F376463

General Info

Members Datasets Scaffolds Average Seq Length
269 167 269 96

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0928635|Ga0495613_0928635_49_336
Length 95
Sequence MYAVVRTYSGQGASELFDLLGQREEDVKALIGGVPGFVSYAAVRDGHGGGVTVTLCEDKAGTDESSRRAAEWVKENVSATADPPAVTEGDTVLQF

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
135 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 11.9
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100429042 3300005329 Bacteria 1261
2 Ga0070692_10564144 3300005345 Bacteria 748
3 Ga0070668_100257783 3300005347 Bacteria 1449
4 Ga0070668_101587822 3300005347 Unclassified 599
5 Ga0070671_101269469 3300005355 Unclassified 649
6 Ga0070674_100004862 3300005356 Bacteria 7702
7 Ga0070714_100114588 3300005435 Bacteria 2391
8 Ga0070713_100002487 3300005436 Bacteria 12035
9 Ga0070708_100159328 3300005445 Unclassified 2103
10 Ga0070708_100215717 3300005445 Bacteria 1799
11 Ga0070708_100907938 3300005445 Unclassified 827
12 Ga0070678_100758481 3300005456 Bacteria 878
13 Ga0070681_10966310 3300005458 Bacteria 771
14 Ga0070685_10640644 3300005466 Unclassified 769
15 Ga0070706_100139588 3300005467 Unclassified 2262
16 Ga0070706_100171224 3300005467 Bacteria 2028
17 Ga0070707_100626646 3300005468 Bacteria 1038
18 Ga0070707_102289992 3300005468 Bacteria 508
19 Ga0070699_100906368 3300005518 Bacteria 808
20 Ga0070697_100183988 3300005536 Unclassified 1772
21 Ga0070697_101361029 3300005536 Unclassified 634
22 Ga0070686_101701679 3300005544 Unclassified 535
23 Ga0070695_100223415 3300005545 Unclassified 1358
24 Ga0070696_100557944 3300005546 Unclassified 918
25 Ga0070696_100617358 3300005546 Unclassified 876
26 Ga0070704_101707620 3300005549 Unclassified 582
27 Ga0070704_102149113 3300005549 Unclassified 519
28 Ga0068855_102335387 3300005563 Unclassified 535
29 Ga0068854_100450216 3300005578 Bacteria 1075
30 Ga0068854_101713394 3300005578 Bacteria 575
31 Ga0068856_100168884 3300005614 Bacteria 2199
32 Ga0070702_101284049 3300005615 Unclassified 594
33 Ga0068852_101084471 3300005616 Unclassified 821
34 Ga0068861_100604758 3300005719 Bacteria 1007
35 Ga0068861_102108541 3300005719 Bacteria 564
36 Ga0081455_10102557 3300005937 Bacteria 2293
37 Ga0070717_10400505 3300006028 Bacteria 1233
38 Ga0070717_10448442 3300006028 Bacteria 1163
39 Ga0075365_10823932 3300006038 Bacteria 655
40 Ga0075365_10939061 3300006038 Bacteria 610
41 Ga0075368_10147744 3300006042 Bacteria 981
42 Ga0075363_100089253 3300006048 Bacteria 1695
43 Ga0070716_100072987 3300006173 Unclassified 2023
44 Ga0075428_102560342 3300006844 Bacteria 522
45 Ga0075431_101474850 3300006847 Unclassified 639
46 Ga0075433_10505785 3300006852 Bacteria 1063
47 Ga0075433_11032737 3300006852 Bacteria 716
48 Ga0075434_100035009 3300006871 Bacteria 4963
49 Ga0075434_101142662 3300006871 Unclassified 791
50 Ga0068865_100501759 3300006881 Bacteria 1012
51 Ga0068865_101728632 3300006881 Unclassified 564
52 Ga0075436_100221798 3300006914 Bacteria 1342
53 Ga0075435_100053983 3300007076 Bacteria 3242
54 Ga0075435_101914243 3300007076 Unclassified 521
55 Ga0111539_10318273 3300009094 Bacteria 1811
56 Ga0111539_10842543 3300009094 Bacteria 1067
57 Ga0111539_11446143 3300009094 Unclassified 797
58 Ga0111539_12264830 3300009094 Unclassified 630
59 Ga0111539_13292348 3300009094 Unclassified 520
60 Ga0105245_10202306 3300009098 Bacteria 1908
61 Ga0105245_10217683 3300009098 Bacteria 1841
62 Ga0114129_10006658 3300009147 Bacteria 16406
63 Ga0114129_10468484 3300009147 Bacteria 1650
64 Ga0114129_10502086 3300009147 Bacteria 1584
65 Ga0114129_11002401 3300009147 Bacteria 1052
66 Ga0105243_10082377 3300009148 Bacteria 2629
67 Ga0105243_10150635 3300009148 Bacteria 1995
68 Ga0105243_10189661 3300009148 Bacteria 1794
69 Ga0105243_11503212 3300009148 Unclassified 697
70 Ga0105243_12751212 3300009148 Unclassified 532
71 Ga0105241_12294825 3300009174 Unclassified 537
72 Ga0105242_10161168 3300009176 Unclassified 1964
73 Ga0105242_10338672 3300009176 Bacteria 1385
74 Ga0105242_12766756 3300009176 Unclassified 541
75 Ga0105248_10951896 3300009177 Bacteria 970
76 Ga0105239_11665377 3300010375 Unclassified 738
77 Ga0105239_12738120 3300010375 Unclassified 575
78 Ga0157378_12989850 3300013297 Unclassified 524
79 Ga0163162_11481873 3300013306 Unclassified 773
80 Ga0163162_11673973 3300013306 Unclassified 726
81 Ga0157375_10844168 3300013308 Bacteria 1063
82 Ga0163163_10264998 3300014325 Bacteria 1769
83 Ga0182008_10106163 3300014497 Bacteria 1390
84 Ga0182008_10444499 3300014497 Unclassified 704
85 Ga0157376_10198900 3300014969 Bacteria 1842
86 Ga0213874_10459255 3300021377 Unclassified 504
87 Ga0207688_10386746 3300025901 Bacteria 866
88 Ga0207699_10146404 3300025906 Bacteria 1558
89 Ga0207684_10156157 3300025910 Unclassified 1964
90 Ga0207707_11033609 3300025912 Bacteria 673
91 Ga0207652_10725101 3300025921 Bacteria 886
92 Ga0207646_10702711 3300025922 Unclassified 904
93 Ga0207700_10000021 3300025928 Bacteria 168335
94 Ga0207664_10058738 3300025929 Bacteria 3061
95 Ga0207664_10327360 3300025929 Bacteria 1353
96 Ga0207690_11603215 3300025932 Unclassified 544
97 Ga0207686_10275888 3300025934 Unclassified 1239
98 Ga0207686_10837817 3300025934 Bacteria 739
99 Ga0207709_10450592 3300025935 Bacteria 995
100 Ga0207709_10917018 3300025935 Unclassified 713
101 Ga0207709_11505399 3300025935 Unclassified 558
102 Ga0207669_10015066 3300025937 Bacteria 3889
103 Ga0207669_10646155 3300025937 Unclassified 865
104 Ga0207704_10264419 3300025938 Bacteria 1299
105 Ga0207665_10036712 3300025939 Bacteria 3260
106 Ga0207668_10414884 3300025972 Bacteria 1141
107 Ga0207668_11368588 3300025972 Unclassified 638
108 Ga0207668_12055619 3300025972 Unclassified 514
109 Ga0207640_10351758 3300025981 Bacteria 1184
110 Ga0207677_11857514 3300026023 Unclassified 559
111 Ga0207702_11708324 3300026078 Unclassified 622
112 Ga0207648_10278650 3300026089 Bacteria 1495
113 Ga0207675_100703138 3300026118 Bacteria 1020
114 Ga0207675_101149981 3300026118 Bacteria 796
115 Ga0207683_11893499 3300026121 Bacteria 545
116 Ga0207428_10326501 3300027907 Unclassified 1132
117 Ga0207428_10641370 3300027907 Unclassified 763
118 Ga0207428_11114987 3300027907 Unclassified 551
119 Ga0307408_100986385 3300031548 Bacteria 776
120 Ga0307413_10213069 3300031824 Bacteria 1405
121 Ga0307410_10771905 3300031852 Bacteria 815
122 Ga0307407_10097664 3300031903 Bacteria 1816
123 Ga0307412_10389751 3300031911 Bacteria 1131
124 Ga0307409_100146985 3300031995 Bacteria 2040
125 Ga0307409_102545106 3300031995 Bacteria 540
126 Ga0307409_102726668 3300031995 Unclassified 522
127 Ga0307416_100438857 3300032002 Bacteria 1355
128 Ga0307416_101158516 3300032002 Unclassified 878
129 Ga0307416_102162941 3300032002 Bacteria 658
130 Ga0307416_103345204 3300032002 Bacteria 537
131 Ga0373926_0009636 3300035083 Bacteria 3228
132 Ga0373943_0045358 3300035170 Bacteria 2142
133 Ga0373935_0205440 3300035692 Bacteria 1363
134 Ga0373927_0503285 3300035695 Bacteria 800
135 Ga0373947_0032896 3300035725 Bacteria 3058
136 Ga0373947_0885655 3300035725 Unclassified 609
137 Ga0373925_0070518 3300037068 Bacteria 2642
138 Ga0373925_0683149 3300037068 Bacteria 846
139 Ga0395898_0287721 3300037466 Bacteria 1568
140 Ga0395898_0707245 3300037466 Bacteria 949
141 Ga0395898_1352707 3300037466 Unclassified 641
142 Ga0395898_1680057 3300037466 Unclassified 558
143 Ga0395905_0943713 3300037471 Bacteria 766
144 Ga0436364_0125586 3300037853 Bacteria 827
145 Ga0395901_0488712 3300038443 Bacteria 1255
146 Ga0395901_1107634 3300038443 Bacteria 762
147 Ga0436365_1134696 3300039437 Bacteria 835
148 Ga0436363_0243722 3300039450 Bacteria 875
149 Ga0436363_0254537 3300039450 Unclassified 515
150 Ga0436363_0261898 3300039450 Unclassified 998
151 Ga0436363_0714355 3300039450 Bacteria 1092
152 Ga0436363_1286936 3300039450 Unclassified 725
153 Ga0436362_0066163 3300039453 Unclassified 664
154 Ga0436362_0707775 3300039453 Bacteria 907
155 Ga0436362_0960539 3300039453 Bacteria 811
156 Ga0451851_0492852 3300041507 Bacteria 619
157 Ga0451853_0509947 3300041512 Unclassified 616
158 Ga0439448_0225257 3300042005 Bacteria 659
159 Ga0466969_0281029 3300044656 Bacteria 754
160 Ga0466963_0871810 3300044694 Bacteria 635
161 Ga0466971_0005530 3300044719 Bacteria 5488
162 Ga0466968_0092831 3300044735 Bacteria 1340
163 Ga0466957_0109646 3300044842 Bacteria 1749
164 Ga0466959_0058884 3300045049 Bacteria 2798
165 Ga0466958_0009609 3300045836 Bacteria 5394
166 Ga0466967_0127148 3300045976 Archaea 2362
167 Ga0466967_0921762 3300045976 Bacteria 869
168 Ga0495641_0034944 3300046461 Unclassified 2373
169 Ga0495582_0108201 3300046473 Bacteria 1561
170 Ga0495630_0371781 3300046517 Bacteria 1095
171 Ga0495644_0381991 3300046523 Bacteria 556
172 Ga0495666_0256870 3300046526 Unclassified 795
173 Ga0495647_0091126 3300046681 Bacteria 1250
174 Ga0495658_0087811 3300046683 Bacteria 1837
175 Ga0495613_0928635 3300046689 Bacteria 562
176 Ga0495624_0054521 3300046690 Bacteria 2520
177 Ga0495674_0298192 3300047319 Bacteria 1317
178 Ga0495676_0017553 3300047321 Bacteria 6324
179 Ga0495676_0085478 3300047321 Bacteria 2376
180 Ga0495676_0427168 3300047321 Bacteria 876
181 Ga0495593_0488804 3300047673 Bacteria 617
182 Ga0496100_0599818 3300048903 Bacteria 855
183 Ga0496100_0840590 3300048903 Unclassified 720
184 Ga0496102_0617305 3300048905 Bacteria 1007
185 Ga0496102_0644274 3300048905 Unclassified 983
186 Ga0496102_1831165 3300048905 Unclassified 524
187 Ga0496103_0417730 3300048906 Unclassified 861
188 Ga0496104_0039557 3300048907 Bacteria 4415
189 Ga0496104_0195999 3300048907 Bacteria 1932
190 Ga0496105_0348389 3300048908 Bacteria 1183
191 Ga0496106_0103368 3300048909 Bacteria 2211
192 Ga0496106_1239594 3300048909 Unclassified 581
193 Ga0496107_0126666 3300048910 Bacteria 1884
194 Ga0496107_1379498 3300048910 Bacteria 502
195 Ga0496108_0015925 3300048911 Bacteria 6129
196 Ga0496109_0005873 3300048912 Bacteria 10295
197 Ga0496109_0697198 3300048912 Unclassified 953
198 Ga0496109_0879545 3300048912 Bacteria 834
199 Ga0496110_0026833 3300048913 Bacteria 4932
200 Ga0496110_0054774 3300048913 Bacteria 3508
201 Ga0496110_0303033 3300048913 Unclassified 1455
202 Ga0496110_0448768 3300048913 Unclassified 1175
203 Ga0496111_0072893 3300048914 Bacteria 2500
204 Ga0496111_0140648 3300048914 Bacteria 1788
205 Ga0496111_0406306 3300048914 Bacteria 1006
206 Ga0496111_1180805 3300048914 Unclassified 543
207 Ga0496112_0027133 3300048915 Bacteria 5520
208 Ga0496112_1764029 3300048915 Unclassified 531
209 Ga0496113_0027561 3300048916 Bacteria 4074
210 Ga0496113_0889998 3300048916 Unclassified 705
211 Ga0496114_0737162 3300048917 Bacteria 862
212 Ga0496115_0000178 3300048918 Bacteria 59512
213 Ga0496115_0767049 3300048918 Bacteria 753
214 Ga0501291_105843 3300049514 Bacteria 593
215 Ga0501292_061150 3300049515 Bacteria 684
216 Ga0501041_0094298 3300049577 Bacteria 1849
217 Ga0501042_0138803 3300049578 Bacteria 1752
218 Ga0501043_0187087 3300049579 Bacteria 1612
219 Ga0501046_0417018 3300049580 Bacteria 968
220 Ga0501067_0044548 3300049583 Bacteria 2465
221 Ga0501067_0120553 3300049583 Bacteria 1459
222 Ga0501067_0395869 3300049583 Unclassified 770
223 Ga0501069_0431647 3300049585 Bacteria 782
224 Ga0501071_0907163 3300049587 Unclassified 680
225 Ga0501072_0119528 3300049588 Bacteria 2099
226 Ga0501074_0065329 3300049590 Bacteria 2619
227 Ga0501075_0233581 3300049591 Bacteria 1402
228 Ga0501075_0347418 3300049591 Bacteria 1130
229 Ga0501076_0434761 3300049592 Bacteria 1080
230 Ga0501077_0288977 3300049593 Bacteria 1044
231 Ga0501077_0621260 3300049593 Unclassified 694
232 Ga0501216_122038 3300049660 Bacteria 596
233 Ga0501079_0209181 3300049741 Bacteria 1524
234 Ga0501079_0321940 3300049741 Bacteria 1210
235 Ga0501079_1139285 3300049741 Bacteria 615
236 Ga0501080_0223403 3300049742 Bacteria 1723
237 Ga0501045_0134723 3300049824 Bacteria 1837
238 Ga0501045_0358003 3300049824 Bacteria 1086
239 Ga0501045_0573242 3300049824 Unclassified 836
240 Ga0501045_0838705 3300049824 Unclassified 676
241 nmdc:mga0yw44_790458_c1 3300050492 Bacteria 644
242 nmdc:mga06z11_476777_c1 3300050494 Bacteria 755
243 nmdc:mga04h51_459993_c1 3300050495 Bacteria 539
244 nmdc:mga05p37_15760_c1 3300050507 Bacteria 9089
245 nmdc:mga05p37_19361_c1 3300050507 Bacteria 8233
246 nmdc:mga05p37_638397_c1 3300050507 Bacteria 1195
247 nmdc:mga05p37_719236_c1 3300050507 Bacteria 1106
248 nmdc:mga09592_270931_c1 3300050508 Bacteria 1472
249 nmdc:mga08y16_1086130_c1 3300050511 Bacteria 776
250 nmdc:mga08y16_1214190_c1 3300050511 Bacteria 724
251 nmdc:mga08y16_1248269_c1 3300050511 Unclassified 712
252 nmdc:mga08y16_666244_c1 3300050511 Bacteria 1043
253 nmdc:mga0n895_182697_c1 3300050512 Unclassified 2129
254 nmdc:mga0n895_94172_c1 3300050512 Bacteria 2999
255 nmdc:mga0rr50_336275_c1 3300050513 Bacteria 1268
256 nmdc:mga08x19_394384_c1 3300050514 Unclassified 970
257 nmdc:mga08x19_666281_c1 3300050514 Bacteria 738
258 nmdc:mga0a205_102580_c1 3300050515 Unclassified 2759
259 nmdc:mga0a205_129387_c1 3300050515 Unclassified 2425
260 nmdc:mga0a205_55502_c1 3300050515 Bacteria 3826
261 Ga0495595_0332526 3300053084 Bacteria 766
262 Ga0495595_0616280 3300053084 Unclassified 555
263 Ga0495619_0439980 3300053085 Bacteria 899
264 Ga0501084_0039196 3300054114 Bacteria 3963
265 Ga0501084_0995283 3300054114 Bacteria 705
266 Ga0501082_0008069 3300060353 Bacteria 9084
267 Ga0466962_0012094 3300061719 Bacteria 4150
268 Ga0530510_0001311 3300061734 Bacteria 16625
269 Ga0530510_0116486 3300061734 Bacteria 1959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_12264830 Ga0111539_122648301 90
2 3300031995 Ga0307409_102726668 Ga0307409_1027266681 90
3 3300050511 nmdc:mga08y16_1214190_c1 nmdc:mga08y16_1214190_c1_348_629 90
4 3300010375 Ga0105239_11665377 Ga0105239_116653771 91
5 3300013306 Ga0163162_11673973 Ga0163162_116739731 91
6 3300025972 Ga0207668_11368588 Ga0207668_113685881 91
7 3300042005 Ga0439448_0225257 Ga0439448_0225257_54_335 91
8 3300025901 Ga0207688_10386746 Ga0207688_103867461 93
9 3300005329 Ga0070683_100429042 Ga0070683_1004290422 94
10 3300005345 Ga0070692_10564144 Ga0070692_105641442 94
11 3300005347 Ga0070668_100257783 Ga0070668_1002577833 94
12 3300005347 Ga0070668_101587822 Ga0070668_1015878222 94
13 3300005355 Ga0070671_101269469 Ga0070671_1012694691 94
14 3300005356 Ga0070674_100004862 Ga0070674_10000486210 94
15 3300005435 Ga0070714_100114588 Ga0070714_1001145882 94
16 3300005436 Ga0070713_100002487 Ga0070713_1000024872 94
17 3300005445 Ga0070708_100159328 Ga0070708_1001593282 94
18 3300005445 Ga0070708_100215717 Ga0070708_1002157174 94
19 3300005445 Ga0070708_100907938 Ga0070708_1009079382 94
20 3300005456 Ga0070678_100758481 Ga0070678_1007584812 94
21 3300005458 Ga0070681_10966310 Ga0070681_109663102 94
22 3300005466 Ga0070685_10640644 Ga0070685_106406441 94
23 3300005467 Ga0070706_100139588 Ga0070706_1001395884 94
24 3300005467 Ga0070706_100171224 Ga0070706_1001712242 94
25 3300005468 Ga0070707_100626646 Ga0070707_1006266461 94
26 3300005468 Ga0070707_102289992 Ga0070707_1022899921 94
27 3300005518 Ga0070699_100906368 Ga0070699_1009063682 94
28 3300005536 Ga0070697_100183988 Ga0070697_1001839883 94
29 3300005536 Ga0070697_101361029 Ga0070697_1013610291 94
30 3300005544 Ga0070686_101701679 Ga0070686_1017016791 94
31 3300005545 Ga0070695_100223415 Ga0070695_1002234152 94
32 3300005546 Ga0070696_100557944 Ga0070696_1005579441 94
33 3300005546 Ga0070696_100617358 Ga0070696_1006173582 94
34 3300005549 Ga0070704_101707620 Ga0070704_1017076201 94
35 3300005549 Ga0070704_102149113 Ga0070704_1021491131 94
36 3300005563 Ga0068855_102335387 Ga0068855_1023353871 94
37 3300005578 Ga0068854_100450216 Ga0068854_1004502162 94
38 3300005578 Ga0068854_101713394 Ga0068854_1017133941 94
39 3300005614 Ga0068856_100168884 Ga0068856_1001688843 94
40 3300005615 Ga0070702_101284049 Ga0070702_1012840491 94
41 3300005616 Ga0068852_101084471 Ga0068852_1010844712 94
42 3300005719 Ga0068861_100604758 Ga0068861_1006047583 94
43 3300005719 Ga0068861_102108541 Ga0068861_1021085411 94
44 3300005937 Ga0081455_10102557 Ga0081455_101025573 94
45 3300006028 Ga0070717_10400505 Ga0070717_104005052 94
46 3300006028 Ga0070717_10448442 Ga0070717_104484422 94
47 3300006038 Ga0075365_10823932 Ga0075365_108239321 94
48 3300006038 Ga0075365_10939061 Ga0075365_109390611 94
49 3300006042 Ga0075368_10147744 Ga0075368_101477442 94
50 3300006048 Ga0075363_100089253 Ga0075363_1000892532 94
51 3300006173 Ga0070716_100072987 Ga0070716_1000729872 94
52 3300006844 Ga0075428_102560342 Ga0075428_1025603421 94
53 3300006847 Ga0075431_101474850 Ga0075431_1014748502 94
54 3300006852 Ga0075433_10505785 Ga0075433_105057852 94
55 3300006852 Ga0075433_11032737 Ga0075433_110327371 94
56 3300006871 Ga0075434_100035009 Ga0075434_1000350094 94
57 3300006871 Ga0075434_101142662 Ga0075434_1011426622 94
58 3300006881 Ga0068865_100501759 Ga0068865_1005017593 94
59 3300006881 Ga0068865_101728632 Ga0068865_1017286322 94
60 3300006914 Ga0075436_100221798 Ga0075436_1002217982 94
61 3300007076 Ga0075435_100053983 Ga0075435_1000539836 94
62 3300007076 Ga0075435_101914243 Ga0075435_1019142431 94
63 3300009094 Ga0111539_10318273 Ga0111539_103182732 94
64 3300009094 Ga0111539_10842543 Ga0111539_108425433 94
65 3300009094 Ga0111539_11446143 Ga0111539_114461431 94
66 3300009094 Ga0111539_13292348 Ga0111539_132923482 94
67 3300009098 Ga0105245_10202306 Ga0105245_102023063 94
68 3300009098 Ga0105245_10217683 Ga0105245_102176831 94
69 3300009147 Ga0114129_10006658 Ga0114129_1000665812 94
70 3300009147 Ga0114129_10468484 Ga0114129_104684842 94
71 3300009147 Ga0114129_10502086 Ga0114129_105020862 94
72 3300009147 Ga0114129_11002401 Ga0114129_110024011 94
73 3300009148 Ga0105243_10082377 Ga0105243_100823773 94
74 3300009148 Ga0105243_10150635 Ga0105243_101506353 94
75 3300009148 Ga0105243_10189661 Ga0105243_101896612 94
76 3300009148 Ga0105243_11503212 Ga0105243_115032121 94
77 3300009148 Ga0105243_12751212 Ga0105243_127512121 94
78 3300009174 Ga0105241_12294825 Ga0105241_122948251 94
79 3300009176 Ga0105242_10161168 Ga0105242_101611682 94
80 3300009176 Ga0105242_10338672 Ga0105242_103386722 94
81 3300009176 Ga0105242_12766756 Ga0105242_127667562 94
82 3300009177 Ga0105248_10951896 Ga0105248_109518961 94
83 3300010375 Ga0105239_12738120 Ga0105239_127381201 94
84 3300013297 Ga0157378_12989850 Ga0157378_129898501 94
85 3300013306 Ga0163162_11481873 Ga0163162_114818731 94
86 3300013308 Ga0157375_10844168 Ga0157375_108441683 94
87 3300014325 Ga0163163_10264998 Ga0163163_102649982 94
88 3300014497 Ga0182008_10106163 Ga0182008_101061632 94
89 3300014497 Ga0182008_10444499 Ga0182008_104444991 94
90 3300014969 Ga0157376_10198900 Ga0157376_101989003 94
91 3300021377 Ga0213874_10459255 Ga0213874_104592551 94
92 3300025906 Ga0207699_10146404 Ga0207699_101464042 94
93 3300025910 Ga0207684_10156157 Ga0207684_101561574 94
94 3300025912 Ga0207707_11033609 Ga0207707_110336091 94
95 3300025921 Ga0207652_10725101 Ga0207652_107251011 94
96 3300025922 Ga0207646_10702711 Ga0207646_107027112 94
97 3300025928 Ga0207700_10000021 Ga0207700_100000213 94
98 3300025929 Ga0207664_10058738 Ga0207664_100587384 94
99 3300025929 Ga0207664_10327360 Ga0207664_103273602 94
100 3300025932 Ga0207690_11603215 Ga0207690_116032151 94
101 3300025934 Ga0207686_10275888 Ga0207686_102758883 94
102 3300025934 Ga0207686_10837817 Ga0207686_108378172 94
103 3300025935 Ga0207709_10450592 Ga0207709_104505922 94
104 3300025935 Ga0207709_10917018 Ga0207709_109170182 94
105 3300025935 Ga0207709_11505399 Ga0207709_115053991 94
106 3300025937 Ga0207669_10015066 Ga0207669_100150662 94
107 3300025937 Ga0207669_10646155 Ga0207669_106461552 94
108 3300025938 Ga0207704_10264419 Ga0207704_102644191 94
109 3300025939 Ga0207665_10036712 Ga0207665_100367123 94
110 3300025972 Ga0207668_10414884 Ga0207668_104148843 94
111 3300025972 Ga0207668_12055619 Ga0207668_120556192 94
112 3300025981 Ga0207640_10351758 Ga0207640_103517582 94
113 3300026023 Ga0207677_11857514 Ga0207677_118575141 94
114 3300026078 Ga0207702_11708324 Ga0207702_117083242 94
115 3300026089 Ga0207648_10278650 Ga0207648_102786504 94
116 3300026118 Ga0207675_100703138 Ga0207675_1007031382 94
117 3300026118 Ga0207675_101149981 Ga0207675_1011499811 94
118 3300026121 Ga0207683_11893499 Ga0207683_118934991 94
119 3300027907 Ga0207428_10326501 Ga0207428_103265012 94
120 3300027907 Ga0207428_10641370 Ga0207428_106413701 94
121 3300027907 Ga0207428_11114987 Ga0207428_111149872 94
122 3300031548 Ga0307408_100986385 Ga0307408_1009863852 94
123 3300031824 Ga0307413_10213069 Ga0307413_102130692 94
124 3300031852 Ga0307410_10771905 Ga0307410_107719052 94
125 3300031903 Ga0307407_10097664 Ga0307407_100976643 94
126 3300031911 Ga0307412_10389751 Ga0307412_103897511 94
127 3300031995 Ga0307409_100146985 Ga0307409_1001469852 94
128 3300031995 Ga0307409_102545106 Ga0307409_1025451061 94
129 3300032002 Ga0307416_100438857 Ga0307416_1004388573 94
130 3300032002 Ga0307416_101158516 Ga0307416_1011585162 94
131 3300032002 Ga0307416_102162941 Ga0307416_1021629412 94
132 3300032002 Ga0307416_103345204 Ga0307416_1033452041 94
133 3300035083 Ga0373926_0009636 Ga0373926_0009636_645_983 94
134 3300035170 Ga0373943_0045358 Ga0373943_0045358_1230_1568 94
135 3300035692 Ga0373935_0205440 Ga0373935_0205440_605_895 94
136 3300035695 Ga0373927_0503285 Ga0373927_0503285_491_781 94
137 3300035725 Ga0373947_0032896 Ga0373947_0032896_1984_2322 94
138 3300035725 Ga0373947_0885655 Ga0373947_0885655_277_561 94
139 3300037068 Ga0373925_0070518 Ga0373925_0070518_254_592 94
140 3300037068 Ga0373925_0683149 Ga0373925_0683149_36_320 94
141 3300037466 Ga0395898_0287721 Ga0395898_0287721_253_537 94
142 3300037466 Ga0395898_0707245 Ga0395898_0707245_342_668 94
143 3300037466 Ga0395898_1352707 Ga0395898_1352707_83_373 94
144 3300037466 Ga0395898_1680057 Ga0395898_1680057_185_475 94
145 3300037471 Ga0395905_0943713 Ga0395905_0943713_139_465 94
146 3300037853 Ga0436364_0125586 Ga0436364_0125586_266_550 94
147 3300038443 Ga0395901_0488712 Ga0395901_0488712_133_459 94
148 3300038443 Ga0395901_1107634 Ga0395901_1107634_440_736 94
149 3300039437 Ga0436365_1134696 Ga0436365_1134696_241_525 94
150 3300039450 Ga0436363_0243722 Ga0436363_0243722_270_554 94
151 3300039450 Ga0436363_0254537 Ga0436363_0254537_82_366 94
152 3300039450 Ga0436363_0261898 Ga0436363_0261898_624_908 94
153 3300039450 Ga0436363_0714355 Ga0436363_0714355_597_881 94
154 3300039450 Ga0436363_1286936 Ga0436363_1286936_215_499 94
155 3300039453 Ga0436362_0066163 Ga0436362_0066163_338_622 94
156 3300039453 Ga0436362_0707775 Ga0436362_0707775_498_782 94
157 3300039453 Ga0436362_0960539 Ga0436362_0960539_28_354 94
158 3300041507 Ga0451851_0492852 Ga0451851_0492852_240_530 94
159 3300041512 Ga0451853_0509947 Ga0451853_0509947_55_345 94
160 3300044656 Ga0466969_0281029 Ga0466969_0281029_166_450 94
161 3300044694 Ga0466963_0871810 Ga0466963_0871810_192_488 94
162 3300044719 Ga0466971_0005530 Ga0466971_0005530_3964_4260 94
163 3300044735 Ga0466968_0092831 Ga0466968_0092831_917_1201 94
164 3300044842 Ga0466957_0109646 Ga0466957_0109646_623_919 94
165 3300045049 Ga0466959_0058884 Ga0466959_0058884_833_1117 94
166 3300045836 Ga0466958_0009609 Ga0466958_0009609_4252_4548 94
167 3300045976 Ga0466967_0127148 Ga0466967_0127148_1668_1952 94
168 3300045976 Ga0466967_0921762 Ga0466967_0921762_209_493 94
169 3300046461 Ga0495641_0034944 Ga0495641_0034944_1675_1959 94
170 3300046473 Ga0495582_0108201 Ga0495582_0108201_395_733 94
171 3300046517 Ga0495630_0371781 Ga0495630_0371781_90_395 94
172 3300046523 Ga0495644_0381991 Ga0495644_0381991_245_529 94
173 3300046526 Ga0495666_0256870 Ga0495666_0256870_435_719 94
174 3300046681 Ga0495647_0091126 Ga0495647_0091126_834_1118 94
175 3300046683 Ga0495658_0087811 Ga0495658_0087811_1121_1459 94
176 3300046689 Ga0495613_0928635 Ga0495613_0928635_49_336 94
177 3300046690 Ga0495624_0054521 Ga0495624_0054521_122_460 94
178 3300047319 Ga0495674_0298192 Ga0495674_0298192_815_1105 94
179 3300047321 Ga0495676_0017553 Ga0495676_0017553_2213_2497 94
180 3300047321 Ga0495676_0085478 Ga0495676_0085478_1418_1756 94
181 3300047321 Ga0495676_0427168 Ga0495676_0427168_56_346 94
182 3300047673 Ga0495593_0488804 Ga0495593_0488804_241_531 94
183 3300048903 Ga0496100_0599818 Ga0496100_0599818_282_572 94
184 3300048903 Ga0496100_0840590 Ga0496100_0840590_311_601 94
185 3300048905 Ga0496102_0617305 Ga0496102_0617305_530_820 94
186 3300048905 Ga0496102_0644274 Ga0496102_0644274_309_593 94
187 3300048905 Ga0496102_1831165 Ga0496102_1831165_155_445 94
188 3300048906 Ga0496103_0417730 Ga0496103_0417730_269_553 94
189 3300048907 Ga0496104_0039557 Ga0496104_0039557_3957_4247 94
190 3300048907 Ga0496104_0195999 Ga0496104_0195999_943_1233 94
191 3300048908 Ga0496105_0348389 Ga0496105_0348389_358_648 94
192 3300048909 Ga0496106_0103368 Ga0496106_0103368_169_459 94
193 3300048909 Ga0496106_1239594 Ga0496106_1239594_161_451 94
194 3300048910 Ga0496107_0126666 Ga0496107_0126666_775_1059 94
195 3300048910 Ga0496107_1379498 Ga0496107_1379498_200_484 94
196 3300048911 Ga0496108_0015925 Ga0496108_0015925_2062_2352 94
197 3300048912 Ga0496109_0005873 Ga0496109_0005873_3185_3475 94
198 3300048912 Ga0496109_0697198 Ga0496109_0697198_315_605 94
199 3300048912 Ga0496109_0879545 Ga0496109_0879545_338_622 94
200 3300048913 Ga0496110_0026833 Ga0496110_0026833_1729_2019 94
201 3300048913 Ga0496110_0054774 Ga0496110_0054774_2283_2573 94
202 3300048913 Ga0496110_0303033 Ga0496110_0303033_582_872 94
203 3300048913 Ga0496110_0448768 Ga0496110_0448768_812_1096 94
204 3300048914 Ga0496111_0072893 Ga0496111_0072893_1923_2213 94
205 3300048914 Ga0496111_0140648 Ga0496111_0140648_1468_1758 94
206 3300048914 Ga0496111_0406306 Ga0496111_0406306_232_522 94
207 3300048914 Ga0496111_1180805 Ga0496111_1180805_187_477 94
208 3300048915 Ga0496112_0027133 Ga0496112_0027133_3957_4247 94
209 3300048915 Ga0496112_1764029 Ga0496112_1764029_213_503 94
210 3300048916 Ga0496113_0027561 Ga0496113_0027561_601_891 94
211 3300048916 Ga0496113_0889998 Ga0496113_0889998_128_418 94
212 3300048917 Ga0496114_0737162 Ga0496114_0737162_287_577 94
213 3300048918 Ga0496115_0000178 Ga0496115_0000178_49572_49856 94
214 3300048918 Ga0496115_0767049 Ga0496115_0767049_282_572 94
215 3300049514 Ga0501291_105843 Ga0501291_105843_266_556 94
216 3300049515 Ga0501292_061150 Ga0501292_061150_89_379 94
217 3300049577 Ga0501041_0094298 Ga0501041_0094298_885_1169 94
218 3300049578 Ga0501042_0138803 Ga0501042_0138803_334_618 94
219 3300049579 Ga0501043_0187087 Ga0501043_0187087_1264_1548 94
220 3300049580 Ga0501046_0417018 Ga0501046_0417018_175_459 94
221 3300049583 Ga0501067_0044548 Ga0501067_0044548_1688_1978 94
222 3300049583 Ga0501067_0120553 Ga0501067_0120553_576_866 94
223 3300049583 Ga0501067_0395869 Ga0501067_0395869_439_732 94
224 3300049585 Ga0501069_0431647 Ga0501069_0431647_98_388 94
225 3300049587 Ga0501071_0907163 Ga0501071_0907163_19_303 94
226 3300049588 Ga0501072_0119528 Ga0501072_0119528_1039_1323 94
227 3300049590 Ga0501074_0065329 Ga0501074_0065329_559_843 94
228 3300049591 Ga0501075_0233581 Ga0501075_0233581_557_841 94
229 3300049591 Ga0501075_0347418 Ga0501075_0347418_360_644 94
230 3300049592 Ga0501076_0434761 Ga0501076_0434761_586_876 94
231 3300049593 Ga0501077_0288977 Ga0501077_0288977_358_642 94
232 3300049593 Ga0501077_0621260 Ga0501077_0621260_121_405 94
233 3300049660 Ga0501216_122038 Ga0501216_122038_107_397 94
234 3300049741 Ga0501079_0209181 Ga0501079_0209181_233_517 94
235 3300049741 Ga0501079_0321940 Ga0501079_0321940_698_982 94
236 3300049741 Ga0501079_1139285 Ga0501079_1139285_260_544 94
237 3300049742 Ga0501080_0223403 Ga0501080_0223403_97_381 94
238 3300049824 Ga0501045_0134723 Ga0501045_0134723_54_344 94
239 3300049824 Ga0501045_0358003 Ga0501045_0358003_87_371 94
240 3300049824 Ga0501045_0573242 Ga0501045_0573242_535_819 94
241 3300049824 Ga0501045_0838705 Ga0501045_0838705_248_532 94
242 3300050492 nmdc:mga0yw44_790458_c1 nmdc:mga0yw44_790458_c1_311_595 94
243 3300050494 nmdc:mga06z11_476777_c1 nmdc:mga06z11_476777_c1_435_719 94
244 3300050495 nmdc:mga04h51_459993_c1 nmdc:mga04h51_459993_c1_110_394 94
245 3300050507 nmdc:mga05p37_15760_c1 nmdc:mga05p37_15760_c1_4666_4950 94
246 3300050507 nmdc:mga05p37_19361_c1 nmdc:mga05p37_19361_c1_5792_6082 94
247 3300050507 nmdc:mga05p37_638397_c1 nmdc:mga05p37_638397_c1_286_570 94
248 3300050507 nmdc:mga05p37_719236_c1 nmdc:mga05p37_719236_c1_22_306 94
249 3300050508 nmdc:mga09592_270931_c1 nmdc:mga09592_270931_c1_830_1114 94
250 3300050511 nmdc:mga08y16_1086130_c1 nmdc:mga08y16_1086130_c1_355_639 94
251 3300050511 nmdc:mga08y16_1248269_c1 nmdc:mga08y16_1248269_c1_288_572 94
252 3300050511 nmdc:mga08y16_666244_c1 nmdc:mga08y16_666244_c1_161_445 94
253 3300050512 nmdc:mga0n895_182697_c1 nmdc:mga0n895_182697_c1_665_949 94
254 3300050512 nmdc:mga0n895_94172_c1 nmdc:mga0n895_94172_c1_2191_2475 94
255 3300050513 nmdc:mga0rr50_336275_c1 nmdc:mga0rr50_336275_c1_917_1252 94
256 3300050514 nmdc:mga08x19_394384_c1 nmdc:mga08x19_394384_c1_207_491 94
257 3300050514 nmdc:mga08x19_666281_c1 nmdc:mga08x19_666281_c1_202_486 94
258 3300050515 nmdc:mga0a205_102580_c1 nmdc:mga0a205_102580_c1_914_1198 94
259 3300050515 nmdc:mga0a205_129387_c1 nmdc:mga0a205_129387_c1_1406_1696 94
260 3300050515 nmdc:mga0a205_55502_c1 nmdc:mga0a205_55502_c1_816_1100 94
261 3300053084 Ga0495595_0332526 Ga0495595_0332526_48_338 94
262 3300053084 Ga0495595_0616280 Ga0495595_0616280_28_312 94
263 3300053085 Ga0495619_0439980 Ga0495619_0439980_484_774 94
264 3300054114 Ga0501084_0039196 Ga0501084_0039196_792_1076 94
265 3300054114 Ga0501084_0995283 Ga0501084_0995283_293_631 94
266 3300060353 Ga0501082_0008069 Ga0501082_0008069_5164_5448 94
267 3300061719 Ga0466962_0012094 Ga0466962_0012094_1114_1410 94
268 3300061734 Ga0530510_0001311 Ga0530510_0001311_4818_5102 94
269 3300061734 Ga0530510_0116486 Ga0530510_0116486_1132_1422 94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.7175 2 89
6fxd-assembly1.cif.gz_A-2 crystal structure of mupz from pseudomonas fluorescens 0.7142 2 89
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.7018 2 94
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.6919 2 94
4hhu-assembly2.cif.gz_B crystal structure of engineered protein. northeast structural genomics consortium target or280. 0.6815 1 89
ID Description Score Start End Superfamily
af_A0A1D6N398_1_83_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7189 25 66 3.30.70.330
af_Q10220_3_87_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.7139 4 78 3.30.310.50
3encA00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.6996 1 79 3.30.310.50
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6919 2 94 3.30.70.100
af_Q0WQM7_193_281_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6907 3 64 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1H6NS19-F1-model_v4 deleted 0.8946 2 88
AF-I5CFN2-F1-model_v4 deleted 0.8578 2 94
AF-A0A6N6SUX3-F1-model_v4 Uncharacterized protein 0.8575 1 94
AF-A0A6N6SUX3-F1-model_v4 Uncharacterized protein 0.8492 1 94
AF-A0A3D3WSQ0-F1-model_v4 ABM domain-containing protein 0.8461 1 94

Feature Viewer

pLDDT pTM Quality
91.91 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map