F376673

General Info

Members Datasets Scaffolds Average Seq Length
270 203 268 119

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1001016|Ga0065165_100101643
Length 144
Sequence LVGNIVARSGVSYNAAAEAARMREEPVLPNIIYGIKNCDTMKKARAWLDTHGVAYEFHDYKAAGVEKDKLKQWSDKVGWETLLNRAGTTFKKLPDSDKEGLTEKKALALMLAQPSMIKRPVLETGSKLLVGFKPDIYAKDVKTK

Samples

Sample ID Description Type Environment
1 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
2 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
108 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
111 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
121 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
122 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
188 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
192 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
193 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0.37
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.48
Nodule 2.59
Rhizoplane 1.85
Rhizosphere 65.19
Stem 0
Stem Tuber 0
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000050 3300002704 Bacteria 76996
2 JGI25156J39149_1000074 3300002705 Bacteria 76996
3 JGI25154J39366_1000099 3300002738 Bacteria 76996
4 JGI25157J39369_1000090 3300002741 Bacteria 76996
5 JGI25159J45721_1000964 3300002987 Bacteria 12521
6 JGI25151J46595_10000278 3300003187 Bacteria 58449
7 JGI25153J46596_10077152 3300003215 Bacteria 842
8 rootH1_10011701 3300003323 Bacteria 3404
9 JGI25160J50197_1000012 3300003354 Bacteria 267582
10 JGI25161J50226_1000002 3300003374 Bacteria 420324
11 Ga0055526_1000981 3300003771 Bacteria 20991
12 Ga0055528_1000553 3300003790 Bacteria 28554
13 Ga0055531_10007547 3300003794 Bacteria 5907
14 Ga0058692_1058851 3300003856 Bacteria 612
15 Ga0055543_1000011 3300004625 Bacteria 196089
16 Ga0058861_11411790 3300004800 Bacteria 700
17 Ga0065165_1000082 3300005262 Bacteria 158536
18 Ga0065165_1001016 3300005262 Bacteria 34080
19 Ga0065165_1005603 3300005262 Bacteria 6960
20 Ga0070658_10921999 3300005327 Bacteria 759
21 Ga0070677_10649994 3300005333 Bacteria 589
22 Ga0070680_100000201 3300005336 Bacteria 38933
23 Ga0070680_100061854 3300005336 Bacteria 3065
24 Ga0070680_101504603 3300005336 Bacteria 583
25 Ga0070682_100878464 3300005337 Bacteria 735
26 Ga0070660_100019973 3300005339 Bacteria 4916
27 Ga0070668_100008462 3300005347 Bacteria 7641
28 Ga0070668_100491546 3300005347 Bacteria 1061
29 Ga0070669_100004577 3300005353 Bacteria 9985
30 Ga0070671_100005679 3300005355 Bacteria 9931
31 Ga0070705_100588234 3300005440 Bacteria 859
32 Ga0070663_101015269 3300005455 Bacteria 722
33 Ga0070681_10000005 3300005458 Bacteria 183053
34 Ga0070681_10006827 3300005458 Bacteria 11113
35 Ga0070681_11055625 3300005458 Bacteria 733
36 Ga0070679_100000293 3300005530 Bacteria 42433
37 Ga0070679_100214118 3300005530 Bacteria 1889
38 Ga0068853_101463965 3300005539 Bacteria 661
39 Ga0070693_100192867 3300005547 Bacteria 1319
40 Ga0070665_100243508 3300005548 Bacteria 1799
41 Ga0068855_100364315 3300005563 Bacteria 1590
42 Ga0068855_100854887 3300005563 Bacteria 964
43 Ga0070664_100641094 3300005564 Bacteria 987
44 Ga0068857_100043508 3300005577 Bacteria 3983
45 Ga0068854_100531622 3300005578 Bacteria 995
46 Ga0068856_100038242 3300005614 Bacteria 4710
47 Ga0068856_100311798 3300005614 Bacteria 1591
48 Ga0070702_100108254 3300005615 Bacteria 1718
49 Ga0068852_100168774 3300005616 Bacteria 2049
50 Ga0068859_100007799 3300005617 Bacteria 10865
51 Ga0068863_100008117 3300005841 Bacteria 10248
52 Ga0068863_100413741 3300005841 Bacteria 1320
53 Ga0068858_100000521 3300005842 Bacteria 40362
54 Ga0068858_100017455 3300005842 Bacteria 6732
55 Ga0068862_100072466 3300005844 Bacteria 2976
56 Ga0081455_10001191 3300005937 Bacteria 32585
57 Ga0081455_10007694 3300005937 Bacteria 11311
58 Ga0081540_1004971 3300005983 Bacteria 9998
59 Ga0081540_1047026 3300005983 Bacteria 2174
60 Ga0081540_1049100 3300005983 Bacteria 2108
61 Ga0070717_10247136 3300006028 Bacteria 1575
62 Ga0075365_10021417 3300006038 Bacteria 4033
63 Ga0075363_100183905 3300006048 Bacteria 1190
64 Ga0075364_10625284 3300006051 Bacteria 736
65 Ga0075362_10009275 3300006177 Bacteria 3799
66 Ga0075369_10018076 3300006186 Bacteria 2867
67 Ga0068871_100110999 3300006358 Bacteria 2306
68 Ga0075428_100158759 3300006844 Bacteria 2455
69 Ga0075431_100151103 3300006847 Bacteria 2391
70 Ga0075431_100713247 3300006847 Bacteria 980
71 Ga0097620_100007799 3300006931 Bacteria 10865
72 Ga0099824_1026214 3300006942 Bacteria 3043
73 Ga0079104_1000033 3300006946 Bacteria 202636
74 Ga0105240_10654947 3300009093 Bacteria 1151
75 Ga0105247_10463794 3300009101 Bacteria 916
76 Ga0105247_10464397 3300009101 Bacteria 915
77 Ga0105247_11196307 3300009101 Bacteria 605
78 Ga0105241_10923455 3300009174 Bacteria 812
79 Ga0105248_10001938 3300009177 Bacteria 22994
80 Ga0105248_10084057 3300009177 Bacteria 3580
81 Ga0105237_10827231 3300009545 Bacteria 933
82 Ga0105237_10916909 3300009545 Bacteria 883
83 Ga0105238_10010958 3300009551 Bacteria 9118
84 Ga0105238_11979548 3300009551 Bacteria 616
85 Ga0105239_10020394 3300010375 Bacteria 7311
86 Ga0105239_10051580 3300010375 Bacteria 4510
87 Ga0105239_10348509 3300010375 Bacteria 1672
88 Ga0105239_10409853 3300010375 Bacteria 1535
89 Ga0105239_11295647 3300010375 Bacteria 840
90 Ga0157370_10733848 3300013104 Bacteria 900
91 Ga0157378_10773979 3300013297 Bacteria 984
92 Ga0157378_12950969 3300013297 Bacteria 528
93 Ga0163162_10143124 3300013306 Bacteria 2505
94 Ga0163162_10551729 3300013306 Bacteria 1280
95 Ga0157372_10038199 3300013307 Bacteria 5298
96 Ga0163163_10003025 3300014325 Bacteria 14246
97 Ga0157379_10000909 3300014968 Bacteria 23893
98 Ga0157376_10199021 3300014969 Bacteria 1842
99 Ga0209435_100063 3300025206 Bacteria 77066
100 Ga0209436_109634 3300025208 Bacteria 1823
101 Ga0209563_100864 3300025230 Bacteria 9008
102 Ga0207425_1009759 3300025245 Bacteria 2372
103 Ga0209646_1000187 3300025246 Bacteria 77066
104 Ga0209026_1000227 3300025250 Bacteria 77066
105 Ga0209677_117635 3300025253 Bacteria 885
106 Ga0209759_1000258 3300025256 Bacteria 77066
107 Ga0209129_1017065 3300025258 Bacteria 1436
108 Ga0209673_1000135 3300025273 Bacteria 160333
109 Ga0209130_1000028 3300025284 Bacteria 325668
110 Ga0209675_1073117 3300025291 Bacteria 649
111 Ga0209025_1000921 3300025294 Bacteria 45037
112 Ga0209564_1000138 3300025295 Bacteria 181512
113 Ga0209564_1026321 3300025295 Bacteria 1926
114 Ga0209758_1001165 3300025297 Bacteria 33420
115 Ga0209758_1030251 3300025297 Bacteria 2246
116 Ga0209758_1031292 3300025297 Bacteria 2185
117 Ga0209050_1022939 3300025298 Bacteria 2216
118 Ga0209256_1000664 3300025299 Bacteria 46510
119 Ga0207426_1000012 3300025302 Bacteria 730942
120 Ga0207426_1000822 3300025302 Bacteria 33249
121 Ga0207707_10000005 3300025912 Bacteria 382024
122 Ga0207707_10309475 3300025912 Bacteria 1365
123 Ga0207695_10503219 3300025913 Bacteria 1093
124 Ga0207671_10595308 3300025914 Bacteria 881
125 Ga0207660_10000507 3300025917 Bacteria 26030
126 Ga0207660_10942955 3300025917 Bacteria 704
127 Ga0207657_10028693 3300025919 Bacteria 5072
128 Ga0207652_10000320 3300025921 Bacteria 49730
129 Ga0207652_10153361 3300025921 Bacteria 2063
130 Ga0207694_10000005 3300025924 Bacteria 823704
131 Ga0207687_10257790 3300025927 Bacteria 1389
132 Ga0207661_10312931 3300025944 Bacteria 1410
133 Ga0207668_10398494 3300025972 Bacteria 1163
134 Ga0207640_10432843 3300025981 Bacteria 1079
135 Ga0207639_10459049 3300026041 Bacteria 1158
136 Ga0207639_11382597 3300026041 Bacteria 661
137 Ga0207702_10023507 3300026078 Bacteria 5113
138 Ga0207674_10056152 3300026116 Bacteria 4000
139 Ga0207698_10032224 3300026142 Bacteria 3794
140 Ga0207698_10270455 3300026142 Bacteria 1566
141 Ga0209281_1000043 3300027111 Bacteria 341543
142 Ga0209389_1000061 3300027296 Bacteria 105698
143 Ga0209371_1002698 3300027312 Bacteria 9592
144 Ga0209589_1000465 3300027357 Bacteria 56891
145 Ga0209489_100006 3300027361 Bacteria 475698
146 Ga0265318_10120178 3300028577 Bacteria 966
147 Ga0307508_10001175 3300031616 Bacteria 30125
148 Ga0307508_10050491 3300031616 Bacteria 3702
149 Ga0307508_10376688 3300031616 Bacteria 1010
150 Ga0265314_10122126 3300031711 Bacteria 1638
151 Ga0307516_10049073 3300031730 Bacteria 4151
152 Ga0395900_0444841 3300037418 Bacteria 1253
153 Ga0395898_0328632 3300037466 Bacteria 1458
154 Ga0395901_0457699 3300038443 Bacteria 1304
155 Ga0395901_0677420 3300038443 Bacteria 1031
156 Ga0439465_0000684 3300041413 Bacteria 10381
157 Ga0439465_0029658 3300041413 Bacteria 1739
158 Ga0439465_0269814 3300041413 Bacteria 632
159 Ga0451804_0295140 3300041463 Bacteria 692
160 Ga0451841_1358064 3300041498 Bacteria 1117
161 Ga0451851_0859542 3300041507 Bacteria 657
162 Ga0451843_0377419 3300041509 Bacteria 1810
163 Ga0451853_0636044 3300041512 Bacteria 1548
164 Ga0439450_004898 3300042008 Bacteria 2320
165 Ga0439464_0123680 3300042439 Bacteria 798
166 Ga0439440_0074281 3300042993 Bacteria 890
167 Ga0466965_0316509 3300044683 Bacteria 849
168 Ga0466963_0002603 3300044694 Bacteria 10121
169 Ga0466963_0778837 3300044694 Bacteria 675
170 Ga0466970_0001637 3300044765 Bacteria 10773
171 Ga0466957_0017766 3300044842 Bacteria 4172
172 Ga0466960_0125932 3300044901 Bacteria 1347
173 Ga0466960_0176074 3300044901 Bacteria 1157
174 Ga0466958_0042884 3300045836 Bacteria 2724
175 Ga0495664_0906912 3300046477 Bacteria 515
176 Ga0495596_0085552 3300046500 Bacteria 1224
177 Ga0495596_0145214 3300046500 Bacteria 922
178 Ga0495606_0064343 3300046507 Bacteria 2334
179 Ga0495606_0071212 3300046507 Bacteria 2190
180 Ga0495606_0101824 3300046507 Bacteria 1747
181 Ga0495648_0035528 3300046524 Bacteria 3230
182 Ga0495667_0744694 3300046559 Bacteria 606
183 Ga0495625_0000093 3300046660 Bacteria 145874
184 Ga0495681_0039347 3300047470 Bacteria 2310
185 Ga0495681_0277826 3300047470 Bacteria 654
186 Ga0495686_0254024 3300047472 Bacteria 987
187 Ga0496101_0168002 3300048904 Bacteria 1685
188 Ga0496110_1376720 3300048913 Bacteria 615
189 Ga0496114_0104442 3300048917 Bacteria 2422
190 Ga0496114_0691740 3300048917 Bacteria 895
191 Ga0496117_0387264 3300048920 Bacteria 710
192 Ga0496119_0272628 3300048922 Bacteria 844
193 Ga0496120_0269079 3300048923 Bacteria 792
194 Ga0496121_0023457 3300048924 Bacteria 5941
195 Ga0496121_0398083 3300048924 Bacteria 903
196 Ga0496123_0028662 3300048926 Bacteria 4116
197 Ga0495682_0002019 3300049460 Bacteria 10017
198 Ga0501031_0001421 3300049568 Bacteria 14827
199 Ga0501032_0000129 3300049569 Bacteria 62082
200 Ga0501032_0875567 3300049569 Bacteria 566
201 Ga0501033_0001179 3300049570 Bacteria 23588
202 Ga0501034_0000503 3300049571 Bacteria 63099
203 Ga0501036_0001453 3300049572 Bacteria 18220
204 Ga0501037_0000106 3300049573 Bacteria 79430
205 Ga0501038_0001655 3300049574 Bacteria 20704
206 Ga0501038_0676886 3300049574 Bacteria 775
207 Ga0501039_0000416 3300049575 Bacteria 30616
208 Ga0501040_0947323 3300049576 Bacteria 624
209 Ga0501042_0203818 3300049578 Bacteria 1426
210 Ga0501043_0005698 3300049579 Bacteria 10037
211 Ga0501046_0000235 3300049580 Bacteria 57005
212 Ga0501046_0129190 3300049580 Bacteria 1917
213 Ga0501047_0000844 3300049581 Bacteria 31650
214 Ga0501047_0344815 3300049581 Bacteria 1327
215 Ga0501047_0435030 3300049581 Bacteria 1142
216 Ga0501048_0001444 3300049582 Bacteria 18038
217 Ga0501067_0000160 3300049583 Bacteria 37883
218 Ga0501068_0000014 3300049584 Bacteria 62762
219 Ga0501068_0232899 3300049584 Bacteria 1171
220 Ga0501069_0002087 3300049585 Bacteria 10059
221 Ga0501070_0009747 3300049586 Bacteria 8123
222 Ga0501070_0417902 3300049586 Bacteria 1083
223 Ga0501071_0028316 3300049587 Bacteria 3948
224 Ga0501072_0001159 3300049588 Bacteria 19618
225 Ga0501073_0002573 3300049589 Bacteria 13565
226 Ga0501074_0000596 3300049590 Bacteria 22464
227 Ga0501076_0163328 3300049592 Bacteria 1815
228 Ga0501076_0808290 3300049592 Bacteria 774
229 Ga0501077_0073296 3300049593 Bacteria 2169
230 Ga0501079_0004541 3300049741 Bacteria 10295
231 Ga0501080_0000917 3300049742 Bacteria 24141
232 Ga0501080_0646138 3300049742 Bacteria 936
233 Ga0501081_0024893 3300049743 Bacteria 4023
234 Ga0501083_0014219 3300049744 Bacteria 5567
235 Ga0501083_0380831 3300049744 Bacteria 917
236 Ga0501035_0000324 3300049822 Bacteria 55297
237 Ga0501044_0000051 3300049823 Bacteria 143658
238 Ga0501044_0705694 3300049823 Bacteria 894
239 Ga0501045_0033060 3300049824 Bacteria 3750
240 nmdc:mga08y16_994999_c1 3300050511 Bacteria 819
241 nmdc:mga0n895_410687_c1 3300050512 Bacteria 1369
242 nmdc:mga0a205_1209214_c1 3300050515 Bacteria 603
243 Ga0500578_0026059 3300053086 Bacteria 3752
244 Ga0500643_012968 3300053087 Bacteria 2965
245 Ga0500647_0048882 3300053091 Bacteria 2033
246 Ga0500566_0000246 3300053094 Bacteria 28960
247 Ga0500566_0166399 3300053094 Bacteria 1144
248 Ga0500641_0000725 3300053096 Bacteria 11932
249 Ga0500556_0001491 3300053104 Bacteria 9717
250 Ga0500556_0148088 3300053104 Bacteria 924
251 Ga0500557_000004 3300053105 Bacteria 202318
252 Ga0500557_054705 3300053105 Bacteria 1286
253 Ga0500562_000749 3300053108 Bacteria 7894
254 Ga0500569_104399 3300053109 Bacteria 931
255 Ga0500595_007399 3300053119 Bacteria 4557
256 Ga0500608_102699 3300053122 Bacteria 1322
257 Ga0500626_116362 3300053128 Bacteria 1149
258 Ga0500642_0000173 3300053130 Bacteria 26732
259 Ga0500616_0064433 3300053153 Bacteria 1887
260 Ga0500616_0099896 3300053153 Bacteria 1420
261 Ga0500616_0102397 3300053153 Bacteria 1397
262 Ga0500636_0102718 3300053177 Bacteria 1623
263 Ga0500625_173911 3300053729 Bacteria 767
264 Ga0500645_000141 3300053730 Bacteria 56609
265 Ga0500645_000740 3300053730 Bacteria 20071
266 Ga0501084_0056545 3300054114 Bacteria 3282
267 Ga0501084_0700380 3300054114 Bacteria 854
268 Ga0501082_0125661 3300060353 Bacteria 2224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005440 Ga0070705_100588234 Ga0070705_1005882342 114
2 3300005458 Ga0070681_11055625 Ga0070681_110556251 114
3 3300006847 Ga0075431_100151103 Ga0075431_1001511033 114
4 3300050511 nmdc:mga08y16_994999_c1 nmdc:mga08y16_994999_c1_35_559 114
5 3300003856 Ga0058692_1058851 Ga0058692_10588511 115
6 3300005336 Ga0070680_101504603 Ga0070680_1015046032 115
7 3300005347 Ga0070668_100008462 Ga0070668_1000084627 115
8 3300005353 Ga0070669_100004577 Ga0070669_1000045778 115
9 3300005355 Ga0070671_100005679 Ga0070671_1000056794 115
10 3300005548 Ga0070665_100243508 Ga0070665_1002435083 115
11 3300005563 Ga0068855_100364315 Ga0068855_1003643152 115
12 3300005564 Ga0070664_100641094 Ga0070664_1006410942 115
13 3300005577 Ga0068857_100043508 Ga0068857_1000435085 115
14 3300005614 Ga0068856_100311798 Ga0068856_1003117982 115
15 3300005615 Ga0070702_100108254 Ga0070702_1001082543 115
16 3300005617 Ga0068859_100007799 Ga0068859_1000077993 115
17 3300005841 Ga0068863_100008117 Ga0068863_1000081177 115
18 3300005841 Ga0068863_100413741 Ga0068863_1004137412 115
19 3300005842 Ga0068858_100017455 Ga0068858_1000174556 115
20 3300005844 Ga0068862_100072466 Ga0068862_1000724663 115
21 3300005937 Ga0081455_10001191 Ga0081455_1000119121 115
22 3300006038 Ga0075365_10021417 Ga0075365_100214172 115
23 3300006048 Ga0075363_100183905 Ga0075363_1001839052 115
24 3300006177 Ga0075362_10009275 Ga0075362_100092755 115
25 3300006186 Ga0075369_10018076 Ga0075369_100180764 115
26 3300006358 Ga0068871_100110999 Ga0068871_1001109991 115
27 3300006847 Ga0075431_100713247 Ga0075431_1007132472 115
28 3300006931 Ga0097620_100007799 Ga0097620_1000077993 115
29 3300009101 Ga0105247_10464397 Ga0105247_104643972 115
30 3300009174 Ga0105241_10923455 Ga0105241_109234552 115
31 3300009177 Ga0105248_10001938 Ga0105248_1000193818 115
32 3300009177 Ga0105248_10084057 Ga0105248_100840573 115
33 3300013297 Ga0157378_10773979 Ga0157378_107739792 115
34 3300013297 Ga0157378_12950969 Ga0157378_129509692 115
35 3300014325 Ga0163163_10003025 Ga0163163_100030253 115
36 3300014968 Ga0157379_10000909 Ga0157379_100009094 115
37 3300014969 Ga0157376_10199021 Ga0157376_101990212 115
38 3300025944 Ga0207661_10312931 Ga0207661_103129312 115
39 3300026116 Ga0207674_10056152 Ga0207674_100561523 115
40 3300031616 Ga0307508_10050491 Ga0307508_100504913 115
41 3300037418 Ga0395900_0444841 Ga0395900_0444841_384_737 115
42 3300037466 Ga0395898_0328632 Ga0395898_0328632_768_1121 115
43 3300038443 Ga0395901_0677420 Ga0395901_0677420_249_602 115
44 3300042008 Ga0439450_004898 Ga0439450_004898_403_753 115
45 3300042439 Ga0439464_0123680 Ga0439464_0123680_270_620 115
46 3300042993 Ga0439440_0074281 Ga0439440_0074281_255_605 115
47 3300046660 Ga0495625_0000093 Ga0495625_0000093_32089_32439 115
48 3300048917 Ga0496114_0691740 Ga0496114_0691740_253_630 115
49 3300049592 Ga0501076_0163328 Ga0501076_0163328_1061_1411 115
50 3300049593 Ga0501077_0073296 Ga0501077_0073296_589_939 115
51 3300049742 Ga0501080_0646138 Ga0501080_0646138_538_888 115
52 3300049743 Ga0501081_0024893 Ga0501081_0024893_1222_1572 115
53 3300053153 Ga0500616_0102397 Ga0500616_0102397_452_802 115
54 3300054114 Ga0501084_0700380 Ga0501084_0700380_409_759 115
55 3300003187 JGI25151J46595_10000278 JGI25151J46595_1000027842 116
56 3300003215 JGI25153J46596_10077152 JGI25153J46596_100771521 116
57 3300003771 Ga0055526_1000981 Ga0055526_10009819 116
58 3300003790 Ga0055528_1000553 Ga0055528_100055311 116
59 3300004800 Ga0058861_11411790 Ga0058861_114117901 116
60 3300005333 Ga0070677_10649994 Ga0070677_106499941 116
61 3300005336 Ga0070680_100000201 Ga0070680_10000020117 116
62 3300005458 Ga0070681_10000005 Ga0070681_10000005111 116
63 3300005530 Ga0070679_100000293 Ga0070679_10000029330 116
64 3300005842 Ga0068858_100000521 Ga0068858_10000052111 116
65 3300009093 Ga0105240_10654947 Ga0105240_106549472 116
66 3300009101 Ga0105247_11196307 Ga0105247_111963072 116
67 3300009545 Ga0105237_10916909 Ga0105237_109169092 116
68 3300009551 Ga0105238_11979548 Ga0105238_119795482 116
69 3300010375 Ga0105239_10051580 Ga0105239_100515804 116
70 3300013306 Ga0163162_10143124 Ga0163162_101431242 116
71 3300013306 Ga0163162_10551729 Ga0163162_105517293 116
72 3300025245 Ga0207425_1009759 Ga0207425_10097592 116
73 3300025258 Ga0209129_1017065 Ga0209129_10170652 116
74 3300025273 Ga0209673_1000135 Ga0209673_100013566 116
75 3300025291 Ga0209675_1073117 Ga0209675_10731172 116
76 3300025294 Ga0209025_1000921 Ga0209025_10009213 116
77 3300025295 Ga0209564_1000138 Ga0209564_100013848 116
78 3300025297 Ga0209758_1001165 Ga0209758_10011652 116
79 3300025297 Ga0209758_1031292 Ga0209758_10312922 116
80 3300025299 Ga0209256_1000664 Ga0209256_100066440 116
81 3300025912 Ga0207707_10000005 Ga0207707_10000005268 116
82 3300025913 Ga0207695_10503219 Ga0207695_105032192 116
83 3300025914 Ga0207671_10595308 Ga0207671_105953082 116
84 3300025917 Ga0207660_10000507 Ga0207660_100005073 116
85 3300025921 Ga0207652_10000320 Ga0207652_1000032023 116
86 3300031616 Ga0307508_10001175 Ga0307508_1000117514 116
87 3300031616 Ga0307508_10376688 Ga0307508_103766882 116
88 3300041413 Ga0439465_0000684 Ga0439465_0000684_8412_8762 116
89 3300041413 Ga0439465_0269814 Ga0439465_0269814_35_385 116
90 3300041463 Ga0451804_0295140 Ga0451804_0295140_322_675 116
91 3300041498 Ga0451841_1358064 Ga0451841_1358064_713_1063 116
92 3300041507 Ga0451851_0859542 Ga0451851_0859542_92_442 116
93 3300041509 Ga0451843_0377419 Ga0451843_0377419_1097_1447 116
94 3300041512 Ga0451853_0636044 Ga0451853_0636044_1182_1532 116
95 3300046477 Ga0495664_0906912 Ga0495664_0906912_10_360 116
96 3300046500 Ga0495596_0085552 Ga0495596_0085552_402_752 116
97 3300046507 Ga0495606_0064343 Ga0495606_0064343_580_930 116
98 3300046507 Ga0495606_0101824 Ga0495606_0101824_10_360 116
99 3300046524 Ga0495648_0035528 Ga0495648_0035528_626_976 116
100 3300047470 Ga0495681_0039347 Ga0495681_0039347_372_722 116
101 3300048904 Ga0496101_0168002 Ga0496101_0168002_558_908 116
102 3300048913 Ga0496110_1376720 Ga0496110_1376720_47_397 116
103 3300048917 Ga0496114_0104442 Ga0496114_0104442_269_619 116
104 3300048924 Ga0496121_0398083 Ga0496121_0398083_86_436 116
105 3300048926 Ga0496123_0028662 Ga0496123_0028662_1691_2074 116
106 3300049569 Ga0501032_0875567 Ga0501032_0875567_149_499 116
107 3300049576 Ga0501040_0947323 Ga0501040_0947323_208_558 116
108 3300049580 Ga0501046_0129190 Ga0501046_0129190_1189_1539 116
109 3300049584 Ga0501068_0232899 Ga0501068_0232899_424_774 116
110 3300049744 Ga0501083_0380831 Ga0501083_0380831_375_725 116
111 3300049823 Ga0501044_0705694 Ga0501044_0705694_163_513 116
112 3300053086 Ga0500578_0026059 Ga0500578_0026059_1593_1943 116
113 3300053087 Ga0500643_012968 Ga0500643_012968_965_1321 116
114 3300053096 Ga0500641_0000725 Ga0500641_0000725_6532_6888 116
115 3300053104 Ga0500556_0001491 Ga0500556_0001491_5918_6274 116
116 3300053104 Ga0500556_0148088 Ga0500556_0148088_253_609 116
117 3300053105 Ga0500557_054705 Ga0500557_054705_148_504 116
118 3300053108 Ga0500562_000749 Ga0500562_000749_4936_5292 116
119 3300053109 Ga0500569_104399 Ga0500569_104399_563_913 116
120 3300053122 Ga0500608_102699 Ga0500608_102699_450_800 116
121 3300053153 Ga0500616_0064433 Ga0500616_0064433_1082_1438 116
122 3300053153 Ga0500616_0099896 Ga0500616_0099896_34_390 116
123 3300053177 Ga0500636_0102718 Ga0500636_0102718_476_826 116
124 3300053730 Ga0500645_000141 Ga0500645_000141_5983_6339 116
125 3300053730 Ga0500645_000740 Ga0500645_000740_13437_13793 116
126 3300003794 Ga0055531_10007547 Ga0055531_100075477 117
127 3300005262 Ga0065165_1001016 Ga0065165_100101643 117
128 3300005262 Ga0065165_1005603 Ga0065165_10056033 117
129 3300005327 Ga0070658_10921999 Ga0070658_109219991 117
130 3300005547 Ga0070693_100192867 Ga0070693_1001928671 117
131 3300005578 Ga0068854_100531622 Ga0068854_1005316222 117
132 3300005616 Ga0068852_100168774 Ga0068852_1001687744 117
133 3300005983 Ga0081540_1049100 Ga0081540_10491003 117
134 3300006946 Ga0079104_1000033 Ga0079104_100003330 117
135 3300009551 Ga0105238_10010958 Ga0105238_1001095810 117
136 3300010375 Ga0105239_10020394 Ga0105239_100203947 117
137 3300010375 Ga0105239_11295647 Ga0105239_112956472 117
138 3300025230 Ga0209563_100864 Ga0209563_1008647 117
139 3300025253 Ga0209677_117635 Ga0209677_1176352 117
140 3300025295 Ga0209564_1026321 Ga0209564_10263212 117
141 3300025297 Ga0209758_1030251 Ga0209758_10302514 117
142 3300025302 Ga0207426_1000822 Ga0207426_100082234 117
143 3300025924 Ga0207694_10000005 Ga0207694_10000005671 117
144 3300025981 Ga0207640_10432843 Ga0207640_104328432 117
145 3300026041 Ga0207639_10459049 Ga0207639_104590492 117
146 3300026142 Ga0207698_10032224 Ga0207698_100322244 117
147 3300026142 Ga0207698_10270455 Ga0207698_102704553 117
148 3300027111 Ga0209281_1000043 Ga0209281_1000043168 117
149 3300028577 Ga0265318_10120178 Ga0265318_101201782 117
150 3300031711 Ga0265314_10122126 Ga0265314_101221262 117
151 3300031730 Ga0307516_10049073 Ga0307516_100490734 117
152 3300044683 Ga0466965_0316509 Ga0466965_0316509_427_780 117
153 3300044694 Ga0466963_0002603 Ga0466963_0002603_1377_1730 117
154 3300044765 Ga0466970_0001637 Ga0466970_0001637_1851_2204 117
155 3300044842 Ga0466957_0017766 Ga0466957_0017766_1807_2160 117
156 3300044901 Ga0466960_0176074 Ga0466960_0176074_570_923 117
157 3300045836 Ga0466958_0042884 Ga0466958_0042884_1701_2054 117
158 3300046500 Ga0495596_0145214 Ga0495596_0145214_72_425 117
159 3300047472 Ga0495686_0254024 Ga0495686_0254024_403_774 117
160 3300049460 Ga0495682_0002019 Ga0495682_0002019_7587_7946 117
161 3300053091 Ga0500647_0048882 Ga0500647_0048882_538_891 117
162 3300053105 Ga0500557_000004 Ga0500557_000004_181395_181748 117
163 3300053119 Ga0500595_007399 Ga0500595_007399_2853_3206 117
164 3300053130 Ga0500642_0000173 Ga0500642_0000173_20540_20893 117
165 3300053729 Ga0500625_173911 Ga0500625_173911_142_495 117
166 3300002987 JGI25159J45721_1000964 JGI25159J45721_10009646 118
167 3300003323 rootH1_10011701 rootH1_100117014 118
168 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012218 118
169 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002369 118
170 3300004625 Ga0055543_1000011 Ga0055543_1000011123 118
171 3300005262 Ga0065165_1000082 Ga0065165_100008287 118
172 3300005336 Ga0070680_100061854 Ga0070680_1000618542 118
173 3300005339 Ga0070660_100019973 Ga0070660_1000199735 118
174 3300005347 Ga0070668_100491546 Ga0070668_1004915461 118
175 3300005458 Ga0070681_10006827 Ga0070681_100068272 118
176 3300005530 Ga0070679_100214118 Ga0070679_1002141182 118
177 3300005539 Ga0068853_101463965 Ga0068853_1014639651 118
178 3300005614 Ga0068856_100038242 Ga0068856_1000382425 118
179 3300006051 Ga0075364_10625284 Ga0075364_106252842 118
180 3300009101 Ga0105247_10463794 Ga0105247_104637942 118
181 3300010375 Ga0105239_10409853 Ga0105239_104098533 118
182 3300025208 Ga0209436_109634 Ga0209436_1096342 118
183 3300025284 Ga0209130_1000028 Ga0209130_100002881 118
184 3300025298 Ga0209050_1022939 Ga0209050_10229395 118
185 3300025302 Ga0207426_1000012 Ga0207426_1000012500 118
186 3300025912 Ga0207707_10309475 Ga0207707_103094752 118
187 3300025917 Ga0207660_10942955 Ga0207660_109429552 118
188 3300025919 Ga0207657_10028693 Ga0207657_100286935 118
189 3300025921 Ga0207652_10153361 Ga0207652_101533612 118
190 3300025972 Ga0207668_10398494 Ga0207668_103984942 118
191 3300026041 Ga0207639_11382597 Ga0207639_113825972 118
192 3300026078 Ga0207702_10023507 Ga0207702_100235074 118
193 3300027312 Ga0209371_1002698 Ga0209371_100269811 118
194 3300046507 Ga0495606_0071212 Ga0495606_0071212_444_800 118
195 3300047470 Ga0495681_0277826 Ga0495681_0277826_164_520 118
196 3300048920 Ga0496117_0387264 Ga0496117_0387264_96_452 118
197 3300048922 Ga0496119_0272628 Ga0496119_0272628_377_733 118
198 3300048923 Ga0496120_0269079 Ga0496120_0269079_342_698 118
199 3300048924 Ga0496121_0023457 Ga0496121_0023457_3964_4320 118
200 3300006028 Ga0070717_10247136 Ga0070717_102471361 119
201 3300006942 Ga0099824_1026214 Ga0099824_10262143 119
202 3300025927 Ga0207687_10257790 Ga0207687_102577902 119
203 3300027296 Ga0209389_1000061 Ga0209389_100006142 119
204 3300027357 Ga0209589_1000465 Ga0209589_100046542 119
205 3300027361 Ga0209489_100006 Ga0209489_10000644 119
206 3300038443 Ga0395901_0457699 Ga0395901_0457699_25_384 119
207 3300041413 Ga0439465_0029658 Ga0439465_0029658_47_406 119
208 3300044694 Ga0466963_0778837 Ga0466963_0778837_297_656 119
209 3300053094 Ga0500566_0000246 Ga0500566_0000246_1108_1467 119
210 3300053094 Ga0500566_0166399 Ga0500566_0166399_529_903 119
211 3300053128 Ga0500626_116362 Ga0500626_116362_432_791 119
212 3300005563 Ga0068855_100854887 Ga0068855_1008548872 120
213 3300005937 Ga0081455_10007694 Ga0081455_100076945 120
214 3300005983 Ga0081540_1004971 Ga0081540_10049712 120
215 3300005983 Ga0081540_1047026 Ga0081540_10470265 120
216 3300006844 Ga0075428_100158759 Ga0075428_1001587592 120
217 3300013104 Ga0157370_10733848 Ga0157370_107338482 120
218 3300013307 Ga0157372_10038199 Ga0157372_100381994 120
219 3300049568 Ga0501031_0001421 Ga0501031_0001421_8682_9047 120
220 3300049569 Ga0501032_0000129 Ga0501032_0000129_53699_54064 120
221 3300049570 Ga0501033_0001179 Ga0501033_0001179_23044_23409 120
222 3300049571 Ga0501034_0000503 Ga0501034_0000503_16772_17137 120
223 3300049572 Ga0501036_0001453 Ga0501036_0001453_8928_9293 120
224 3300049573 Ga0501037_0000106 Ga0501037_0000106_70358_70723 120
225 3300049574 Ga0501038_0001655 Ga0501038_0001655_8864_9229 120
226 3300049575 Ga0501039_0000416 Ga0501039_0000416_9870_10235 120
227 3300049578 Ga0501042_0203818 Ga0501042_0203818_613_978 120
228 3300049579 Ga0501043_0005698 Ga0501043_0005698_2267_2632 120
229 3300049580 Ga0501046_0000235 Ga0501046_0000235_41058_41423 120
230 3300049581 Ga0501047_0000844 Ga0501047_0000844_8758_9123 120
231 3300049581 Ga0501047_0435030 Ga0501047_0435030_430_795 120
232 3300049582 Ga0501048_0001444 Ga0501048_0001444_9081_9446 120
233 3300049583 Ga0501067_0000160 Ga0501067_0000160_32706_33071 120
234 3300049584 Ga0501068_0000014 Ga0501068_0000014_2028_2393 120
235 3300049585 Ga0501069_0002087 Ga0501069_0002087_1651_2016 120
236 3300049586 Ga0501070_0009747 Ga0501070_0009747_1652_2017 120
237 3300049586 Ga0501070_0417902 Ga0501070_0417902_241_606 120
238 3300049587 Ga0501071_0028316 Ga0501071_0028316_1667_2032 120
239 3300049588 Ga0501072_0001159 Ga0501072_0001159_8569_8934 120
240 3300049589 Ga0501073_0002573 Ga0501073_0002573_4657_5022 120
241 3300049590 Ga0501074_0000596 Ga0501074_0000596_16801_17166 120
242 3300049592 Ga0501076_0808290 Ga0501076_0808290_159_524 120
243 3300049741 Ga0501079_0004541 Ga0501079_0004541_8540_8905 120
244 3300049742 Ga0501080_0000917 Ga0501080_0000917_17104_17469 120
245 3300049744 Ga0501083_0014219 Ga0501083_0014219_3644_4009 120
246 3300049822 Ga0501035_0000324 Ga0501035_0000324_38161_38526 120
247 3300049823 Ga0501044_0000051 Ga0501044_0000051_134456_134821 120
248 3300049824 Ga0501045_0033060 Ga0501045_0033060_2808_3173 120
249 3300050515 nmdc:mga0a205_1209214_c1 nmdc:mga0a205_1209214_c1_25_387 120
250 3300054114 Ga0501084_0056545 Ga0501084_0056545_602_967 120
251 3300060353 Ga0501082_0125661 Ga0501082_0125661_1192_1557 120
252 3300005337 Ga0070682_100878464 Ga0070682_1008784642 121
253 3300005455 Ga0070663_101015269 Ga0070663_1010152691 121
254 3300009545 Ga0105237_10827231 Ga0105237_108272312 121
255 3300010375 Ga0105239_10348509 Ga0105239_103485093 121
256 3300044901 Ga0466960_0125932 Ga0466960_0125932_220_693 121
257 3300049574 Ga0501038_0676886 Ga0501038_0676886_156_527 121
258 3300049581 Ga0501047_0344815 Ga0501047_0344815_727_1098 121
259 iso_pu_bacteria 2524023205 2524437527 121
260 iso_pu_bacteria 2744054633 2745076481 121
261 3300046559 Ga0495667_0744694 Ga0495667_0744694_207_575 122
262 3300050512 nmdc:mga0n895_410687_c1 nmdc:mga0n895_410687_c1_767_1135 122
263 3300002704 JGI25155J39150_1000050 JGI25155J39150_100005070 123
264 3300002705 JGI25156J39149_1000074 JGI25156J39149_10000749 123
265 3300002738 JGI25154J39366_1000099 JGI25154J39366_10000999 123
266 3300002741 JGI25157J39369_1000090 JGI25157J39369_100009070 123
267 3300025206 Ga0209435_100063 Ga0209435_10006369 123
268 3300025246 Ga0209646_1000187 Ga0209646_100018769 123
269 3300025250 Ga0209026_1000227 Ga0209026_100022769 123
270 3300025256 Ga0209759_1000258 Ga0209759_100025869 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

33

139

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9835 2 112
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9497 2 112
3gkx-assembly3.cif.gz_B crystal structure of putative arsc family related protein from bacteroides fragilis 0.8693 1 112
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.8632 1 112
3gkx-assembly2.cif.gz_A crystal structure of putative arsc family related protein from bacteroides fragilis 0.8625 1 112
ID Description Score Start End Superfamily
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9827 2 112 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 2 115 3.40.30.10
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9481 2 112 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9342 2 115 3.40.30.10
af_Q4CWB7_73_169_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9235 2 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A387FND1-F1-model_v4 ArsC family reductase 0.9981 1 115
AF-A0A2M7WPQ2-F1-model_v4 ArsC family reductase 0.9969 2 114
AF-A0A270BW18-F1-model_v4 ArsC family reductase 0.9943 2 114
AF-A0A511B3D3-F1-model_v4 Arsenate reductase 0.9942 2 115
AF-A0A1W9JND3-F1-model_v4 deleted 0.9941 2 114

Feature Viewer

pLDDT pTM Quality
92.81 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map