0058009
435 Ga0395898_0004914
436 Ga0395905_0004287
437 Ga0436364_0799577
438 Ga0400485_19459
439 Ga0400485_21906
440 Ga0400486_09530
441 Ga0400486_24213
442 Ga0400486_28350
443 Ga0400489_32649
444 Ga0400487_40977
445 Ga0400487_43016
446 Ga0400487_45202
447 Ga0436363_0420444
448 Ga0466961_0013795
449 Ga0466971_0011067
450 Ga0466971_0051732
451 Ga0466957_0003646
452 Ga0451576_0002277
453 Ga0466967_0072194
454 Ga0466967_0257081
455 Ga0495592_0211179
456 Ga0495629_0026506
457 Ga0495638_0000282
458 Ga0495610_0021832
459 Ga0495632_0028891
460 Ga0495654_0000214
461 Ga0495625_0021927
462 Ga0495669_0012431
463 Ga0495676_0011510
464 Ga0496106_0182998
465 Ga0496107_0101092
466 Ga0496109_0021524
467 Ga0496110_0011828
468 Ga0496111_0006336
469 Ga0496112_0650586
470 Ga0496114_0147930
471 Ga0496114_0153082
472 Ga0496119_0002226
473 Ga0496120_0000332
474 Ga0496122_0012889
475 Ga0496123_0104453
476 Ga0496124_0000656
477 Ga0496125_0099362
478 Ga0501034_0002404
479 Ga0501034_0009009
480 Ga0501036_0032553
481 Ga0501037_0032528
482 Ga0501038_0058080
483 Ga0501039_0016104
484 Ga0501039_0025832
485 Ga0501040_0016339
486 Ga0501042_0039959
487 Ga0501046_0049290
488 Ga0501070_0044198
489 Ga0501071_0077176
490 Ga0501071_0171890
491 Ga0501073_0051124
492 Ga0501074_0057884
493 Ga0501075_0008463
494 Ga0501075_0074595
495 Ga0501076_0104420
496 Ga0501079_0031588
497 Ga0501080_0001405
498 Ga0501080_0087404
499 Ga0501081_0008864
500 Ga0501081_0069466
501 Ga0501083_0032778
502 nmdc:mga0k408_48163_c1
503 nmdc:mga06z11_28375_c1
504 nmdc:mga04h51_9820_c1
505 nmdc:mga05p37_25650_c1
506 nmdc:mga05p37_44635_c1
507 nmdc:mga05p37_719_c1
508 nmdc:mga09592_236121_c1
509 nmdc:mga09592_6577_c1
510 nmdc:mga0qj67_102280_c1
511 nmdc:mga06r32_63571_c1
512 nmdc:mga06r32_773_c1
513 nmdc:mga08y16_1028_c1
514 nmdc:mga08y16_3215_c1
515 nmdc:mga0n895_464034_c1
516 nmdc:mga0n895_8458_c1
517 nmdc:mga08x19_257431_c1
518 nmdc:mga08x19_5582_c1
519 nmdc:mga0a205_265375_c1
520 Ga0500646_0000478
521 Ga0500583_0001347
522 Ga0500583_0003496
523 Ga0500583_0020495
524 Ga0500641_0016831
525 Ga0500641_0021635
526 Ga0500650_0059674
527 Ga0500594_0017312
528 Ga0500597_076487
529 Ga0500614_006652
530 Ga0500617_097441
531 Ga0500652_009314
532 Ga0500658_0095548
533 Ga0500568_0035483
534 Ga0500588_0003006
535 Ga0500590_000970
536 Ga0500604_0007652
537 Ga0501082_0033904
538 2585325138
539 2739229300
540 2919708770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

54

347

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9355 2 310
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9239 1 312
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9123 2 308
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9098 4 308
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9081 1 312
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.969 2 321 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9581 2 215 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9541 5 329 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9501 74 327 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9497 3 253 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9918 123 206 GO:0004033
GO:0005737
AF-A0A7Y5WXJ2-F1-model_v4 Aldo/keto reductase 0.9913 63 329 GO:0004033
GO:0005737
AF-A0A1G9MJ32-F1-model_v4 Predicted oxidoreductase 0.9884 2 328 GO:0004033
GO:0005737
AF-A0A4Q6A8B0-F1-model_v4 deleted 0.9883 3 177
AF-A0A3M6GJV6-F1-model_v4 Aldo/keto reductase family oxidoreductase 0.9868 3 260 GO:0004033
GO:0005737

Map