F377011

General Info

Members Datasets Scaffolds Average Seq Length
270 144 540 241

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10495161|Ga0207651_104951612
Length 218
Sequence MTFQSDLFKGKTVVVTGGTQGIGAGIAQQFAALGARVVAAGLAPTDAQRDALGNGIEVAALDVVNCAGMIRRGDEHDIETFERVIAVNLNGTMRMCSAARPLLAKTRGAIVNTASMLTFFGGGLVPAYSASKGGVAQLTKSLAIAYAADGIRVNAVAPGVVDTPMHKNDSKEALQSLNPMGVVSSVRDIVDAVMYLTDAATVTGDILYVDGGAHFGRW

Samples

Sample ID Description Type Environment
1 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 1.85
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 15.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207651_10495161 3300025960 Bacteria 1056
2 Ga0065707_10035375 3300005295 Bacteria 983
3 Ga0065707_10201305 3300005295 Bacteria 1309
4 Ga0065707_10334860 3300005295 Bacteria 943
5 Ga0070666_10484984 3300005335 Bacteria 895
6 Ga0070661_100171558 3300005344 Bacteria 1647
7 Ga0070714_100012972 3300005435 Bacteria 6665
8 Ga0070710_10040940 3300005437 Bacteria 2555
9 Ga0070705_100277066 3300005440 Bacteria 1191
10 Ga0070708_100107555 3300005445 Unclassified 2560
11 Ga0070708_100133912 3300005445 Bacteria 2295
12 Ga0070708_100561254 3300005445 Bacteria 1077
13 Ga0070681_10073030 3300005458 Unclassified 3393
14 Ga0070706_100199887 3300005467 Bacteria 1867
15 Ga0070706_100320032 3300005467 Bacteria 1447
16 Ga0070706_100376559 3300005467 Unclassified 1322
17 Ga0070706_100582239 3300005467 Bacteria 1040
18 Ga0070707_100049101 3300005468 Bacteria 4044
19 Ga0070707_100056368 3300005468 Bacteria 3769
20 Ga0070707_100122828 3300005468 Bacteria 2521
21 Ga0070707_100201399 3300005468 Bacteria 1941
22 Ga0070707_100694278 3300005468 Bacteria 980
23 Ga0070698_100037797 3300005471 Bacteria 4977
24 Ga0070698_100058780 3300005471 Bacteria 3886
25 Ga0070699_100065905 3300005518 Unclassified 3143
26 Ga0070699_100082365 3300005518 Bacteria 2805
27 Ga0070684_100277405 3300005535 Bacteria 1535
28 Ga0070697_100101188 3300005536 Bacteria 2394
29 Ga0070697_100798337 3300005536 Bacteria 835
30 Ga0070695_100056389 3300005545 Unclassified 2535
31 Ga0070695_100270870 3300005545 Bacteria 1244
32 Ga0070704_100097905 3300005549 Bacteria 2203
33 Ga0070704_100184994 3300005549 Unclassified 1670
34 Ga0070664_100130774 3300005564 Bacteria 2205
35 Ga0068859_100015438 3300005617 Bacteria 7673
36 Ga0068859_100373579 3300005617 Bacteria 1521
37 Ga0068864_100973245 3300005618 Bacteria 841
38 Ga0068863_100024973 3300005841 Bacteria 5699
39 Ga0068860_100182755 3300005843 Unclassified 2027
40 Ga0068862_100087050 3300005844 Bacteria 2717
41 Ga0081455_10003228 3300005937 Bacteria 18890
42 Ga0081540_1002593 3300005983 Bacteria 14684
43 Ga0081540_1055250 3300005983 Bacteria 1935
44 Ga0070717_10227383 3300006028 Bacteria 1642
45 Ga0070716_100321972 3300006173 Bacteria 1084
46 Ga0075362_10059515 3300006177 Bacteria 1725
47 Ga0068871_100507523 3300006358 Unclassified 1088
48 Ga0075428_100180481 3300006844 Bacteria 2285
49 Ga0075428_100211345 3300006844 Bacteria 2096
50 Ga0075428_100279132 3300006844 Bacteria 1798
51 Ga0075428_100325792 3300006844 Bacteria 1650
52 Ga0075428_100527000 3300006844 Bacteria 1263
53 Ga0075430_100253343 3300006846 Bacteria 1458
54 Ga0075431_100046711 3300006847 Bacteria 4465
55 Ga0075431_100105781 3300006847 Bacteria 2903
56 Ga0075431_100133946 3300006847 Bacteria 2554
57 Ga0075431_100246887 3300006847 Bacteria 1814
58 Ga0075431_100257062 3300006847 Bacteria 1773
59 Ga0075433_10010160 3300006852 Bacteria 7549
60 Ga0075433_10042125 3300006852 Bacteria 3960
61 Ga0075433_10116576 3300006852 Unclassified 2370
62 Ga0075433_10153205 3300006852 Bacteria 2050
63 Ga0075433_10166853 3300006852 Bacteria 1959
64 Ga0075433_10204254 3300006852 Bacteria 1756
65 Ga0075433_10298128 3300006852 Bacteria 1427
66 Ga0075434_100018784 3300006871 Bacteria 6683
67 Ga0075434_100079768 3300006871 Bacteria 3269
68 Ga0075434_100126941 3300006871 Bacteria 2568
69 Ga0075434_100221320 3300006871 Unclassified 1913
70 Ga0075434_100456112 3300006871 Bacteria 1299
71 Ga0075434_100896443 3300006871 Bacteria 902
72 Ga0075429_100040690 3300006880 Bacteria 4047
73 Ga0075429_100164518 3300006880 Bacteria 1943
74 Ga0075436_100077342 3300006914 Bacteria 2305
75 Ga0075436_100193044 3300006914 Unclassified 1441
76 Ga0075436_100326679 3300006914 Bacteria 1102
77 Ga0097620_100015438 3300006931 Bacteria 7673
78 Ga0097620_100373541 3300006931 Bacteria 1521
79 Ga0075435_100010953 3300007076 Bacteria 6647
80 Ga0075435_100462612 3300007076 Unclassified 1094
81 Ga0099794_10031408 3300007265 Unclassified 2486
82 Ga0099794_10134986 3300007265 Bacteria 1248
83 Ga0105240_10124045 3300009093 Unclassified 3106
84 Ga0111539_10110878 3300009094 Bacteria 3220
85 Ga0111539_10229743 3300009094 Bacteria 2160
86 Ga0111539_10784293 3300009094 Bacteria 1109
87 Ga0114129_10103031 3300009147 Bacteria 3946
88 Ga0114129_10121982 3300009147 Bacteria 3586
89 Ga0114129_10293827 3300009147 Bacteria 2168
90 Ga0114129_10340073 3300009147 Bacteria 1991
91 Ga0114129_10409081 3300009147 Bacteria 1787
92 Ga0114129_10968618 3300009147 Bacteria 1073
93 Ga0105242_10493207 3300009176 Unclassified 1163
94 Ga0105248_10064176 3300009177 Unclassified 4123
95 Ga0105248_10387914 3300009177 Bacteria 1573
96 Ga0105238_10658152 3300009551 Bacteria 1058
97 Ga0105249_10061562 3300009553 Bacteria 3445
98 Ga0105249_10235896 3300009553 Bacteria 1806
99 Ga0105249_10236644 3300009553 Bacteria 1803
100 Ga0105239_10035571 3300010375 Bacteria 5469
101 Ga0157374_10473612 3300013296 Bacteria 1255
102 Ga0157378_10104071 3300013297 Bacteria 2595
103 Ga0157378_10247586 3300013297 Bacteria 1705
104 Ga0163162_10100922 3300013306 Bacteria 2977
105 Ga0163163_10065218 3300014325 Bacteria 3614
106 Ga0163163_10101503 3300014325 Unclassified 2899
107 Ga0157379_10485808 3300014968 Unclassified 1143
108 Ga0157379_10571156 3300014968 Bacteria 1054
109 Ga0157376_10013111 3300014969 Bacteria 6175
110 Ga0157376_10432628 3300014969 Bacteria 1279
111 Ga0163161_10466349 3300017792 Bacteria 1023
112 Ga0207685_10030119 3300025905 Bacteria 1929
113 Ga0207643_10107857 3300025908 Bacteria 1638
114 Ga0207684_10024053 3300025910 Bacteria 5197
115 Ga0207684_10067384 3300025910 Bacteria 3042
116 Ga0207684_10162744 3300025910 Unclassified 1922
117 Ga0207684_10304449 3300025910 Unclassified 1374
118 Ga0207707_10559025 3300025912 Unclassified 971
119 Ga0207695_10089984 3300025913 Unclassified 3085
120 Ga0207663_10310039 3300025916 Unclassified 1182
121 Ga0207663_10484423 3300025916 Bacteria 959
122 Ga0207660_10302117 3300025917 Bacteria 1274
123 Ga0207646_10044200 3300025922 Bacteria 3998
124 Ga0207646_10072632 3300025922 Bacteria 3073
125 Ga0207646_10401628 3300025922 Bacteria 1237
126 Ga0207687_10102634 3300025927 Bacteria 2107
127 Ga0207664_10047731 3300025929 Bacteria 3365
128 Ga0207709_10196443 3300025935 Unclassified 1437
129 Ga0207704_10484903 3300025938 Bacteria 993
130 Ga0207711_10400377 3300025941 Unclassified 1275
131 Ga0207679_10003235 3300025945 Bacteria 10048
132 Ga0207679_10228892 3300025945 Bacteria 1568
133 Ga0207703_10571129 3300026035 Bacteria 1068
134 Ga0207708_10224503 3300026075 Bacteria 1506
135 Ga0207641_10183040 3300026088 Unclassified 1920
136 Ga0207641_10285980 3300026088 Bacteria 1553
137 Ga0207648_10228894 3300026089 Bacteria 1653
138 Ga0207676_10710907 3300026095 Bacteria 974
139 Ga0268265_10056722 3300028380 Bacteria 2982
140 Ga0265334_10000014 3300028573 Bacteria 154345
141 Ga0265338_10025646 3300028800 Bacteria 5975
142 Ga0265338_10037685 3300028800 Bacteria 4596
143 Ga0265332_10026857 3300031238 Bacteria 2523
144 Ga0265332_10033796 3300031238 Bacteria 2225
145 Ga0265328_10050748 3300031239 Bacteria 1523
146 Ga0265320_10006042 3300031240 Bacteria 7685
147 Ga0265325_10017803 3300031241 Bacteria 3947
148 Ga0265325_10108975 3300031241 Bacteria 1348
149 Ga0265339_10001038 3300031249 Bacteria 21149
150 Ga0265339_10005834 3300031249 Bacteria 8166
151 Ga0265339_10030171 3300031249 Bacteria 3072
152 Ga0265331_10009785 3300031250 Bacteria 5350
153 Ga0265327_10002125 3300031251 Bacteria 21915
154 Ga0265316_10015443 3300031344 Bacteria 6676
155 Ga0265313_10028727 3300031595 Bacteria 2886
156 Ga0265314_10000843 3300031711 Bacteria 36306
157 Ga0265314_10001316 3300031711 Bacteria 28132
158 Ga0265314_10016780 3300031711 Bacteria 5770
159 Ga0265314_10035021 3300031711 Bacteria 3663
160 Ga0265342_10020660 3300031712 Bacteria 4218
161 Ga0265342_10116345 3300031712 Bacteria 1509
162 Ga0373934_0077451 3300035086 Bacteria 1334
163 Ga0373934_0131948 3300035086 Bacteria 1019
164 Ga0373939_0111654 3300035114 Bacteria 953
165 Ga0373956_0101942 3300035119 Bacteria 1332
166 Ga0373956_0176997 3300035119 Unclassified 1008
167 Ga0373962_0008810 3300035242 Bacteria 2491
168 Ga0373935_0039809 3300035692 Unclassified 2948
169 Ga0373935_0063017 3300035692 Bacteria 2376
170 Ga0373947_0533115 3300035725 Bacteria 799
171 Ga0373937_0003408 3300036401 Bacteria 13340
172 Ga0373937_0021702 3300036401 Bacteria 5764
173 Ga0373925_0069075 3300037068 Bacteria 2668
174 Ga0373925_0184527 3300037068 Bacteria 1653
175 Ga0373925_0204389 3300037068 Unclassified 1572
176 Ga0436364_0594311 3300037853 Bacteria 835
177 Ga0436364_1411564 3300037853 Bacteria 1711
178 Ga0436360_0344800 3300039438 Bacteria 965
179 Ga0436360_0345754 3300039438 Bacteria 823
180 Ga0436360_0517300 3300039438 Bacteria 1025
181 Ga0436361_0860047 3300039447 Bacteria 1070
182 Ga0436363_1002037 3300039450 Bacteria 1611
183 Ga0436363_1431982 3300039450 Bacteria 1160
184 Ga0436362_0908262 3300039453 Bacteria 837
185 Ga0436362_0935061 3300039453 Bacteria 1096
186 Ga0451849_1124620 3300041505 Bacteria 1654
187 Ga0451851_0226291 3300041507 Bacteria 1718
188 Ga0451853_0487412 3300041512 Bacteria 18071
189 Ga0451853_1481127 3300041512 Bacteria 1172
190 Ga0453684_0077034 3300044712 Bacteria 4183
191 Ga0451576_0007508 3300045051 Bacteria 13012
192 Ga0451576_0071628 3300045051 Unclassified 3608
193 Ga0451576_0965547 3300045051 Bacteria 893
194 Ga0495629_0325517 3300046459 Bacteria 1050
195 Ga0495629_0474369 3300046459 Bacteria 846
196 Ga0495651_0500311 3300046462 Bacteria 778
197 Ga0495580_0030599 3300046472 Bacteria 3896
198 Ga0495639_0017785 3300046475 Bacteria 3089
199 Ga0495584_0124922 3300046491 Unclassified 1304
200 Ga0495594_0137645 3300046499 Bacteria 1384
201 Ga0495608_0065535 3300046511 Bacteria 2379
202 Ga0495618_0035645 3300046514 Bacteria 3123
203 Ga0495618_0157535 3300046514 Bacteria 1449
204 Ga0495628_0064934 3300046516 Unclassified 2857
205 Ga0495630_0000001 3300046517 Bacteria 1687293
206 Ga0495640_0444168 3300046533 Bacteria 793
207 Ga0495587_0133885 3300046536 Bacteria 1416
208 Ga0495598_0105468 3300046537 Bacteria 938
209 Ga0495621_0076682 3300046539 Unclassified 1240
210 Ga0495645_0059871 3300046543 Unclassified 2760
211 Ga0495667_0073803 3300046559 Bacteria 2222
212 Ga0495657_0018135 3300046675 Bacteria 5099
213 Ga0495599_0028729 3300046678 Unclassified 3485
214 Ga0495646_0158024 3300046680 Bacteria 1257
215 Ga0495613_0000697 3300046689 Bacteria 26458
216 Ga0495624_0065286 3300046690 Bacteria 2274
217 Ga0495680_0068729 3300047322 Bacteria 2705
218 Ga0495680_0077477 3300047322 Bacteria 2518
219 Ga0495675_0145089 3300047444 Bacteria 1469
220 Ga0495684_0091829 3300047471 Unclassified 2300
221 Ga0495684_0145227 3300047471 Bacteria 1777
222 Ga0496104_0551005 3300048907 Bacteria 1064
223 Ga0496105_0014317 3300048908 Bacteria 6313
224 Ga0496112_0593117 3300048915 Bacteria 1040
225 Ga0496114_0124430 3300048917 Bacteria 2221
226 Ga0496115_0286359 3300048918 Bacteria 1352
227 nmdc:mga05p37_198453_c1 3300050507 Bacteria 2432
228 nmdc:mga05p37_210024_c1 3300050507 Bacteria 2354
229 nmdc:mga05p37_213645_c1 3300050507 Bacteria 2331
230 nmdc:mga05p37_261316_c1 3300050507 Bacteria 2072
231 nmdc:mga05p37_275559_c1 3300050507 Bacteria 2009
232 nmdc:mga05p37_446405_c1 3300050507 Unclassified 1498
233 nmdc:mga05p37_624681_c1 3300050507 Bacteria 1212
234 nmdc:mga05p37_77501_c1 3300050507 Bacteria 4092
235 nmdc:mga05p37_95588_c1 3300050507 Bacteria 3661
236 nmdc:mga09592_20128_c1 3300050508 Bacteria 5484
237 nmdc:mga09592_36066_c1 3300050508 Bacteria 4142
238 nmdc:mga09592_42607_c1 3300050508 Bacteria 3819
239 nmdc:mga0qj67_25504_c1 3300050509 Bacteria 4569
240 nmdc:mga06r32_102073_c1 3300050510 Bacteria 2815
241 nmdc:mga06r32_44658_c1 3300050510 Bacteria 4220
242 nmdc:mga06r32_453337_c1 3300050510 Bacteria 1262
243 nmdc:mga06r32_48009_c1 3300050510 Bacteria 4080
244 nmdc:mga06r32_521628_c1 3300050510 Bacteria 1164
245 nmdc:mga06r32_584707_c1 3300050510 Unclassified 1088
246 nmdc:mga08y16_202786_c1 3300050511 Bacteria 2055
247 nmdc:mga08y16_23083_c1 3300050511 Bacteria 6569
248 nmdc:mga08y16_248770_c1 3300050511 Bacteria 1837
249 nmdc:mga08y16_40855_c1 3300050511 Bacteria 4859
250 nmdc:mga0n895_1055022_c1 3300050512 Bacteria 792
251 nmdc:mga0n895_123156_c1 3300050512 Bacteria 2615
252 nmdc:mga0n895_154545_c1 3300050512 Unclassified 2325
253 nmdc:mga0n895_226695_c1 3300050512 Bacteria 1897
254 nmdc:mga0n895_251431_c1 3300050512 Bacteria 1794
255 nmdc:mga0n895_289862_c1 3300050512 Bacteria 1660
256 nmdc:mga0n895_33134_c1 3300050512 Unclassified 4963
257 nmdc:mga0n895_431392_c1 3300050512 Bacteria 1332
258 nmdc:mga0n895_50262_c1 3300050512 Bacteria 4087
259 nmdc:mga0rr50_47675_c1 3300050513 Bacteria 3163
260 nmdc:mga0rr50_60255_c1 3300050513 Unclassified 2854
261 nmdc:mga0rr50_78487_c1 3300050513 Bacteria 2541
262 nmdc:mga08x19_227503_c1 3300050514 Unclassified 1283
263 nmdc:mga0a205_100199_c1 3300050515 Bacteria 2796
264 nmdc:mga0a205_16292_c1 3300050515 Bacteria 6960
265 nmdc:mga0a205_204754_c1 3300050515 Unclassified 1863
266 nmdc:mga0a205_23402_c1 3300050515 Bacteria 5860
267 nmdc:mga0a205_467848_c1 3300050515 Bacteria 1120
268 nmdc:mga0a205_4777_c1 3300050515 Bacteria 12170
269 nmdc:mga0a205_78234_c1 3300050515 Bacteria 3195
270 Ga0495595_0226784 3300053084 Bacteria 933
271 Ga0207651_10495161
272 Ga0065707_10035375
273 Ga0065707_10201305
274 Ga0065707_10334860
275 Ga0070666_10484984
276 Ga0070661_100171558
277 Ga0070714_100012972
278 Ga0070710_10040940
279 Ga0070705_100277066
280 Ga0070708_100107555
281 Ga0070708_100133912
282 Ga0070708_100561254
283 Ga0070681_10073030
284 Ga0070706_100199887
285 Ga0070706_100320032
286 Ga0070706_100376559
287 Ga0070706_100582239
288 Ga0070707_100049101
289 Ga0070707_100056368
290 Ga0070707_100122828
291 Ga0070707_100201399
292 Ga0070707_100694278
293 Ga0070698_100037797
294 Ga0070698_100058780
295 Ga0070699_100065905
296 Ga0070699_100082365
297 Ga0070684_100277405
298 Ga0070697_100101188
299 Ga0070697_100798337
300 Ga0070695_100056389
301 Ga0070695_100270870
302 Ga0070704_100097905
303 Ga0070704_100184994
304 Ga0070664_100130774
305 Ga0068859_100015438
306 Ga0068859_100373579
307 Ga0068864_100973245
308 Ga0068863_100024973
309 Ga0068860_100182755
310 Ga0068862_100087050
311 Ga0081455_10003228
312 Ga0081540_1002593
313 Ga0081540_1055250
314 Ga0070717_10227383
315 Ga0070716_100321972
316 Ga0075362_10059515
317 Ga0068871_100507523
318 Ga0075428_100180481
319 Ga0075428_100211345
320 Ga0075428_100279132
321 Ga0075428_100325792
322 Ga0075428_100527000
323 Ga0075430_100253343
324 Ga0075431_100046711
325 Ga0075431_100105781
326 Ga0075431_100133946
327 Ga0075431_100246887
328 Ga0075431_100257062
329 Ga0075433_10010160
330 Ga0075433_10042125
331 Ga0075433_10116576
332 Ga0075433_10153205
333 Ga0075433_10166853
334 Ga0075433_10204254
335 Ga0075433_10298128
336 Ga0075434_100018784
337 Ga0075434_100079768
338 Ga0075434_100126941
339 Ga0075434_100221320
340 Ga0075434_100456112
341 Ga0075434_100896443
342 Ga0075429_100040690
343 Ga0075429_100164518
344 Ga0075436_100077342
345 Ga0075436_100193044
346 Ga0075436_100326679
347 Ga0097620_100015438
348 Ga0097620_100373541
349 Ga0075435_100010953
350 Ga0075435_100462612
351 Ga0099794_10031408
352 Ga0099794_10134986
353 Ga0105240_10124045
354 Ga0111539_10110878
355 Ga0111539_10229743
356 Ga0111539_10784293
357 Ga0114129_10103031
358 Ga0114129_10121982
359 Ga0114129_10293827
360 Ga0114129_10340073
361 Ga0114129_10409081
362 Ga0114129_10968618
363 Ga0105242_10493207
364 Ga0105248_10064176
365 Ga0105248_10387914
366 Ga0105238_10658152
367 Ga0105249_10061562
368 Ga0105249_10235896
369 Ga0105249_10236644
370 Ga0105239_10035571
371 Ga0157374_10473612
372 Ga0157378_10104071
373 Ga0157378_10247586
374 Ga0163162_10100922
375 Ga0163163_10065218
376 Ga0163163_10101503
377 Ga0157379_10485808
378 Ga0157379_10571156
379 Ga0157376_10013111
380 Ga0157376_10432628
381 Ga0163161_10466349
382 Ga0207685_10030119
383 Ga0207643_10107857
384 Ga0207684_10024053
385 Ga0207684_10067384
386 Ga0207684_10162744
387 Ga0207684_10304449
388 Ga0207707_10559025
389 Ga0207695_10089984
390 Ga0207663_10310039
391 Ga0207663_10484423
392 Ga0207660_10302117
393 Ga0207646_10044200
394 Ga0207646_10072632
395 Ga0207646_10401628
396 Ga0207687_10102634
397 Ga0207664_10047731
398 Ga0207709_10196443
399 Ga0207704_10484903
400 Ga0207711_10400377
401 Ga0207679_10003235
402 Ga0207679_10228892
403 Ga0207703_10571129
404 Ga0207708_10224503
405 Ga0207641_10183040
406 Ga0207641_10285980
407 Ga0207648_10228894
408 Ga0207676_10710907
409 Ga0268265_10056722
410 Ga0265334_10000014
411 Ga0265338_10025646
412 Ga0265338_10037685
413 Ga0265332_10026857
414 Ga0265332_10033796
415 Ga0265328_10050748
416 Ga0265320_10006042
417 Ga0265325_10017803
418 Ga0265325_10108975
419 Ga0265339_10001038
420 Ga0265339_10005834
421 Ga0265339_10030171
422 Ga0265331_10009785
423 Ga0265327_10002125
424 Ga0265316_10015443
425 Ga0265313_10028727
426 Ga0265314_10000843
427 Ga0265314_10001316
428 Ga0265314_10016780
429 Ga0265314_10035021
430 Ga0265342_10020660
431 Ga0265342_10116345
432 Ga0373934_0077451
433 Ga0373934_0131948
434 Ga0373939_0111654
435 Ga0373956_0101942
436 Ga0373956_0176997
437 Ga0373962_0008810
438 Ga0373935_0039809
439 Ga0373935_0063017
440 Ga0373947_0533115
441 Ga0373937_0003408
442 Ga0373937_0021702
443 Ga0373925_0069075
444 Ga0373925_0184527
445 Ga0373925_0204389
446 Ga0436364_0594311
447 Ga0436364_1411564
448 Ga0436360_0344800
449 Ga0436360_0345754
450 Ga0436360_0517300
451 Ga0436361_0860047
452 Ga0436363_1002037
453 Ga0436363_1431982
454 Ga0436362_0908262
455 Ga0436362_0935061
456 Ga0451849_1124620
457 Ga0451851_0226291
458 Ga0451853_0487412
459 Ga0451853_1481127
460 Ga0453684_0077034
461 Ga0451576_0007508
462 Ga0451576_0071628
463 Ga0451576_0965547
464 Ga0495629_0325517
465 Ga0495629_0474369
466 Ga0495651_0500311
467 Ga0495580_0030599
468 Ga0495639_0017785
469 Ga0495584_0124922
470 Ga0495594_0137645
471 Ga0495608_0065535
472 Ga0495618_0035645
473 Ga0495618_0157535
474 Ga0495628_0064934
475 Ga0495630_0000001
476 Ga0495640_0444168
477 Ga0495587_0133885
478 Ga0495598_0105468
479 Ga0495621_0076682
480 Ga0495645_0059871
481 Ga0495667_0073803
482 Ga0495657_0018135
483 Ga0495599_0028729
484 Ga0495646_0158024
485 Ga0495613_0000697
486 Ga0495624_0065286
487 Ga0495680_0068729
488 Ga0495680_0077477
489 Ga0495675_0145089
490 Ga0495684_0091829
491 Ga0495684_0145227
492 Ga0496104_0551005
493 Ga0496105_0014317
494 Ga0496112_0593117
495 Ga0496114_0124430
496 Ga0496115_0286359
497 nmdc:mga05p37_198453_c1
498 nmdc:mga05p37_210024_c1
499 nmdc:mga05p37_213645_c1
500 nmdc:mga05p37_261316_c1
501 nmdc:mga05p37_275559_c1
502 nmdc:mga05p37_446405_c1
503 nmdc:mga05p37_624681_c1
504 nmdc:mga05p37_77501_c1
505 nmdc:mga05p37_95588_c1
506 nmdc:mga09592_20128_c1
507 nmdc:mga09592_36066_c1
508 nmdc:mga09592_42607_c1
509 nmdc:mga0qj67_25504_c1
510 nmdc:mga06r32_102073_c1
511 nmdc:mga06r32_44658_c1
512 nmdc:mga06r32_453337_c1
513 nmdc:mga06r32_48009_c1
514 nmdc:mga06r32_521628_c1
515 nmdc:mga06r32_584707_c1
516 nmdc:mga08y16_202786_c1
517 nmdc:mga08y16_23083_c1
518 nmdc:mga08y16_248770_c1
519 nmdc:mga08y16_40855_c1
520 nmdc:mga0n895_1055022_c1
521 nmdc:mga0n895_123156_c1
522 nmdc:mga0n895_154545_c1
523 nmdc:mga0n895_226695_c1
524 nmdc:mga0n895_251431_c1
525 nmdc:mga0n895_289862_c1
526 nmdc:mga0n895_33134_c1
527 nmdc:mga0n895_431392_c1
528 nmdc:mga0n895_50262_c1
529 nmdc:mga0rr50_47675_c1
530 nmdc:mga0rr50_60255_c1
531 nmdc:mga0rr50_78487_c1
532 nmdc:mga08x19_227503_c1
533 nmdc:mga0a205_100199_c1
534 nmdc:mga0a205_16292_c1
535 nmdc:mga0a205_204754_c1
536 nmdc:mga0a205_23402_c1
537 nmdc:mga0a205_467848_c1
538 nmdc:mga0a205_4777_c1
539 nmdc:mga0a205_78234_c1
540 Ga0495595_0226784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

214

0.93

PF00106

adh_short

short chain dehydrogenase

50

174

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3un1-assembly1.cif.gz_A crystal structure of an oxidoreductase from sinorhizobium meliloti 1021 0.938 1 242
4cqm-assembly4.cif.gz_G crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9227 9 236
3un1-assembly1.cif.gz_A crystal structure of an oxidoreductase from sinorhizobium meliloti 1021 0.9192 1 242
4cql-assembly4.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9164 6 236
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9105 6 236
ID Description Score Start End Superfamily
3un1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9367 5 242 3.40.50.720
3un1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.921 5 242 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9173 2 179 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9087 6 237 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.905 4 237 3.40.50.720
ID Description Score Start End GO Terms
AF-Q1MEH7-F1-model_v4 Short-chain dehydrogenase/oxidoreductase 0.9626 1 130 GO:0016491
AF-A0A1W9HII7-F1-model_v4 3-oxoacyl-ACP reductase 0.9551 5 159
AF-A0A2N9LZU3-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9523 2 242
AF-A0A5C7XMZ0-F1-model_v4 SDR family oxidoreductase 0.9501 3 237 GO:0016616
GO:0030497
AF-A0A6H1M3C7-F1-model_v4 SDR family oxidoreductase 0.9479 1 237

Map