F376743

General Info

Members Datasets Scaffolds Average Seq Length
270 148 540 356

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100245207|Ga0070659_1002452071
Length 361
Sequence MKAALFCTSRYIGEAPQGVWPVPNEYCDPEIAEQSMAVTMEQFRLADVFGFDWVTVAEHHFSSLSLTPNPMIFAGALSQVVKRAKIAVLGPSLPTLNPVRVAEEFAMLDAMTGGRLIAGLMRGTPNEYVTYNFNPSESRARFAEALEIIRRAWTEPQPFGWQGRYYQYRSISIWPRPVQRPHPPMYMSGSSPEAGEFAAEQHIGLGFAFTTIAQAAKASAYYQAQCREQGWEAKPDDIIYRVGFHVAETDEEAFDDMSKAPQRVALTTANASINKAMTETAYYGRDESQVTRTATRTLQDRIDSGQLLVGSPETIARQIERIRKEIGAGILDCPLAAQLGDKTLRSIELFGTKVLPRIREL

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 18.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100245207 3300005366 Bacteria 1484
2 Ga0065707_10017869 3300005295 Bacteria 1749
3 Ga0070683_100432569 3300005329 Bacteria 1256
4 Ga0070680_100003847 3300005336 Bacteria 11217
5 Ga0070680_100055114 3300005336 Unclassified 3248
6 Ga0070692_10088855 3300005345 Bacteria 1676
7 Ga0070669_100073767 3300005353 Bacteria 2529
8 Ga0070671_100329850 3300005355 Bacteria 1301
9 Ga0070709_10073650 3300005434 Unclassified 2212
10 Ga0070714_100057535 3300005435 Bacteria 3329
11 Ga0070714_100165073 3300005435 Unclassified 2006
12 Ga0070713_100013556 3300005436 Bacteria 6025
13 Ga0070713_100132156 3300005436 Unclassified 2202
14 Ga0070713_100145782 3300005436 Unclassified 2101
15 Ga0070713_100232473 3300005436 Unclassified 1676
16 Ga0070710_10060702 3300005437 Unclassified 2151
17 Ga0070711_100009826 3300005439 Bacteria 5901
18 Ga0070705_100001892 3300005440 Bacteria 10758
19 Ga0070705_100181922 3300005440 Bacteria 1425
20 Ga0070708_100059320 3300005445 Unclassified 3411
21 Ga0070708_100111982 3300005445 Bacteria 2509
22 Ga0070681_10008527 3300005458 Bacteria 10039
23 Ga0070681_10082239 3300005458 Bacteria 3175
24 Ga0070681_10096399 3300005458 Bacteria 2906
25 Ga0070681_10137945 3300005458 Bacteria 2369
26 Ga0070706_100043657 3300005467 Bacteria 4142
27 Ga0070706_100060075 3300005467 Bacteria 3509
28 Ga0070706_100208769 3300005467 Bacteria 1823
29 Ga0070706_100237493 3300005467 Bacteria 1702
30 Ga0070707_100010436 3300005468 Bacteria 8650
31 Ga0070707_100042116 3300005468 Bacteria 4370
32 Ga0070698_100000828 3300005471 Bacteria 33866
33 Ga0070698_100260127 3300005471 Bacteria 1668
34 Ga0070699_100106746 3300005518 Bacteria 2457
35 Ga0070679_100001529 3300005530 Bacteria 20618
36 Ga0070679_100002248 3300005530 Bacteria 17450
37 Ga0070679_100014939 3300005530 Bacteria 7459
38 Ga0070679_100082065 3300005530 Bacteria 3214
39 Ga0070686_100089338 3300005544 Bacteria 2058
40 Ga0070696_100067669 3300005546 Bacteria 2507
41 Ga0070696_100158593 3300005546 Bacteria 1666
42 Ga0070704_100053683 3300005549 Bacteria 2849
43 Ga0068856_100044489 3300005614 Bacteria 4370
44 Ga0070702_100138095 3300005615 Bacteria 1549
45 Ga0068859_100277178 3300005617 Unclassified 1769
46 Ga0068863_100110316 3300005841 Bacteria 2620
47 Ga0068860_100102032 3300005843 Bacteria 2737
48 Ga0068860_100256129 3300005843 Unclassified 1705
49 Ga0068862_100341122 3300005844 Bacteria 1388
50 Ga0081455_10131414 3300005937 Bacteria 1957
51 Ga0081540_1063914 3300005983 Bacteria 1739
52 Ga0070717_10000510 3300006028 Bacteria 24663
53 Ga0070717_10031941 3300006028 Bacteria 4239
54 Ga0070717_10109500 3300006028 Bacteria 2354
55 Ga0070715_10118758 3300006163 Bacteria 1258
56 Ga0075428_100002883 3300006844 Bacteria 18731
57 Ga0075428_100018013 3300006844 Bacteria 7805
58 Ga0075428_100293043 3300006844 Bacteria 1750
59 Ga0075430_100000577 3300006846 Bacteria 27863
60 Ga0075430_100002200 3300006846 Bacteria 16159
61 Ga0075430_100081382 3300006846 Bacteria 2713
62 Ga0075431_100000847 3300006847 Bacteria 26809
63 Ga0075431_100002107 3300006847 Bacteria 19006
64 Ga0075431_100039345 3300006847 Bacteria 4871
65 Ga0075431_100048763 3300006847 Bacteria 4368
66 Ga0075431_100176473 3300006847 Bacteria 2194
67 Ga0075431_100307817 3300006847 Bacteria 1600
68 Ga0075433_10000934 3300006852 Bacteria 20627
69 Ga0075433_10031655 3300006852 Bacteria 4523
70 Ga0075433_10039142 3300006852 Bacteria 4098
71 Ga0075433_10196630 3300006852 Bacteria 1793
72 Ga0075434_100025364 3300006871 Bacteria 5800
73 Ga0075434_100028904 3300006871 Bacteria 5451
74 Ga0075434_100125001 3300006871 Bacteria 2590
75 Ga0075434_100165645 3300006871 Bacteria 2230
76 Ga0075429_100000485 3300006880 Bacteria 29758
77 Ga0075429_100006874 3300006880 Bacteria 9874
78 Ga0075429_100045520 3300006880 Bacteria 3817
79 Ga0075429_100058010 3300006880 Bacteria 3371
80 Ga0075429_100093599 3300006880 Bacteria 2621
81 Ga0075436_100110618 3300006914 Unclassified 1917
82 Ga0075436_100221431 3300006914 Bacteria 1343
83 Ga0097620_100277191 3300006931 Unclassified 1769
84 Ga0075435_100017155 3300007076 Bacteria 5473
85 Ga0075435_100020047 3300007076 Bacteria 5113
86 Ga0075435_100082841 3300007076 Unclassified 2637
87 Ga0075435_100117262 3300007076 Bacteria 2219
88 Ga0075435_100124765 3300007076 Bacteria 2151
89 Ga0099794_10052704 3300007265 Bacteria 1961
90 Ga0105240_10034521 3300009093 Bacteria 6523
91 Ga0111539_10001965 3300009094 Bacteria 27441
92 Ga0111539_10037451 3300009094 Bacteria 5856
93 Ga0105247_10172970 3300009101 Bacteria 1437
94 Ga0114129_10018133 3300009147 Bacteria 10025
95 Ga0114129_10027324 3300009147 Bacteria 8080
96 Ga0114129_10031995 3300009147 Bacteria 7436
97 Ga0114129_10237523 3300009147 Bacteria 2451
98 Ga0114129_10472193 3300009147 Unclassified 1642
99 Ga0105241_10154195 3300009174 Bacteria 1882
100 Ga0105248_10133849 3300009177 Unclassified 2797
101 Ga0105249_10136615 3300009553 Bacteria 2347
102 Ga0157370_10002352 3300013104 Bacteria 22841
103 Ga0157370_10019464 3300013104 Bacteria 6809
104 Ga0157370_10110057 3300013104 Bacteria 2575
105 Ga0157370_10155728 3300013104 Unclassified 2126
106 Ga0157369_10046609 3300013105 Bacteria 4710
107 Ga0157378_10212630 3300013297 Bacteria 1834
108 Ga0163162_10023969 3300013306 Bacteria 6022
109 Ga0163163_10268606 3300014325 Unclassified 1757
110 Ga0163163_10352260 3300014325 Bacteria 1528
111 Ga0182008_10012590 3300014497 Bacteria 4464
112 Ga0182008_10015401 3300014497 Bacteria 3989
113 Ga0182008_10019346 3300014497 Bacteria 3516
114 Ga0163161_10200467 3300017792 Bacteria 1538
115 Ga0213874_10036609 3300021377 Bacteria 1448
116 Ga0213875_10000552 3300021388 Bacteria 30617
117 Ga0213875_10068000 3300021388 Unclassified 1664
118 Ga0207685_10076778 3300025905 Bacteria 1370
119 Ga0207699_10111650 3300025906 Unclassified 1753
120 Ga0207684_10019913 3300025910 Bacteria 5735
121 Ga0207684_10021761 3300025910 Bacteria 5474
122 Ga0207684_10029089 3300025910 Bacteria 4706
123 Ga0207707_10078055 3300025912 Bacteria 2891
124 Ga0207707_10155440 3300025912 Bacteria 2000
125 Ga0207707_10333940 3300025912 Unclassified 1307
126 Ga0207693_10002201 3300025915 Bacteria 16997
127 Ga0207693_10017877 3300025915 Bacteria 5653
128 Ga0207693_10036091 3300025915 Bacteria 3896
129 Ga0207693_10174247 3300025915 Unclassified 1693
130 Ga0207663_10040142 3300025916 Bacteria 2842
131 Ga0207663_10040395 3300025916 Bacteria 2835
132 Ga0207660_10020032 3300025917 Bacteria 4482
133 Ga0207660_10235667 3300025917 Bacteria 1440
134 Ga0207657_10121336 3300025919 Bacteria 2150
135 Ga0207652_10004204 3300025921 Bacteria 11750
136 Ga0207652_10006691 3300025921 Bacteria 9285
137 Ga0207652_10304253 3300025921 Unclassified 1439
138 Ga0207646_10006273 3300025922 Bacteria 12329
139 Ga0207646_10014619 3300025922 Bacteria 7441
140 Ga0207646_10073261 3300025922 Bacteria 3059
141 Ga0207646_10095765 3300025922 Bacteria 2659
142 Ga0207700_10011727 3300025928 Bacteria 5607
143 Ga0207700_10062400 3300025928 Bacteria 2830
144 Ga0207664_10011181 3300025929 Bacteria 6365
145 Ga0207664_10133293 3300025929 Bacteria 2094
146 Ga0207664_10291645 3300025929 Unclassified 1434
147 Ga0207706_10019719 3300025933 Bacteria 6065
148 Ga0207709_10066020 3300025935 Bacteria 2277
149 Ga0207691_10005919 3300025940 Bacteria 11807
150 Ga0207711_10031622 3300025941 Unclassified 4469
151 Ga0207661_10131567 3300025944 Bacteria 2144
152 Ga0207679_10386989 3300025945 Unclassified 1227
153 Ga0207658_10268994 3300025986 Bacteria 1456
154 Ga0207702_10011383 3300026078 Bacteria 7416
155 Ga0207641_10038460 3300026088 Bacteria 4000
156 Ga0207648_10124373 3300026089 Unclassified 2268
157 Ga0207675_100315382 3300026118 Bacteria 1525
158 Ga0207428_10001047 3300027907 Bacteria 30430
159 Ga0207428_10134477 3300027907 Bacteria 1891
160 Ga0307408_100026281 3300031548 Bacteria 3997
161 Ga0265313_10088991 3300031595 Unclassified 1389
162 Ga0307412_10060606 3300031911 Bacteria 2540
163 Ga0307416_100155930 3300032002 Bacteria 2102
164 Ga0373940_0007599 3300035088 Bacteria 2452
165 Ga0373940_0024795 3300035088 Unclassified 1557
166 Ga0373944_0012704 3300035089 Unclassified 2326
167 Ga0373944_0063078 3300035089 Bacteria 1193
168 Ga0373923_0018188 3300035111 Bacteria 2701
169 Ga0373943_0135497 3300035170 Unclassified 1322
170 Ga0373955_0016073 3300035172 Bacteria 3677
171 Ga0373962_0037763 3300035242 Bacteria 1350
172 Ga0373924_0085594 3300035410 Bacteria 1345
173 Ga0373931_0006064 3300035691 Bacteria 5630
174 Ga0373931_0008725 3300035691 Bacteria 4824
175 Ga0373927_0036667 3300035695 Bacteria 3188
176 Ga0373927_0041409 3300035695 Bacteria 2988
177 Ga0373933_0030529 3300035724 Bacteria 3121
178 Ga0373933_0060856 3300035724 Unclassified 2277
179 Ga0373933_0064770 3300035724 Unclassified 2212
180 Ga0373933_0091831 3300035724 Bacteria 1874
181 Ga0373947_0022742 3300035725 Bacteria 3639
182 Ga0373937_0001288 3300036401 Bacteria 20997
183 Ga0373937_0009252 3300036401 Bacteria 8554
184 Ga0373937_0022108 3300036401 Bacteria 5714
185 Ga0373937_0091704 3300036401 Bacteria 2815
186 Ga0373937_0115329 3300036401 Bacteria 2501
187 Ga0373937_0140120 3300036401 Bacteria 2262
188 Ga0373937_0392467 3300036401 Unclassified 1316
189 Ga0373925_0099774 3300037068 Unclassified 2230
190 Ga0395900_0123600 3300037418 Bacteria 2654
191 Ga0395900_0291663 3300037418 Bacteria 1620
192 Ga0395898_0022462 3300037466 Bacteria 6389
193 Ga0436364_0499586 3300037853 Unclassified 1777
194 Ga0436364_0827620 3300037853 Bacteria 9608
195 Ga0436364_1284200 3300037853 Bacteria 100206
196 Ga0395901_0018831 3300038443 Bacteria 7057
197 Ga0395901_0382766 3300038443 Bacteria 1448
198 Ga0436365_0566650 3300039437 Bacteria 2534
199 Ga0436365_0950776 3300039437 Bacteria 5907
200 Ga0436360_1077194 3300039438 Bacteria 5445
201 Ga0436363_0572734 3300039450 Bacteria 4461
202 Ga0436363_0821722 3300039450 Bacteria 3529
203 Ga0436363_1544045 3300039450 Unclassified 1448
204 Ga0451577_0058862 3300042876 Bacteria 3426
205 Ga0453683_0103076 3300044673 Bacteria 1792
206 Ga0451576_0115163 3300045051 Unclassified 2799
207 Ga0466967_0045064 3300045976 Bacteria 3831
208 Ga0466967_0271826 3300045976 Bacteria 1624
209 Ga0495603_0019336 3300046455 Bacteria 4123
210 Ga0495651_0022217 3300046462 Plasmid 4932
211 Ga0495580_0085905 3300046472 Unclassified 2191
212 Ga0495594_0133967 3300046499 Bacteria 1404
213 Ga0495608_0032174 3300046511 Bacteria 3545
214 Ga0495652_0245103 3300046529 Unclassified 1331
215 Ga0495645_0071491 3300046543 Bacteria 2502
216 Ga0495667_0197723 3300046559 Bacteria 1287
217 Ga0495656_0002289 3300046615 Bacteria 6324
218 Ga0495659_0077898 3300046664 Bacteria 1253
219 Ga0495669_0003664 3300046684 Bacteria 6327
220 Ga0495674_0072329 3300047319 Bacteria 2974
221 Ga0495684_0087436 3300047471 Unclassified 2362
222 Ga0495684_0195636 3300047471 Bacteria 1493
223 Ga0496112_0034154 3300048915 Bacteria 4948
224 Ga0496113_0041211 3300048916 Bacteria 3406
225 Ga0501034_0479717 3300049571 Unclassified 1159
226 Ga0501039_0059982 3300049575 Bacteria 2946
227 Ga0501046_0185895 3300049580 Unclassified 1552
228 Ga0501069_0193964 3300049585 Unclassified 1176
229 Ga0501070_0449592 3300049586 Bacteria 1039
230 Ga0501072_0001275 3300049588 Bacteria 18814
231 Ga0501074_0201914 3300049590 Bacteria 1417
232 Ga0501075_0161873 3300049591 Bacteria 1707
233 Ga0501076_0097489 3300049592 Bacteria 2368
234 Ga0501045_0041024 3300049824 Bacteria 3367
235 nmdc:mga05p37_32306_c1 3300050507 Bacteria 6401
236 nmdc:mga05p37_95825_c1 3300050507 Unclassified 3656
237 nmdc:mga09592_186636_c1 3300050508 Bacteria 1794
238 nmdc:mga09592_1983_c1 3300050508 Bacteria 16505
239 nmdc:mga09592_9870_c1 3300050508 Bacteria 7763
240 nmdc:mga0qj67_141_c1 3300050509 Bacteria 48622
241 nmdc:mga0qj67_39284_c1 3300050509 Unclassified 3716
242 nmdc:mga0qj67_6609_c1 3300050509 Bacteria 8519
243 nmdc:mga06r32_383480_c1 3300050510 Bacteria 1388
244 nmdc:mga06r32_46521_c1 3300050510 Bacteria 4140
245 nmdc:mga06r32_9098_c1 3300050510 Bacteria 8953
246 nmdc:mga08y16_1771_c1 3300050511 Bacteria 21870
247 nmdc:mga08y16_192166_c1 3300050511 Bacteria 2117
248 nmdc:mga08y16_60822_c1 3300050511 Bacteria 3944
249 nmdc:mga0n895_140070_c1 3300050512 Bacteria 2447
250 nmdc:mga0n895_15508_c1 3300050512 Bacteria 6951
251 nmdc:mga0n895_252266_c1 3300050512 Unclassified 1791
252 nmdc:mga0n895_3955_c1 3300050512 Bacteria 12046
253 nmdc:mga0n895_4033_c1 3300050512 Bacteria 11946
254 nmdc:mga0rr50_106751_c1 3300050513 Bacteria 2210
255 nmdc:mga0rr50_21469_c1 3300050513 Bacteria 4409
256 nmdc:mga0rr50_42321_c1 3300050513 Unclassified 3326
257 nmdc:mga0rr50_4933_c1 3300050513 Bacteria 7899
258 nmdc:mga0rr50_78182_c1 3300050513 Bacteria 2545
259 nmdc:mga08x19_6300_c1 3300050514 Bacteria 7025
260 nmdc:mga0a205_123087_c1 3300050515 Unclassified 1908
261 nmdc:mga0a205_1418_c1 3300050515 Bacteria 20365
262 nmdc:mga0a205_15322_c1 3300050515 Bacteria 7164
263 nmdc:mga0a205_48319_c1 3300050515 Bacteria 4107
264 nmdc:mga0a205_50551_c1 3300050515 Bacteria 4013
265 nmdc:mga0a205_50581_c1 3300050515 Bacteria 4012
266 Ga0495601_0156894 3300053077 Unclassified 1486
267 Ga0495619_0022806 3300053085 Bacteria 4009
268 Ga0495619_0059674 3300053085 Unclassified 2535
269 Ga0495619_0106958 3300053085 Unclassified 1908
270 Ga0530510_0156822 3300061734 Bacteria 1683
271 Ga0070659_100245207
272 Ga0065707_10017869
273 Ga0070683_100432569
274 Ga0070680_100003847
275 Ga0070680_100055114
276 Ga0070692_10088855
277 Ga0070669_100073767
278 Ga0070671_100329850
279 Ga0070709_10073650
280 Ga0070714_100057535
281 Ga0070714_100165073
282 Ga0070713_100013556
283 Ga0070713_100132156
284 Ga0070713_100145782
285 Ga0070713_100232473
286 Ga0070710_10060702
287 Ga0070711_100009826
288 Ga0070705_100001892
289 Ga0070705_100181922
290 Ga0070708_100059320
291 Ga0070708_100111982
292 Ga0070681_10008527
293 Ga0070681_10082239
294 Ga0070681_10096399
295 Ga0070681_10137945
296 Ga0070706_100043657
297 Ga0070706_100060075
298 Ga0070706_100208769
299 Ga0070706_100237493
300 Ga0070707_100010436
301 Ga0070707_100042116
302 Ga0070698_100000828
303 Ga0070698_100260127
304 Ga0070699_100106746
305 Ga0070679_100001529
306 Ga0070679_100002248
307 Ga0070679_100014939
308 Ga0070679_100082065
309 Ga0070686_100089338
310 Ga0070696_100067669
311 Ga0070696_100158593
312 Ga0070704_100053683
313 Ga0068856_100044489
314 Ga0070702_100138095
315 Ga0068859_100277178
316 Ga0068863_100110316
317 Ga0068860_100102032
318 Ga0068860_100256129
319 Ga0068862_100341122
320 Ga0081455_10131414
321 Ga0081540_1063914
322 Ga0070717_10000510
323 Ga0070717_10031941
324 Ga0070717_10109500
325 Ga0070715_10118758
326 Ga0075428_100002883
327 Ga0075428_100018013
328 Ga0075428_100293043
329 Ga0075430_100000577
330 Ga0075430_100002200
331 Ga0075430_100081382
332 Ga0075431_100000847
333 Ga0075431_100002107
334 Ga0075431_100039345
335 Ga0075431_100048763
336 Ga0075431_100176473
337 Ga0075431_100307817
338 Ga0075433_10000934
339 Ga0075433_10031655
340 Ga0075433_10039142
341 Ga0075433_10196630
342 Ga0075434_100025364
343 Ga0075434_100028904
344 Ga0075434_100125001
345 Ga0075434_100165645
346 Ga0075429_100000485
347 Ga0075429_100006874
348 Ga0075429_100045520
349 Ga0075429_100058010
350 Ga0075429_100093599
351 Ga0075436_100110618
352 Ga0075436_100221431
353 Ga0097620_100277191
354 Ga0075435_100017155
355 Ga0075435_100020047
356 Ga0075435_100082841
357 Ga0075435_100117262
358 Ga0075435_100124765
359 Ga0099794_10052704
360 Ga0105240_10034521
361 Ga0111539_10001965
362 Ga0111539_10037451
363 Ga0105247_10172970
364 Ga0114129_10018133
365 Ga0114129_10027324
366 Ga0114129_10031995
367 Ga0114129_10237523
368 Ga0114129_10472193
369 Ga0105241_10154195
370 Ga0105248_10133849
371 Ga0105249_10136615
372 Ga0157370_10002352
373 Ga0157370_10019464
374 Ga0157370_10110057
375 Ga0157370_10155728
376 Ga0157369_10046609
377 Ga0157378_10212630
378 Ga0163162_10023969
379 Ga0163163_10268606
380 Ga0163163_10352260
381 Ga0182008_10012590
382 Ga0182008_10015401
383 Ga0182008_10019346
384 Ga0163161_10200467
385 Ga0213874_10036609
386 Ga0213875_10000552
387 Ga0213875_10068000
388 Ga0207685_10076778
389 Ga0207699_10111650
390 Ga0207684_10019913
391 Ga0207684_10021761
392 Ga0207684_10029089
393 Ga0207707_10078055
394 Ga0207707_10155440
395 Ga0207707_10333940
396 Ga0207693_10002201
397 Ga0207693_10017877
398 Ga0207693_10036091
399 Ga0207693_10174247
400 Ga0207663_10040142
401 Ga0207663_10040395
402 Ga0207660_10020032
403 Ga0207660_10235667
404 Ga0207657_10121336
405 Ga0207652_10004204
406 Ga0207652_10006691
407 Ga0207652_10304253
408 Ga0207646_10006273
409 Ga0207646_10014619
410 Ga0207646_10073261
411 Ga0207646_10095765
412 Ga0207700_10011727
413 Ga0207700_10062400
414 Ga0207664_10011181
415 Ga0207664_10133293
416 Ga0207664_10291645
417 Ga0207706_10019719
418 Ga0207709_10066020
419 Ga0207691_10005919
420 Ga0207711_10031622
421 Ga0207661_10131567
422 Ga0207679_10386989
423 Ga0207658_10268994
424 Ga0207702_10011383
425 Ga0207641_10038460
426 Ga0207648_10124373
427 Ga0207675_100315382
428 Ga0207428_10001047
429 Ga0207428_10134477
430 Ga0307408_100026281
431 Ga0265313_10088991
432 Ga0307412_10060606
433 Ga0307416_100155930
434 Ga0373940_0007599
435 Ga0373940_0024795
436 Ga0373944_0012704
437 Ga0373944_0063078
438 Ga0373923_0018188
439 Ga0373943_0135497
440 Ga0373955_0016073
441 Ga0373962_0037763
442 Ga0373924_0085594
443 Ga0373931_0006064
444 Ga0373931_0008725
445 Ga0373927_0036667
446 Ga0373927_0041409
447 Ga0373933_0030529
448 Ga0373933_0060856
449 Ga0373933_0064770
450 Ga0373933_0091831
451 Ga0373947_0022742
452 Ga0373937_0001288
453 Ga0373937_0009252
454 Ga0373937_0022108
455 Ga0373937_0091704
456 Ga0373937_0115329
457 Ga0373937_0140120
458 Ga0373937_0392467
459 Ga0373925_0099774
460 Ga0395900_0123600
461 Ga0395900_0291663
462 Ga0395898_0022462
463 Ga0436364_0499586
464 Ga0436364_0827620
465 Ga0436364_1284200
466 Ga0395901_0018831
467 Ga0395901_0382766
468 Ga0436365_0566650
469 Ga0436365_0950776
470 Ga0436360_1077194
471 Ga0436363_0572734
472 Ga0436363_0821722
473 Ga0436363_1544045
474 Ga0451577_0058862
475 Ga0453683_0103076
476 Ga0451576_0115163
477 Ga0466967_0045064
478 Ga0466967_0271826
479 Ga0495603_0019336
480 Ga0495651_0022217
481 Ga0495580_0085905
482 Ga0495594_0133967
483 Ga0495608_0032174
484 Ga0495652_0245103
485 Ga0495645_0071491
486 Ga0495667_0197723
487 Ga0495656_0002289
488 Ga0495659_0077898
489 Ga0495669_0003664
490 Ga0495674_0072329
491 Ga0495684_0087436
492 Ga0495684_0195636
493 Ga0496112_0034154
494 Ga0496113_0041211
495 Ga0501034_0479717
496 Ga0501039_0059982
497 Ga0501046_0185895
498 Ga0501069_0193964
499 Ga0501070_0449592
500 Ga0501072_0001275
501 Ga0501074_0201914
502 Ga0501075_0161873
503 Ga0501076_0097489
504 Ga0501045_0041024
505 nmdc:mga05p37_32306_c1
506 nmdc:mga05p37_95825_c1
507 nmdc:mga09592_186636_c1
508 nmdc:mga09592_1983_c1
509 nmdc:mga09592_9870_c1
510 nmdc:mga0qj67_141_c1
511 nmdc:mga0qj67_39284_c1
512 nmdc:mga0qj67_6609_c1
513 nmdc:mga06r32_383480_c1
514 nmdc:mga06r32_46521_c1
515 nmdc:mga06r32_9098_c1
516 nmdc:mga08y16_1771_c1
517 nmdc:mga08y16_192166_c1
518 nmdc:mga08y16_60822_c1
519 nmdc:mga0n895_140070_c1
520 nmdc:mga0n895_15508_c1
521 nmdc:mga0n895_252266_c1
522 nmdc:mga0n895_3955_c1
523 nmdc:mga0n895_4033_c1
524 nmdc:mga0rr50_106751_c1
525 nmdc:mga0rr50_21469_c1
526 nmdc:mga0rr50_42321_c1
527 nmdc:mga0rr50_4933_c1
528 nmdc:mga0rr50_78182_c1
529 nmdc:mga08x19_6300_c1
530 nmdc:mga0a205_123087_c1
531 nmdc:mga0a205_1418_c1
532 nmdc:mga0a205_15322_c1
533 nmdc:mga0a205_48319_c1
534 nmdc:mga0a205_50551_c1
535 nmdc:mga0a205_50581_c1
536 Ga0495601_0156894
537 Ga0495619_0022806
538 Ga0495619_0059674
539 Ga0495619_0106958
540 Ga0530510_0156822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

14

329

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1luc-assembly1.cif.gz_A bacterial luciferase 0.8488 1 352
1luc-assembly1.cif.gz_A bacterial luciferase 0.8318 1 352
1xkj-assembly1.cif.gz_B bacterial luciferase beta2 homodimer 0.8178 1 347
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8134 1 352
7k64-assembly1.cif.gz_D binary titrated soak structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens with fmn 0.8062 1 352
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8056 1 356 3.20.20.30
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.798 1 347 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7859 1 354 3.20.20.30
6friA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7834 1 349 3.20.20.30
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7833 2 353 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2E6PNN8-F1-model_v4 Luciferase-like domain-containing protein 0.918 1 357 GO:0004497
GO:0005829
GO:0016705
AF-A0A2E6PNN8-F1-model_v4 Luciferase-like domain-containing protein 0.9155 1 357 GO:0004497
GO:0005829
GO:0016705
AF-A0A3C0TSD8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9042 1 240 GO:0005829
GO:0016705
AF-A0A496XBL4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9041 1 177 GO:0004497
GO:0005829
GO:0016705
AF-A0A7C3NTJ8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.8999 1 218 GO:0004497
GO:0005829
GO:0016705

Map