F377066

General Info

Members Datasets Scaffolds Average Seq Length
270 185 540 255

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0072090|Ga0373944_0072090_95_1021
Length 288
Sequence MEAIFRVDGANVVTSPHAAGPWDPNMQHGGAPASLVVWAAERIPTPAPMQVARVTIDLMRPVPVATLKLETEVLREGRKIQLCAVRLLADGKLTVGATVLKIRRQAQSLPDDIVEPPLDXXXXEQSRVEPQNSPFGSGVTIRAARGRFGGPGPGAIWYRADRPLIEGSPISAAMRVAAASDFCNASSALDWQKWTFLNADLTVSMAREPVGEWILLDAVSWIGPDGAGLATARLAISAAARRASSSRSGKPRFGLWASWSPAGCATSSRSRRMSALVHERTSPCPARS

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 1.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 2.96
Rhizosphere 87.78
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0072090 3300035089 Bacteria 1127
2 JGI25406J46586_10003982 3300003203 Bacteria 6910
3 rootH2_10060731 3300003320 Bacteria 1318
4 JGI25404J52841_10003070 3300003659 Bacteria 3258
5 Ga0070660_100488119 3300005339 Bacteria 1024
6 Ga0070661_100000041 3300005344 Bacteria 99916
7 Ga0070661_100021916 3300005344 Bacteria 4569
8 Ga0070673_100262202 3300005364 Bacteria 1510
9 Ga0070709_10022816 3300005434 Bacteria 3667
10 Ga0070713_100011912 3300005436 Bacteria 6358
11 Ga0070713_100155660 3300005436 Bacteria 2037
12 Ga0070710_10028163 3300005437 Bacteria 3003
13 Ga0070711_100004209 3300005439 Bacteria 8457
14 Ga0070663_100151921 3300005455 Bacteria 1776
15 Ga0070681_10021797 3300005458 Bacteria 6424
16 Ga0070681_10169988 3300005458 Bacteria 2102
17 Ga0070681_10460555 3300005458 Bacteria 1184
18 Ga0070681_10728617 3300005458 Bacteria 908
19 Ga0070679_100022668 3300005530 Bacteria 6140
20 Ga0070684_100010401 3300005535 Bacteria 7370
21 Ga0068853_100229654 3300005539 Bacteria 1697
22 Ga0068855_100027429 3300005563 Bacteria 6813
23 Ga0068855_100325134 3300005563 Bacteria 1699
24 Ga0068857_100219365 3300005577 Bacteria 1737
25 Ga0068856_100141308 3300005614 Bacteria 2415
26 Ga0068852_100667415 3300005616 Bacteria 1048
27 Ga0068858_100272414 3300005842 Bacteria 1611
28 Ga0068860_100178582 3300005843 Bacteria 2052
29 Ga0068862_100485238 3300005844 Bacteria 1170
30 Ga0081455_10003989 3300005937 Bacteria 16757
31 Ga0081455_10014097 3300005937 Bacteria 7857
32 Ga0081540_1003183 3300005983 Bacteria 13074
33 Ga0081540_1013139 3300005983 Bacteria 5404
34 Ga0081539_10000729 3300005985 Bacteria 65907
35 Ga0070717_10499732 3300006028 Bacteria 1099
36 Ga0070712_100058833 3300006175 Bacteria 2704
37 Ga0105240_10019547 3300009093 Bacteria 9048
38 Ga0105237_10173992 3300009545 Bacteria 2153
39 Ga0105238_10058549 3300009551 Bacteria 3861
40 Ga0105238_10159049 3300009551 Bacteria 2235
41 Ga0105238_10177148 3300009551 Bacteria 2109
42 Ga0105239_10013196 3300010375 Bacteria 9181
43 Ga0105239_10058477 3300010375 Bacteria 4231
44 Ga0105239_10185682 3300010375 Bacteria 2327
45 Ga0157371_10094812 3300013102 Bacteria 2115
46 Ga0157369_10009045 3300013105 Bacteria 11403
47 Ga0157372_10033962 3300013307 Bacteria 5606
48 Ga0157375_11032548 3300013308 Bacteria 960
49 Ga0206356_10133052 3300020070 Bacteria 1484
50 Ga0206354_10800226 3300020081 Bacteria 1038
51 Ga0206354_11586518 3300020081 Bacteria 1223
52 Ga0213876_10152368 3300021384 Bacteria 1229
53 Ga0213876_10200320 3300021384 Bacteria 1061
54 Ga0209455_1012832 3300025272 Bacteria 1980
55 Ga0207692_10020162 3300025898 Bacteria 3027
56 Ga0207699_10023245 3300025906 Bacteria 3371
57 Ga0207654_10180337 3300025911 Bacteria 1377
58 Ga0207707_10027062 3300025912 Bacteria 5013
59 Ga0207707_10028503 3300025912 Bacteria 4880
60 Ga0207707_10149229 3300025912 Bacteria 2044
61 Ga0207707_10346683 3300025912 Bacteria 1280
62 Ga0207695_10124715 3300025913 Bacteria 2539
63 Ga0207695_10354843 3300025913 Bacteria 1353
64 Ga0207671_10267207 3300025914 Bacteria 1347
65 Ga0207693_10059784 3300025915 Bacteria 2985
66 Ga0207660_10034283 3300025917 Bacteria 3517
67 Ga0207649_10000053 3300025920 Bacteria 104949
68 Ga0207649_10015365 3300025920 Bacteria 4301
69 Ga0207652_10007270 3300025921 Bacteria 8921
70 Ga0207652_10064498 3300025921 Bacteria 3169
71 Ga0207652_10118960 3300025921 Bacteria 2349
72 Ga0207694_10182909 3300025924 Bacteria 1700
73 Ga0207700_10042054 3300025928 Bacteria 3348
74 Ga0207700_10098163 3300025928 Bacteria 2329
75 Ga0207700_10511556 3300025928 Bacteria 1063
76 Ga0207665_10376481 3300025939 Bacteria 1077
77 Ga0207661_10026644 3300025944 Bacteria 4407
78 Ga0207661_10414081 3300025944 Bacteria 1223
79 Ga0207667_10173737 3300025949 Bacteria 2214
80 Ga0207651_10156926 3300025960 Bacteria 1779
81 Ga0207639_10637731 3300026041 Bacteria 985
82 Ga0207702_10492494 3300026078 Bacteria 1194
83 Ga0265337_1016155 3300028556 Bacteria 2421
84 Ga0265319_1018182 3300028563 Bacteria 2655
85 Ga0265334_10006810 3300028573 Bacteria 4906
86 Ga0265323_10000443 3300028653 Bacteria 23769
87 Ga0265322_10051096 3300028654 Bacteria 1173
88 Ga0265336_10000637 3300028666 Bacteria 19239
89 Ga0265338_10000076 3300028800 Bacteria 180204
90 Ga0265338_10207106 3300028800 Bacteria 1475
91 Ga0265324_10011765 3300029957 Bacteria 3324
92 Ga0265330_10046424 3300031235 Bacteria 1914
93 Ga0265330_10052463 3300031235 Bacteria 1786
94 Ga0265332_10053762 3300031238 Bacteria 1728
95 Ga0265332_10069949 3300031238 Bacteria 1495
96 Ga0265328_10040815 3300031239 Bacteria 1709
97 Ga0265340_10001129 3300031247 Bacteria 15258
98 Ga0265340_10048721 3300031247 Bacteria 2059
99 Ga0265339_10003766 3300031249 Bacteria 10572
100 Ga0265331_10001602 3300031250 Bacteria 16530
101 Ga0265327_10000869 3300031251 Bacteria 44810
102 Ga0307513_10054040 3300031456 Bacteria 4310
103 Ga0307508_10000120 3300031616 Bacteria 93316
104 Ga0307508_10441395 3300031616 Bacteria 894
105 Ga0265314_10028496 3300031711 Bacteria 4163
106 Ga0373934_0039741 3300035086 Bacteria 1855
107 Ga0373934_0069162 3300035086 Bacteria 1411
108 Ga0373934_0128466 3300035086 Bacteria 1033
109 Ga0373923_0093947 3300035111 Bacteria 1315
110 Ga0373936_0086808 3300035113 Bacteria 1308
111 Ga0373954_0000198 3300035118 Bacteria 21926
112 Ga0373956_0076171 3300035119 Bacteria 1535
113 Ga0373955_0049465 3300035172 Bacteria 2282
114 Ga0373942_0044154 3300035207 Bacteria 1227
115 Ga0373931_0055489 3300035691 Bacteria 2120
116 Ga0373933_0160481 3300035724 Bacteria 1427
117 Ga0373937_0068708 3300036401 Bacteria 3266
118 Ga0373937_0574313 3300036401 Bacteria 1071
119 Ga0372808_000618 3300036459 Bacteria 3010
120 Ga0373925_0190422 3300037068 Bacteria 1627
121 Ga0436364_1214833 3300037853 Bacteria 1028
122 Ga0395901_0079201 3300038443 Bacteria 3431
123 Ga0436365_0871655 3300039437 Bacteria 2054
124 Ga0436365_1658112 3300039437 Bacteria 10434
125 Ga0436360_0437323 3300039438 Bacteria 1492
126 Ga0436360_0878492 3300039438 Bacteria 1429
127 Ga0436363_0120934 3300039450 Bacteria 927
128 Ga0436362_0419687 3300039453 Bacteria 1215
129 Ga0466966_0273658 3300044684 Bacteria 1016
130 Ga0466964_0030806 3300044706 Bacteria 2125
131 Ga0466971_0074442 3300044719 Bacteria 1544
132 Ga0466967_0013329 3300045976 Bacteria 6346
133 Ga0466967_0033179 3300045976 Bacteria 4368
134 Ga0495592_0023186 3300046454 Bacteria 4721
135 Ga0495592_0057197 3300046454 Bacteria 2879
136 Ga0495603_0100733 3300046455 Bacteria 1686
137 Ga0495629_0001168 3300046459 Bacteria 20735
138 Ga0495638_0050792 3300046460 Bacteria 2589
139 Ga0495653_0020331 3300046463 Bacteria 5383
140 Ga0495639_0004916 3300046475 Bacteria 5731
141 Ga0495662_0170072 3300046476 Bacteria 1074
142 Ga0495664_0001239 3300046477 Bacteria 13359
143 Ga0495664_0021902 3300046477 Bacteria 3695
144 Ga0495594_0021462 3300046499 Bacteria 3447
145 Ga0495594_0164687 3300046499 Bacteria 1261
146 Ga0495608_0139250 3300046511 Bacteria 1549
147 Ga0495618_0013026 3300046514 Bacteria 5055
148 Ga0495618_0034523 3300046514 Bacteria 3172
149 Ga0495628_0027513 3300046516 Bacteria 4626
150 Ga0495628_0298720 3300046516 Bacteria 1192
151 Ga0495630_0013190 3300046517 Bacteria 6008
152 Ga0495652_0037506 3300046529 Bacteria 4204
153 Ga0495665_0013058 3300046531 Bacteria 4497
154 Ga0495640_0075029 3300046533 Bacteria 2259
155 Ga0495587_0100726 3300046536 Bacteria 1665
156 Ga0495645_0042485 3300046543 Bacteria 3314
157 Ga0495667_0005050 3300046559 Bacteria 8922
158 Ga0495634_0221793 3300046642 Bacteria 1167
159 Ga0495635_0002264 3300046663 Bacteria 13077
160 Ga0495635_0032967 3300046663 Bacteria 3593
161 Ga0495657_0006044 3300046675 Bacteria 9507
162 Ga0495599_0030293 3300046678 Bacteria 3394
163 Ga0495623_0020691 3300046679 Bacteria 4252
164 Ga0495623_0271057 3300046679 Bacteria 948
165 Ga0495646_0013045 3300046680 Bacteria 5282
166 Ga0495624_0036377 3300046690 Bacteria 3174
167 Ga0495600_0023777 3300046809 Bacteria 3942
168 Ga0495581_0030622 3300047315 Bacteria 3117
169 Ga0495581_0157879 3300047315 Bacteria 1326
170 Ga0495604_0201459 3300047317 Bacteria 1380
171 Ga0495674_0028614 3300047319 Bacteria 5079
172 Ga0495674_0044528 3300047319 Bacteria 3945
173 Ga0495672_0026369 3300047320 Bacteria 3709
174 Ga0495676_0052392 3300047321 Bacteria 3258
175 Ga0495680_0007956 3300047322 Bacteria 9669
176 Ga0495675_0018232 3300047444 Bacteria 4454
177 Ga0495684_0000988 3300047471 Bacteria 23121
178 Ga0495684_0008718 3300047471 Bacteria 7840
179 Ga0495593_0003204 3300047673 Bacteria 9817
180 Ga0495593_0022173 3300047673 Bacteria 3543
181 Ga0495602_0397472 3300048088 Bacteria 983
182 Ga0496105_0053947 3300048908 Bacteria 3320
183 Ga0496109_0463760 3300048912 Bacteria 1196
184 Ga0496110_0082075 3300048913 Bacteria 2874
185 Ga0496111_0030057 3300048914 Bacteria 3862
186 Ga0496112_0030330 3300048915 Bacteria 5232
187 Ga0496112_0395004 3300048915 Bacteria 1323
188 Ga0496113_0084627 3300048916 Bacteria 2435
189 Ga0496115_0113890 3300048918 Bacteria 2223
190 Ga0496117_0043638 3300048920 Bacteria 3258
191 Ga0496118_0080699 3300048921 Bacteria 2288
192 Ga0496121_0033382 3300048924 Bacteria 4657
193 Ga0496121_0079375 3300048924 Bacteria 2606
194 Ga0496121_0188874 3300048924 Bacteria 1479
195 Ga0496124_0026682 3300048927 Bacteria 5205
196 Ga0496125_0077465 3300048928 Bacteria 2563
197 Ga0496126_0065244 3300048929 Bacteria 3259
198 Ga0496126_0083860 3300048929 Bacteria 2812
199 Ga0496126_0109561 3300048929 Bacteria 2407
200 Ga0501031_0000476 3300049568 Bacteria 23367
201 Ga0501031_0221067 3300049568 Bacteria 1233
202 Ga0501032_0003481 3300049569 Bacteria 12045
203 Ga0501032_0064945 3300049569 Bacteria 2442
204 Ga0501033_0000513 3300049570 Bacteria 36373
205 Ga0501033_0005866 3300049570 Bacteria 9654
206 Ga0501033_0121631 3300049570 Bacteria 1894
207 Ga0501034_0000181 3300049571 Bacteria 117767
208 Ga0501034_0136021 3300049571 Bacteria 2438
209 Ga0501034_0180335 3300049571 Bacteria 2077
210 Ga0501034_0233319 3300049571 Bacteria 1788
211 Ga0501036_0000671 3300049572 Bacteria 25134
212 Ga0501036_0026343 3300049572 Bacteria 4907
213 Ga0501037_0000059 3300049573 Bacteria 101459
214 Ga0501037_0125940 3300049573 Bacteria 1839
215 Ga0501037_0145200 3300049573 Bacteria 1697
216 Ga0501038_0000143 3300049574 Bacteria 61292
217 Ga0501038_0020121 3300049574 Bacteria 6005
218 Ga0501039_0000069 3300049575 Bacteria 78211
219 Ga0501042_0011121 3300049578 Bacteria 6064
220 Ga0501043_0000661 3300049579 Bacteria 30410
221 Ga0501043_0140510 3300049579 Bacteria 1891
222 Ga0501043_0288845 3300049579 Bacteria 1256
223 Ga0501046_0000563 3300049580 Bacteria 36758
224 Ga0501046_0023257 3300049580 Bacteria 5099
225 Ga0501046_0145079 3300049580 Bacteria 1793
226 Ga0501047_0000149 3300049581 Bacteria 85138
227 Ga0501047_0021310 3300049581 Bacteria 6221
228 Ga0501047_0038932 3300049581 Bacteria 4599
229 Ga0501047_0115584 3300049581 Bacteria 2565
230 Ga0501048_0000128 3300049582 Bacteria 44557
231 Ga0501067_0002538 3300049583 Bacteria 10079
232 Ga0501068_0002459 3300049584 Bacteria 9833
233 Ga0501069_0005554 3300049585 Bacteria 6566
234 Ga0501070_0009580 3300049586 Bacteria 8180
235 Ga0501070_0016980 3300049586 Bacteria 6106
236 Ga0501070_0081283 3300049586 Bacteria 2680
237 Ga0501070_0160421 3300049586 Bacteria 1854
238 Ga0501070_0207691 3300049586 Bacteria 1608
239 Ga0501071_0428907 3300049587 Bacteria 1011
240 Ga0501072_0001770 3300049588 Bacteria 16063
241 Ga0501073_0000094 3300049589 Bacteria 56659
242 Ga0501073_0021177 3300049589 Bacteria 4689
243 Ga0501074_0000245 3300049590 Bacteria 30598
244 Ga0501074_0065419 3300049590 Bacteria 2617
245 Ga0501076_0251548 3300049592 Bacteria 1446
246 Ga0501079_0252500 3300049741 Bacteria 1378
247 Ga0501079_0576100 3300049741 Unclassified 885
248 Ga0501080_0000486 3300049742 Bacteria 30950
249 Ga0501080_0052855 3300049742 Bacteria 3781
250 Ga0501080_0140593 3300049742 Bacteria 2232
251 Ga0501080_0336009 3300049742 Bacteria 1366
252 Ga0501083_0001736 3300049744 Bacteria 14857
253 Ga0501035_0000942 3300049822 Bacteria 30724
254 Ga0501035_0040522 3300049822 Bacteria 4208
255 Ga0501035_0264695 3300049822 Bacteria 1456
256 Ga0501035_0432667 3300049822 Bacteria 1091
257 Ga0501044_0000443 3300049823 Bacteria 50672
258 Ga0501044_0027531 3300049823 Bacteria 6006
259 Ga0501044_0225749 3300049823 Bacteria 1822
260 Ga0501044_0442929 3300049823 Bacteria 1206
261 Ga0501045_0017171 3300049824 Bacteria 5138
262 Ga0495601_0334532 3300053077 Bacteria 985
263 Ga0495612_0006124 3300053078 Bacteria 4951
264 Ga0495595_0050192 3300053084 Bacteria 1931
265 Ga0495619_0002113 3300053085 Bacteria 13175
266 Ga0500642_0005303 3300053130 Bacteria 4149
267 Ga0500568_0027716 3300053139 Bacteria 2367
268 Ga0500611_007218 3300053727 Bacteria 1659
269 Ga0501084_0105211 3300054114 Bacteria 2370
270 Ga0501082_0190526 3300060353 Bacteria 1784
271 Ga0373944_0072090
272 JGI25406J46586_10003982
273 rootH2_10060731
274 JGI25404J52841_10003070
275 Ga0070660_100488119
276 Ga0070661_100000041
277 Ga0070661_100021916
278 Ga0070673_100262202
279 Ga0070709_10022816
280 Ga0070713_100011912
281 Ga0070713_100155660
282 Ga0070710_10028163
283 Ga0070711_100004209
284 Ga0070663_100151921
285 Ga0070681_10021797
286 Ga0070681_10169988
287 Ga0070681_10460555
288 Ga0070681_10728617
289 Ga0070679_100022668
290 Ga0070684_100010401
291 Ga0068853_100229654
292 Ga0068855_100027429
293 Ga0068855_100325134
294 Ga0068857_100219365
295 Ga0068856_100141308
296 Ga0068852_100667415
297 Ga0068858_100272414
298 Ga0068860_100178582
299 Ga0068862_100485238
300 Ga0081455_10003989
301 Ga0081455_10014097
302 Ga0081540_1003183
303 Ga0081540_1013139
304 Ga0081539_10000729
305 Ga0070717_10499732
306 Ga0070712_100058833
307 Ga0105240_10019547
308 Ga0105237_10173992
309 Ga0105238_10058549
310 Ga0105238_10159049
311 Ga0105238_10177148
312 Ga0105239_10013196
313 Ga0105239_10058477
314 Ga0105239_10185682
315 Ga0157371_10094812
316 Ga0157369_10009045
317 Ga0157372_10033962
318 Ga0157375_11032548
319 Ga0206356_10133052
320 Ga0206354_10800226
321 Ga0206354_11586518
322 Ga0213876_10152368
323 Ga0213876_10200320
324 Ga0209455_1012832
325 Ga0207692_10020162
326 Ga0207699_10023245
327 Ga0207654_10180337
328 Ga0207707_10027062
329 Ga0207707_10028503
330 Ga0207707_10149229
331 Ga0207707_10346683
332 Ga0207695_10124715
333 Ga0207695_10354843
334 Ga0207671_10267207
335 Ga0207693_10059784
336 Ga0207660_10034283
337 Ga0207649_10000053
338 Ga0207649_10015365
339 Ga0207652_10007270
340 Ga0207652_10064498
341 Ga0207652_10118960
342 Ga0207694_10182909
343 Ga0207700_10042054
344 Ga0207700_10098163
345 Ga0207700_10511556
346 Ga0207665_10376481
347 Ga0207661_10026644
348 Ga0207661_10414081
349 Ga0207667_10173737
350 Ga0207651_10156926
351 Ga0207639_10637731
352 Ga0207702_10492494
353 Ga0265337_1016155
354 Ga0265319_1018182
355 Ga0265334_10006810
356 Ga0265323_10000443
357 Ga0265322_10051096
358 Ga0265336_10000637
359 Ga0265338_10000076
360 Ga0265338_10207106
361 Ga0265324_10011765
362 Ga0265330_10046424
363 Ga0265330_10052463
364 Ga0265332_10053762
365 Ga0265332_10069949
366 Ga0265328_10040815
367 Ga0265340_10001129
368 Ga0265340_10048721
369 Ga0265339_10003766
370 Ga0265331_10001602
371 Ga0265327_10000869
372 Ga0307513_10054040
373 Ga0307508_10000120
374 Ga0307508_10441395
375 Ga0265314_10028496
376 Ga0373934_0039741
377 Ga0373934_0069162
378 Ga0373934_0128466
379 Ga0373923_0093947
380 Ga0373936_0086808
381 Ga0373954_0000198
382 Ga0373956_0076171
383 Ga0373955_0049465
384 Ga0373942_0044154
385 Ga0373931_0055489
386 Ga0373933_0160481
387 Ga0373937_0068708
388 Ga0373937_0574313
389 Ga0372808_000618
390 Ga0373925_0190422
391 Ga0436364_1214833
392 Ga0395901_0079201
393 Ga0436365_0871655
394 Ga0436365_1658112
395 Ga0436360_0437323
396 Ga0436360_0878492
397 Ga0436363_0120934
398 Ga0436362_0419687
399 Ga0466966_0273658
400 Ga0466964_0030806
401 Ga0466971_0074442
402 Ga0466967_0013329
403 Ga0466967_0033179
404 Ga0495592_0023186
405 Ga0495592_0057197
406 Ga0495603_0100733
407 Ga0495629_0001168
408 Ga0495638_0050792
409 Ga0495653_0020331
410 Ga0495639_0004916
411 Ga0495662_0170072
412 Ga0495664_0001239
413 Ga0495664_0021902
414 Ga0495594_0021462
415 Ga0495594_0164687
416 Ga0495608_0139250
417 Ga0495618_0013026
418 Ga0495618_0034523
419 Ga0495628_0027513
420 Ga0495628_0298720
421 Ga0495630_0013190
422 Ga0495652_0037506
423 Ga0495665_0013058
424 Ga0495640_0075029
425 Ga0495587_0100726
426 Ga0495645_0042485
427 Ga0495667_0005050
428 Ga0495634_0221793
429 Ga0495635_0002264
430 Ga0495635_0032967
431 Ga0495657_0006044
432 Ga0495599_0030293
433 Ga0495623_0020691
434 Ga0495623_0271057
435 Ga0495646_0013045
436 Ga0495624_0036377
437 Ga0495600_0023777
438 Ga0495581_0030622
439 Ga0495581_0157879
440 Ga0495604_0201459
441 Ga0495674_0028614
442 Ga0495674_0044528
443 Ga0495672_0026369
444 Ga0495676_0052392
445 Ga0495680_0007956
446 Ga0495675_0018232
447 Ga0495684_0000988
448 Ga0495684_0008718
449 Ga0495593_0003204
450 Ga0495593_0022173
451 Ga0495602_0397472
452 Ga0496105_0053947
453 Ga0496109_0463760
454 Ga0496110_0082075
455 Ga0496111_0030057
456 Ga0496112_0030330
457 Ga0496112_0395004
458 Ga0496113_0084627
459 Ga0496115_0113890
460 Ga0496117_0043638
461 Ga0496118_0080699
462 Ga0496121_0033382
463 Ga0496121_0079375
464 Ga0496121_0188874
465 Ga0496124_0026682
466 Ga0496125_0077465
467 Ga0496126_0065244
468 Ga0496126_0083860
469 Ga0496126_0109561
470 Ga0501031_0000476
471 Ga0501031_0221067
472 Ga0501032_0003481
473 Ga0501032_0064945
474 Ga0501033_0000513
475 Ga0501033_0005866
476 Ga0501033_0121631
477 Ga0501034_0000181
478 Ga0501034_0136021
479 Ga0501034_0180335
480 Ga0501034_0233319
481 Ga0501036_0000671
482 Ga0501036_0026343
483 Ga0501037_0000059
484 Ga0501037_0125940
485 Ga0501037_0145200
486 Ga0501038_0000143
487 Ga0501038_0020121
488 Ga0501039_0000069
489 Ga0501042_0011121
490 Ga0501043_0000661
491 Ga0501043_0140510
492 Ga0501043_0288845
493 Ga0501046_0000563
494 Ga0501046_0023257
495 Ga0501046_0145079
496 Ga0501047_0000149
497 Ga0501047_0021310
498 Ga0501047_0038932
499 Ga0501047_0115584
500 Ga0501048_0000128
501 Ga0501067_0002538
502 Ga0501068_0002459
503 Ga0501069_0005554
504 Ga0501070_0009580
505 Ga0501070_0016980
506 Ga0501070_0081283
507 Ga0501070_0160421
508 Ga0501070_0207691
509 Ga0501071_0428907
510 Ga0501072_0001770
511 Ga0501073_0000094
512 Ga0501073_0021177
513 Ga0501074_0000245
514 Ga0501074_0065419
515 Ga0501076_0251548
516 Ga0501079_0252500
517 Ga0501079_0576100
518 Ga0501080_0000486
519 Ga0501080_0052855
520 Ga0501080_0140593
521 Ga0501080_0336009
522 Ga0501083_0001736
523 Ga0501035_0000942
524 Ga0501035_0040522
525 Ga0501035_0264695
526 Ga0501035_0432667
527 Ga0501044_0000443
528 Ga0501044_0027531
529 Ga0501044_0225749
530 Ga0501044_0442929
531 Ga0501045_0017171
532 Ga0495601_0334532
533 Ga0495612_0006124
534 Ga0495595_0050192
535 Ga0495619_0002113
536 Ga0500642_0005303
537 Ga0500568_0027716
538 Ga0500611_007218
539 Ga0501084_0105211
540 Ga0501082_0190526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

18

102

0.91

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

110

239

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f41-assembly2.cif.gz_D crystal structure of fapr- a global regulator of fatty acid biosynthesis in b. subtilis 0.9026 74 126
2f41-assembly2.cif.gz_C crystal structure of fapr- a global regulator of fatty acid biosynthesis in b. subtilis 0.8816 74 128
4a0z-assembly1.cif.gz_B structure of the global transcription regulator fapr from staphylococcus aureus in complex with malonyl-coa 0.8682 74 131
1njk-assembly1.cif.gz_D crystal structure of ybaw probable thioesterase from escherichia coli 0.8639 73 127
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.8629 74 127
ID Description Score Start End Superfamily
af_Q2FV88_6_135_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9086 73 126 3.10.129.10
2f41C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8816 74 128 3.10.129.10
4a0zB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8682 74 131 3.10.129.10
af_Q5AK57_71_273_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8656 36 129 3.10.129.10
af_Q59ZH1_40_216_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8547 73 130 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6B2DFH6-F1-model_v4 Thioesterase family protein 0.9432 150 265
AF-A0A1U1FDD9-F1-model_v4 deleted 0.9419 179 265
AF-A0A7T9F8V4-F1-model_v4 deleted 0.9409 169 265
AF-X8BA54-F1-model_v4 deleted 0.9276 150 265
AF-A0A800A7Q7-F1-model_v4 Thioesterase family protein 0.9137 28 264

Map