F376445

General Info

Members Datasets Scaffolds Average Seq Length
269 169 263 388

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000562|Ga0495606_0000562_38637_39713
Length 358
Sequence MTPIYATSTYVQESPGKHKGYEYSRTQNPTRMAYERCVAELEGGKAGFAFGSGLAAAATVLDMLDSGSHVIAMDDLYGGTYRLFERVRRRSAGLDFTFVDLNDASALKAALKPNTRMIWAETPTNPMLKLVDLAKLAAFAKKHGLLLVVDNTFCSPMLQRPLEYGADLVLHSATKYLNGHSDMVGGIVVAGTQELAEQMAFLQNSVGAVSGPFDAFLAMRGLKTLHLRMRAHCESAMELARWLEAHPAIERVIYPGLKSHPQHQLAKRQMDGFGGIISVEVKGGLKKARRVLERCNLFALAESLGGVESLIEHPAIMTHASVPLANRKRLGISDSLIRLSVGVEDLRDLQNELAAALA

Samples

Sample ID Description Type Environment
1 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
2 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
3 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
4 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
5 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
6 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
95 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 3.35
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10039347 3300003316 Bacteria 17782
2 rootH1_10039347 3300003323 Bacteria 1765
3 Ga0065704_10070432 3300005289 Bacteria 25018
4 Ga0068869_100064068 3300005334 Bacteria 2703
5 Ga0070666_10028013 3300005335 Bacteria 3694
6 Ga0070680_100114763 3300005336 Bacteria 2244
7 Ga0070668_100013024 3300005347 Bacteria 6193
8 Ga0070671_100002748 3300005355 Bacteria 13664
9 Ga0070671_100018190 3300005355 Bacteria 5705
10 Ga0070688_100070605 3300005365 Bacteria 2234
11 Ga0070659_100026601 3300005366 Bacteria 4453
12 Ga0070663_100010572 3300005455 Bacteria 5756
13 Ga0070685_10000832 3300005466 Bacteria 16796
14 Ga0070685_10001362 3300005466 Bacteria 12825
15 Ga0070707_100198741 3300005468 Bacteria 1954
16 Ga0070679_100095301 3300005530 Bacteria 2964
17 Ga0070684_100056815 3300005535 Bacteria 3416
18 Ga0070697_100036882 3300005536 Bacteria 3949
19 Ga0068853_100001164 3300005539 Bacteria 18703
20 Ga0068853_100045349 3300005539 Bacteria 3765
21 Ga0068853_100151334 3300005539 Bacteria 2089
22 Ga0070665_100013639 3300005548 Bacteria 8174
23 Ga0070665_100193852 3300005548 Bacteria 2032
24 Ga0068854_100048723 3300005578 Bacteria 3024
25 Ga0068856_100007715 3300005614 Bacteria 10505
26 Ga0068856_100072187 3300005614 Bacteria 3417
27 Ga0068856_100411989 3300005614 Bacteria 1371
28 Ga0068852_100046538 3300005616 Bacteria 3697
29 Ga0068859_100001513 3300005617 Bacteria 23736
30 Ga0068858_100038835 3300005842 Bacteria 4415
31 Ga0068860_100016399 3300005843 Bacteria 7223
32 Ga0068862_100001035 3300005844 Bacteria 26724
33 Ga0070717_10123333 3300006028 Bacteria 2222
34 Ga0075364_10078527 3300006051 Bacteria 2180
35 Ga0097621_100012705 3300006237 Bacteria 6256
36 Ga0097621_100085810 3300006237 Bacteria 2626
37 Ga0068871_100022247 3300006358 Bacteria 4888
38 Ga0068871_100024257 3300006358 Bacteria 4701
39 Ga0068871_100034839 3300006358 Bacteria 3997
40 Ga0068865_100055243 3300006881 Bacteria 2762
41 Ga0068865_100070515 3300006881 Bacteria 2476
42 Ga0097620_100001513 3300006931 Bacteria 23736
43 Ga0105240_10056465 3300009093 Bacteria 4913
44 Ga0105241_10264791 3300009174 Bacteria 1462
45 Ga0105248_10020716 3300009177 Bacteria 7286
46 Ga0105238_10004253 3300009551 Bacteria 14227
47 Ga0105238_10039489 3300009551 Bacteria 4786
48 Ga0105239_10000033 3300010375 Bacteria 223933
49 Ga0105239_10008484 3300010375 Bacteria 11682
50 Ga0157370_10006138 3300013104 Bacteria 13332
51 Ga0157369_10001729 3300013105 Bacteria 26531
52 Ga0157369_10004216 3300013105 Bacteria 17028
53 Ga0157374_10000538 3300013296 Bacteria 33948
54 Ga0157374_10021970 3300013296 Bacteria 5685
55 Ga0157374_10201779 3300013296 Bacteria 1947
56 Ga0157374_10287439 3300013296 Bacteria 1624
57 Ga0157378_10026522 3300013297 Bacteria 5107
58 Ga0157378_10166117 3300013297 Bacteria 2067
59 Ga0163162_10000017 3300013306 Bacteria 233474
60 Ga0163162_10006875 3300013306 Bacteria 11040
61 Ga0157375_10001695 3300013308 Bacteria 18933
62 Ga0157375_10001992 3300013308 Bacteria 17624
63 Ga0157375_10182285 3300013308 Bacteria 2252
64 Ga0163163_10000029 3300014325 Bacteria 174973
65 Ga0163163_10055588 3300014325 Bacteria 3912
66 Ga0157376_10173144 3300014969 Bacteria 1967
67 Ga0213876_10017051 3300021384 Bacteria 3837
68 Ga0209672_100916 3300025228 Bacteria 13362
69 Ga0209233_1002533 3300025261 Bacteria 6676
70 Ga0209455_1005703 3300025272 Bacteria 3797
71 Ga0209676_1000052 3300025292 Bacteria 371539
72 Ga0209025_1004686 3300025294 Bacteria 11676
73 Ga0207680_10124276 3300025903 Bacteria 1692
74 Ga0207647_10002622 3300025904 Bacteria 13595
75 Ga0207654_10000391 3300025911 Bacteria 25490
76 Ga0207695_10002627 3300025913 Bacteria 26289
77 Ga0207695_10023815 3300025913 Bacteria 6910
78 Ga0207671_10005357 3300025914 Bacteria 11864
79 Ga0207694_10019790 3300025924 Bacteria 5092
80 Ga0207650_10012334 3300025925 Bacteria 5899
81 Ga0207644_10003468 3300025931 Bacteria 10194
82 Ga0207644_10028300 3300025931 Bacteria 3878
83 Ga0207686_10010628 3300025934 Bacteria 5016
84 Ga0207704_10004451 3300025938 Bacteria 6406
85 Ga0207691_10044460 3300025940 Bacteria 4089
86 Ga0207691_10230969 3300025940 Bacteria 1602
87 Ga0207711_10021180 3300025941 Bacteria 5429
88 Ga0207667_10002857 3300025949 Bacteria 21430
89 Ga0207712_10159724 3300025961 Bacteria 1750
90 Ga0207640_10208637 3300025981 Bacteria 1486
91 Ga0207639_10000455 3300026041 Bacteria 28193
92 Ga0207639_10001038 3300026041 Bacteria 18865
93 Ga0207639_10123156 3300026041 Bacteria 2134
94 Ga0207678_10002061 3300026067 Bacteria 18229
95 Ga0207702_10042561 3300026078 Bacteria 3810
96 Ga0207648_10177038 3300026089 Bacteria 1887
97 Ga0207674_10049210 3300026116 Bacteria 4312
98 Ga0207683_10131122 3300026121 Bacteria 2255
99 Ga0207698_10023858 3300026142 Bacteria 4282
100 Ga0207698_10138506 3300026142 Bacteria 2092
101 Ga0207698_10213149 3300026142 Bacteria 1739
102 Ga0268266_10152720 3300028379 Bacteria 2083
103 Ga0268266_10243529 3300028379 Bacteria 1660
104 Ga0268265_10000372 3300028380 Bacteria 48383
105 Ga0268264_10013160 3300028381 Bacteria 6805
106 Ga0268264_10014160 3300028381 Bacteria 6559
107 Ga0265327_10001771 3300031251 Bacteria 25517
108 Ga0307513_10005508 3300031456 Bacteria 16712
109 Ga0307516_10078800 3300031730 Bacteria 3140
110 Ga0307406_10010696 3300031901 Bacteria 5183
111 Ga0307414_10003716 3300032004 Bacteria 8185
112 Ga0307414_10007110 3300032004 Bacteria 6280
113 Ga0307414_10011970 3300032004 Bacteria 5114
114 Ga0373956_0045183 3300035119 Bacteria 1965
115 Ga0395899_0053253 3300037312 Bacteria 2997
116 Ga0395900_0020527 3300037418 Bacteria 6745
117 Ga0395898_0191245 3300037466 Bacteria 1955
118 Ga0395905_0003783 3300037471 Bacteria 16014
119 Ga0395901_0007245 3300038443 Bacteria 11190
120 Ga0436365_1756022 3300039437 Bacteria 12858
121 Ga0451791_0534889 3300041451 Bacteria 1765
122 Ga0451791_0890502 3300041451 Bacteria 2128
123 Ga0451837_0306698 3300041494 Bacteria 7218
124 Ga0439432_007466 3300042006 Bacteria 3874
125 Ga0495592_0015247 3300046454 Bacteria 5834
126 Ga0495629_0055141 3300046459 Bacteria 2780
127 Ga0495650_0000134 3300046471 Bacteria 173331
128 Ga0495580_0059037 3300046472 Bacteria 2696
129 Ga0495582_0022570 3300046473 Bacteria 3445
130 Ga0495639_0041940 3300046475 Bacteria 2062
131 Ga0495594_0122076 3300046499 Bacteria 1473
132 Ga0495606_0000562 3300046507 Bacteria 59044
133 Ga0495618_0070680 3300046514 Bacteria 2220
134 Ga0495663_0000265 3300046525 Bacteria 20102
135 Ga0495665_0067680 3300046531 Bacteria 1884
136 Ga0495621_0000203 3300046539 Bacteria 13807
137 Ga0495645_0107251 3300046543 Bacteria 1980
138 Ga0495656_0004389 3300046615 Bacteria 4828
139 Ga0495635_0044160 3300046663 Bacteria 3075
140 Ga0495657_0077576 3300046675 Bacteria 2155
141 Ga0495623_0002598 3300046679 Bacteria 11923
142 Ga0495658_0004509 3300046683 Bacteria 6847
143 Ga0495649_0014075 3300046694 Bacteria 4595
144 Ga0495604_0044423 3300047317 Bacteria 3471
145 Ga0495636_0034663 3300047318 Bacteria 2078
146 Ga0495680_0068274 3300047322 Bacteria 2716
147 Ga0495675_0111633 3300047444 Bacteria 1706
148 Ga0495684_0168119 3300047471 Bacteria 1632
149 Ga0496103_0133938 3300048906 Bacteria 1583
150 Ga0496104_0000109 3300048907 Bacteria 78168
151 Ga0496105_0000012 3300048908 Bacteria 261713
152 Ga0496109_0049500 3300048912 Bacteria 3825
153 Ga0496112_0016331 3300048915 Bacteria 6952
154 Ga0496115_0000014 3300048918 Bacteria 204935
155 Ga0496115_0000193 3300048918 Bacteria 56720
156 Ga0496117_0128383 3300048920 Bacteria 1542
157 Ga0496118_0000184 3300048921 Bacteria 109873
158 Ga0496118_0003995 3300048921 Bacteria 17974
159 Ga0496118_0022053 3300048921 Bacteria 5583
160 Ga0496122_0000537 3300048925 Bacteria 78505
161 Ga0496122_0014349 3300048925 Bacteria 7668
162 Ga0496123_0000987 3300048926 Bacteria 43765
163 Ga0496123_0009613 3300048926 Bacteria 8680
164 Ga0496123_0053791 3300048926 Bacteria 2657
165 Ga0496126_0000047 3300048929 Bacteria 322212
166 Ga0496126_0003733 3300048929 Bacteria 18974
167 Ga0495682_0008232 3300049460 Bacteria 4118
168 Ga0501031_0046779 3300049568 Bacteria 2821
169 Ga0501032_0002443 3300049569 Bacteria 14510
170 Ga0501032_0011139 3300049569 Bacteria 6464
171 Ga0501032_0016623 3300049569 Bacteria 5172
172 Ga0501033_0000348 3300049570 Bacteria 43990
173 Ga0501033_0017194 3300049570 Bacteria 5465
174 Ga0501034_0001456 3300049571 Bacteria 31331
175 Ga0501034_0003503 3300049571 Bacteria 17820
176 Ga0501034_0005075 3300049571 Bacteria 14459
177 Ga0501034_0013484 3300049571 Bacteria 8413
178 Ga0501034_0033790 3300049571 Bacteria 5184
179 Ga0501036_0002512 3300049572 Bacteria 14389
180 Ga0501036_0010356 3300049572 Bacteria 7697
181 Ga0501036_0013840 3300049572 Bacteria 6708
182 Ga0501036_0015939 3300049572 Bacteria 6277
183 Ga0501036_0066591 3300049572 Bacteria 3048
184 Ga0501037_0003230 3300049573 Bacteria 11814
185 Ga0501037_0018129 3300049573 Bacteria 5186
186 Ga0501037_0018628 3300049573 Bacteria 5115
187 Ga0501038_0026626 3300049574 Bacteria 5149
188 Ga0501038_0063451 3300049574 Bacteria 3153
189 Ga0501038_0082824 3300049574 Bacteria 2701
190 Ga0501038_0088934 3300049574 Bacteria 2591
191 Ga0501039_0006094 3300049575 Bacteria 9154
192 Ga0501039_0012881 3300049575 Bacteria 6395
193 Ga0501039_0018800 3300049575 Bacteria 5303
194 Ga0501042_0072330 3300049578 Bacteria 2467
195 Ga0501043_0003809 3300049579 Bacteria 12408
196 Ga0501043_0006731 3300049579 Bacteria 9174
197 Ga0501043_0059907 3300049579 Bacteria 2988
198 Ga0501043_0160564 3300049579 Bacteria 1756
199 Ga0501046_0005282 3300049580 Bacteria 11553
200 Ga0501046_0006283 3300049580 Bacteria 10535
201 Ga0501046_0054128 3300049580 Bacteria 3158
202 Ga0501046_0134092 3300049580 Bacteria 1877
203 Ga0501047_0001202 3300049581 Bacteria 25643
204 Ga0501047_0004649 3300049581 Bacteria 12914
205 Ga0501047_0019765 3300049581 Bacteria 6464
206 Ga0501047_0030614 3300049581 Bacteria 5187
207 Ga0501047_0054009 3300049581 Bacteria 3886
208 Ga0501048_0012473 3300049582 Bacteria 6322
209 Ga0501048_0098016 3300049582 Bacteria 2068
210 Ga0501048_0115335 3300049582 Bacteria 1898
211 Ga0501067_0000323 3300049583 Bacteria 26159
212 Ga0501067_0004757 3300049583 Bacteria 7518
213 Ga0501067_0009451 3300049583 Bacteria 5403
214 Ga0501068_0002222 3300049584 Bacteria 10326
215 Ga0501068_0032360 3300049584 Bacteria 3110
216 Ga0501068_0037627 3300049584 Bacteria 2896
217 Ga0501069_0000679 3300049585 Bacteria 15824
218 Ga0501069_0003467 3300049585 Bacteria 8120
219 Ga0501070_0004712 3300049586 Bacteria 11687
220 Ga0501070_0024283 3300049586 Bacteria 5083
221 Ga0501070_0026695 3300049586 Bacteria 4844
222 Ga0501071_0054970 3300049587 Bacteria 2873
223 Ga0501072_0050393 3300049588 Bacteria 3278
224 Ga0501073_0000520 3300049589 Bacteria 26965
225 Ga0501073_0003010 3300049589 Bacteria 12627
226 Ga0501073_0006133 3300049589 Bacteria 8970
227 Ga0501073_0009258 3300049589 Bacteria 7264
228 Ga0501073_0024884 3300049589 Bacteria 4296
229 Ga0501074_0011402 3300049590 Bacteria 6462
230 Ga0501074_0050464 3300049590 Bacteria 3003
231 Ga0501077_0002130 3300049593 Bacteria 11949
232 Ga0501079_0002990 3300049741 Bacteria 12362
233 Ga0501079_0094448 3300049741 Bacteria 2317
234 Ga0501079_0136807 3300049741 Bacteria 1908
235 Ga0501079_0351422 3300049741 Bacteria 1155
236 Ga0501080_0000421 3300049742 Bacteria 32612
237 Ga0501080_0001116 3300049742 Bacteria 22115
238 Ga0501080_0005115 3300049742 Bacteria 11685
239 Ga0501080_0011134 3300049742 Bacteria 8234
240 Ga0501080_0028843 3300049742 Bacteria 5166
241 Ga0501083_0000277 3300049744 Bacteria 32515
242 Ga0501083_0031324 3300049744 Bacteria 3650
243 Ga0501266_011199 3300049763 Bacteria 1147
244 Ga0501035_0009427 3300049822 Bacteria 9076
245 Ga0501035_0018237 3300049822 Bacteria 6464
246 Ga0501035_0027652 3300049822 Bacteria 5183
247 Ga0501044_0031332 3300049823 Bacteria 5597
248 Ga0501044_0043475 3300049823 Bacteria 4666
249 Ga0501044_0091034 3300049823 Bacteria 3077
250 Ga0501044_0228459 3300049823 Bacteria 1809
251 nmdc:mga08x19_71937_c1 3300050514 Bacteria 2255
252 Ga0495595_0017255 3300053084 Bacteria 3105
253 Ga0500651_0000154 3300053093 Bacteria 43979
254 Ga0500651_0011299 3300053093 Bacteria 5382
255 Ga0500652_028118 3300053131 Bacteria 2181
256 Ga0500568_0000367 3300053139 Bacteria 34838
257 Ga0500620_002872 3300053155 Bacteria 3577
258 Ga0500622_0010133 3300053156 Bacteria 5186
259 Ga0501084_0022432 3300054114 Bacteria 5268
260 Ga0501084_0027267 3300054114 Bacteria 4774
261 Ga0501082_0000609 3300060353 Bacteria 31514
262 Ga0501082_0001406 3300060353 Bacteria 21188
263 Ga0501082_0014631 3300060353 Bacteria 6758

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10264791 Ga0105241_102647912 342
2 3300049763 Ga0501266_011199 Ga0501266_011199_20_1054 343
3 3300046507 Ga0495606_0000562 Ga0495606_0000562_38637_39713 358
4 3300046694 Ga0495649_0014075 Ga0495649_0014075_2232_3308 358
5 3300048918 Ga0496115_0000193 Ga0496115_0000193_33478_34554 358
6 3300049460 Ga0495682_0008232 Ga0495682_0008232_2139_3215 358
7 3300049741 Ga0501079_0351422 Ga0501079_0351422_30_1109 358
8 3300053131 Ga0500652_028118 Ga0500652_028118_17_1099 358
9 3300048920 Ga0496117_0128383 Ga0496117_0128383_450_1529 359
10 iso_pu_bacteria 2842780639 2842782049 374
11 3300049571 Ga0501034_0005075 Ga0501034_0005075_12945_14129 377
12 3300050514 nmdc:mga08x19_71937_c1 nmdc:mga08x19_71937_c1_956_2107 381
13 3300005468 Ga0070707_100198741 Ga0070707_1001987412 382
14 3300005536 Ga0070697_100036882 Ga0070697_1000368822 382
15 3300006237 Ga0097621_100012705 Ga0097621_1000127054 383
16 3300006358 Ga0068871_100034839 Ga0068871_1000348392 383
17 3300009551 Ga0105238_10004253 Ga0105238_100042538 383
18 3300013297 Ga0157378_10026522 Ga0157378_100265223 383
19 3300013308 Ga0157375_10182285 Ga0157375_101822852 383
20 3300025924 Ga0207694_10019790 Ga0207694_100197903 383
21 3300049583 Ga0501067_0004757 Ga0501067_0004757_5659_6822 384
22 3300049589 Ga0501073_0006133 Ga0501073_0006133_4368_5531 384
23 3300049593 Ga0501077_0002130 Ga0501077_0002130_8307_9470 384
24 3300049742 Ga0501080_0005115 Ga0501080_0005115_1805_2968 384
25 3300053156 Ga0500622_0010133 Ga0500622_0010133_2908_4071 384
26 3300054114 Ga0501084_0022432 Ga0501084_0022432_1784_2947 384
27 3300060353 Ga0501082_0000609 Ga0501082_0000609_2588_3751 384
28 iso_pu_bacteria 2842757796 2842759500 384
29 3300005355 Ga0070671_100002748 Ga0070671_1000027484 385
30 3300005365 Ga0070688_100070605 Ga0070688_1000706052 385
31 3300005455 Ga0070663_100010572 Ga0070663_1000105722 385
32 3300005548 Ga0070665_100013639 Ga0070665_1000136394 385
33 3300005548 Ga0070665_100193852 Ga0070665_1001938522 385
34 3300005843 Ga0068860_100016399 Ga0068860_1000163995 385
35 3300006028 Ga0070717_10123333 Ga0070717_101233331 385
36 3300006051 Ga0075364_10078527 Ga0075364_100785272 385
37 3300006881 Ga0068865_100070515 Ga0068865_1000705152 385
38 3300013296 Ga0157374_10201779 Ga0157374_102017792 385
39 3300014325 Ga0163163_10055588 Ga0163163_100555882 385
40 3300025913 Ga0207695_10023815 Ga0207695_100238156 385
41 3300025925 Ga0207650_10012334 Ga0207650_100123345 385
42 3300025931 Ga0207644_10003468 Ga0207644_100034687 385
43 3300025934 Ga0207686_10010628 Ga0207686_100106282 385
44 3300025938 Ga0207704_10004451 Ga0207704_100044515 385
45 3300025940 Ga0207691_10044460 Ga0207691_100444603 385
46 3300025961 Ga0207712_10159724 Ga0207712_101597241 385
47 3300026067 Ga0207678_10002061 Ga0207678_1000206115 385
48 3300026089 Ga0207648_10177038 Ga0207648_101770381 385
49 3300028379 Ga0268266_10243529 Ga0268266_102435291 385
50 3300028381 Ga0268264_10013160 Ga0268264_100131602 385
51 3300035119 Ga0373956_0045183 Ga0373956_0045183_473_1633 385
52 3300046454 Ga0495592_0015247 Ga0495592_0015247_4000_5160 385
53 3300046459 Ga0495629_0055141 Ga0495629_0055141_1324_2484 385
54 3300046472 Ga0495580_0059037 Ga0495580_0059037_986_2146 385
55 3300046473 Ga0495582_0022570 Ga0495582_0022570_1528_2688 385
56 3300046475 Ga0495639_0041940 Ga0495639_0041940_288_1448 385
57 3300046499 Ga0495594_0122076 Ga0495594_0122076_27_1187 385
58 3300046514 Ga0495618_0070680 Ga0495618_0070680_207_1367 385
59 3300046531 Ga0495665_0067680 Ga0495665_0067680_74_1234 385
60 3300046539 Ga0495621_0000203 Ga0495621_0000203_2882_4045 385
61 3300046543 Ga0495645_0107251 Ga0495645_0107251_202_1362 385
62 3300046663 Ga0495635_0044160 Ga0495635_0044160_1826_2986 385
63 3300046675 Ga0495657_0077576 Ga0495657_0077576_442_1602 385
64 3300046679 Ga0495623_0002598 Ga0495623_0002598_1032_2192 385
65 3300046683 Ga0495658_0004509 Ga0495658_0004509_5066_6226 385
66 3300047317 Ga0495604_0044423 Ga0495604_0044423_721_1881 385
67 3300047318 Ga0495636_0034663 Ga0495636_0034663_826_1989 385
68 3300047322 Ga0495680_0068274 Ga0495680_0068274_749_1909 385
69 3300047444 Ga0495675_0111633 Ga0495675_0111633_520_1680 385
70 3300047471 Ga0495684_0168119 Ga0495684_0168119_189_1349 385
71 3300048906 Ga0496103_0133938 Ga0496103_0133938_362_1519 385
72 3300048907 Ga0496104_0000109 Ga0496104_0000109_50793_51956 385
73 3300048908 Ga0496105_0000012 Ga0496105_0000012_26187_27350 385
74 3300048915 Ga0496112_0016331 Ga0496112_0016331_3528_4688 385
75 3300048921 Ga0496118_0000184 Ga0496118_0000184_52883_54052 385
76 3300048921 Ga0496118_0003995 Ga0496118_0003995_10243_11400 385
77 3300049568 Ga0501031_0046779 Ga0501031_0046779_736_1893 385
78 3300049569 Ga0501032_0016623 Ga0501032_0016623_988_2145 385
79 3300049570 Ga0501033_0017194 Ga0501033_0017194_3321_4478 385
80 3300049571 Ga0501034_0033790 Ga0501034_0033790_3040_4197 385
81 3300049572 Ga0501036_0010356 Ga0501036_0010356_5553_6710 385
82 3300049573 Ga0501037_0018129 Ga0501037_0018129_988_2145 385
83 3300049574 Ga0501038_0026626 Ga0501038_0026626_3014_4171 385
84 3300049575 Ga0501039_0006094 Ga0501039_0006094_3039_4196 385
85 3300049580 Ga0501046_0054128 Ga0501046_0054128_1022_2179 385
86 3300049580 Ga0501046_0134092 Ga0501046_0134092_73_1230 385
87 3300049581 Ga0501047_0030614 Ga0501047_0030614_3043_4200 385
88 3300049582 Ga0501048_0098016 Ga0501048_0098016_406_1563 385
89 3300049584 Ga0501068_0032360 Ga0501068_0032360_980_2137 385
90 3300049586 Ga0501070_0026695 Ga0501070_0026695_2700_3857 385
91 3300049589 Ga0501073_0009258 Ga0501073_0009258_988_2145 385
92 3300049590 Ga0501074_0050464 Ga0501074_0050464_988_2145 385
93 3300049741 Ga0501079_0136807 Ga0501079_0136807_617_1774 385
94 3300049742 Ga0501080_0028843 Ga0501080_0028843_988_2145 385
95 3300049822 Ga0501035_0027652 Ga0501035_0027652_3039_4196 385
96 3300049823 Ga0501044_0043475 Ga0501044_0043475_988_2145 385
97 3300049823 Ga0501044_0228459 Ga0501044_0228459_455_1612 385
98 3300053084 Ga0495595_0017255 Ga0495595_0017255_160_1320 385
99 3300053093 Ga0500651_0000154 Ga0500651_0000154_29325_30488 385
100 3300060353 Ga0501082_0001406 Ga0501082_0001406_5039_6196 385
101 iso_pu_bacteria 2643221579 2643906980 385
102 iso_pu_bacteria 2747842501 2748019005 385
103 iso_pu_bacteria 2923516293 2923519542 385
104 iso_pu_bacteria 2987605356 2987608875 385
105 3300005355 Ga0070671_100018190 Ga0070671_1000181904 386
106 3300005539 Ga0068853_100001164 Ga0068853_10000116411 386
107 3300005614 Ga0068856_100411989 Ga0068856_1004119891 386
108 3300005616 Ga0068852_100046538 Ga0068852_1000465381 386
109 3300013104 Ga0157370_10006138 Ga0157370_100061387 386
110 3300025931 Ga0207644_10028300 Ga0207644_100283002 386
111 3300026041 Ga0207639_10001038 Ga0207639_1000103810 386
112 3300026142 Ga0207698_10213149 Ga0207698_102131491 386
113 3300031251 Ga0265327_10001771 Ga0265327_1000177118 386
114 3300031730 Ga0307516_10078800 Ga0307516_100788003 386
115 3300048912 Ga0496109_0049500 Ga0496109_0049500_2077_3240 386
116 3300049569 Ga0501032_0002443 Ga0501032_0002443_12374_13534 386
117 3300049570 Ga0501033_0000348 Ga0501033_0000348_2730_3890 386
118 3300049571 Ga0501034_0001456 Ga0501034_0001456_25926_27086 386
119 3300049571 Ga0501034_0013484 Ga0501034_0013484_1236_2396 386
120 3300049572 Ga0501036_0002512 Ga0501036_0002512_4434_5594 386
121 3300049572 Ga0501036_0015939 Ga0501036_0015939_3348_4508 386
122 3300049573 Ga0501037_0003230 Ga0501037_0003230_245_1405 386
123 3300049574 Ga0501038_0063451 Ga0501038_0063451_1075_2235 386
124 3300049574 Ga0501038_0082824 Ga0501038_0082824_1370_2530 386
125 3300049574 Ga0501038_0088934 Ga0501038_0088934_997_2157 386
126 3300049575 Ga0501039_0018800 Ga0501039_0018800_2457_3617 386
127 3300049579 Ga0501043_0003809 Ga0501043_0003809_2681_3841 386
128 3300049579 Ga0501043_0160564 Ga0501043_0160564_95_1255 386
129 3300049580 Ga0501046_0005282 Ga0501046_0005282_8314_9474 386
130 3300049581 Ga0501047_0001202 Ga0501047_0001202_19832_20992 386
131 3300049581 Ga0501047_0054009 Ga0501047_0054009_2681_3841 386
132 3300049582 Ga0501048_0115335 Ga0501048_0115335_26_1186 386
133 3300049583 Ga0501067_0000323 Ga0501067_0000323_16695_17855 386
134 3300049584 Ga0501068_0037627 Ga0501068_0037627_1677_2837 386
135 3300049585 Ga0501069_0000679 Ga0501069_0000679_4623_5783 386
136 3300049586 Ga0501070_0004712 Ga0501070_0004712_6443_7603 386
137 3300049587 Ga0501071_0054970 Ga0501071_0054970_105_1265 386
138 3300049589 Ga0501073_0000520 Ga0501073_0000520_21463_22623 386
139 3300049589 Ga0501073_0003010 Ga0501073_0003010_8806_9966 386
140 3300049742 Ga0501080_0001116 Ga0501080_0001116_3722_4882 386
141 3300049744 Ga0501083_0000277 Ga0501083_0000277_11318_12478 386
142 3300053093 Ga0500651_0011299 Ga0500651_0011299_1153_2313 386
143 3300053155 Ga0500620_002872 Ga0500620_002872_26_1186 386
144 3300005289 Ga0065704_10070432 Ga0065704_100704322 387
145 3300005334 Ga0068869_100064068 Ga0068869_1000640682 387
146 3300005335 Ga0070666_10028013 Ga0070666_100280133 387
147 3300005336 Ga0070680_100114763 Ga0070680_1001147632 387
148 3300005366 Ga0070659_100026601 Ga0070659_1000266014 387
149 3300005530 Ga0070679_100095301 Ga0070679_1000953013 387
150 3300005535 Ga0070684_100056815 Ga0070684_1000568151 387
151 3300005539 Ga0068853_100045349 Ga0068853_1000453492 387
152 3300005578 Ga0068854_100048723 Ga0068854_1000487231 387
153 3300005614 Ga0068856_100007715 Ga0068856_1000077152 387
154 3300005614 Ga0068856_100072187 Ga0068856_1000721873 387
155 3300005617 Ga0068859_100001513 Ga0068859_1000015139 387
156 3300005842 Ga0068858_100038835 Ga0068858_1000388354 387
157 3300005844 Ga0068862_100001035 Ga0068862_10000103513 387
158 3300006237 Ga0097621_100085810 Ga0097621_1000858102 387
159 3300006358 Ga0068871_100022247 Ga0068871_1000222473 387
160 3300006358 Ga0068871_100024257 Ga0068871_1000242574 387
161 3300006881 Ga0068865_100055243 Ga0068865_1000552432 387
162 3300006931 Ga0097620_100001513 Ga0097620_10000151313 387
163 3300009093 Ga0105240_10056465 Ga0105240_100564654 387
164 3300009177 Ga0105248_10020716 Ga0105248_100207166 387
165 3300009551 Ga0105238_10039489 Ga0105238_100394892 387
166 3300010375 Ga0105239_10008484 Ga0105239_100084842 387
167 3300013105 Ga0157369_10001729 Ga0157369_1000172913 387
168 3300013105 Ga0157369_10004216 Ga0157369_100042165 387
169 3300013296 Ga0157374_10000538 Ga0157374_1000053817 387
170 3300013296 Ga0157374_10021970 Ga0157374_100219702 387
171 3300013297 Ga0157378_10166117 Ga0157378_101661171 387
172 3300013306 Ga0163162_10000017 Ga0163162_1000001716 387
173 3300013308 Ga0157375_10001992 Ga0157375_100019926 387
174 3300014325 Ga0163163_10000029 Ga0163163_10000029127 387
175 3300014969 Ga0157376_10173144 Ga0157376_101731442 387
176 3300021384 Ga0213876_10017051 Ga0213876_100170513 387
177 3300025292 Ga0209676_1000052 Ga0209676_100005247 387
178 3300025294 Ga0209025_1004686 Ga0209025_10046864 387
179 3300025903 Ga0207680_10124276 Ga0207680_101242762 387
180 3300025904 Ga0207647_10002622 Ga0207647_100026226 387
181 3300025911 Ga0207654_10000391 Ga0207654_1000039118 387
182 3300025913 Ga0207695_10002627 Ga0207695_100026279 387
183 3300025914 Ga0207671_10005357 Ga0207671_100053578 387
184 3300025940 Ga0207691_10230969 Ga0207691_102309691 387
185 3300025941 Ga0207711_10021180 Ga0207711_100211804 387
186 3300025949 Ga0207667_10002857 Ga0207667_1000285712 387
187 3300025981 Ga0207640_10208637 Ga0207640_102086372 387
188 3300026041 Ga0207639_10000455 Ga0207639_100004555 387
189 3300026078 Ga0207702_10042561 Ga0207702_100425614 387
190 3300026116 Ga0207674_10049210 Ga0207674_100492103 387
191 3300026121 Ga0207683_10131122 Ga0207683_101311222 387
192 3300026142 Ga0207698_10023858 Ga0207698_100238584 387
193 3300026142 Ga0207698_10138506 Ga0207698_101385062 387
194 3300028379 Ga0268266_10152720 Ga0268266_101527201 387
195 3300028380 Ga0268265_10000372 Ga0268265_1000037213 387
196 3300028381 Ga0268264_10014160 Ga0268264_100141602 387
197 3300031901 Ga0307406_10010696 Ga0307406_100106962 387
198 3300039437 Ga0436365_1756022 Ga0436365_1756022_5265_6437 387
199 3300041494 Ga0451837_0306698 Ga0451837_0306698_3998_5182 387
200 3300042006 Ga0439432_007466 Ga0439432_007466_947_2128 387
201 3300046615 Ga0495656_0004389 Ga0495656_0004389_270_1448 387
202 3300048918 Ga0496115_0000014 Ga0496115_0000014_92873_94036 387
203 3300048929 Ga0496126_0000047 Ga0496126_0000047_110655_111818 387
204 3300049572 Ga0501036_0066591 Ga0501036_0066591_1812_2981 387
205 3300049579 Ga0501043_0059907 Ga0501043_0059907_956_2119 387
206 3300049581 Ga0501047_0004649 Ga0501047_0004649_11613_12776 387
207 3300049741 Ga0501079_0094448 Ga0501079_0094448_238_1407 387
208 iso_pu_bacteria 8002869464 8002869828 387
209 3300005347 Ga0070668_100013024 Ga0070668_1000130242 388
210 3300010375 Ga0105239_10000033 Ga0105239_10000033131 388
211 3300031456 Ga0307513_10005508 Ga0307513_100055082 388
212 3300037312 Ga0395899_0053253 Ga0395899_0053253_392_1564 388
213 3300037418 Ga0395900_0020527 Ga0395900_0020527_2659_3831 388
214 3300037466 Ga0395898_0191245 Ga0395898_0191245_87_1259 388
215 3300037471 Ga0395905_0003783 Ga0395905_0003783_12014_13186 388
216 3300038443 Ga0395901_0007245 Ga0395901_0007245_3015_4187 388
217 3300041451 Ga0451791_0890502 Ga0451791_0890502_482_1669 388
218 3300046525 Ga0495663_0000265 Ga0495663_0000265_15835_17016 388
219 3300048925 Ga0496122_0014349 Ga0496122_0014349_5920_7101 388
220 3300048926 Ga0496123_0053791 Ga0496123_0053791_250_1431 388
221 3300049742 Ga0501080_0000421 Ga0501080_0000421_187_1353 388
222 3300005466 Ga0070685_10001362 Ga0070685_100013624 389
223 3300025272 Ga0209455_1005703 Ga0209455_10057032 389
224 3300032004 Ga0307414_10003716 Ga0307414_100037166 389
225 3300032004 Ga0307414_10007110 Ga0307414_100071103 389
226 3300032004 Ga0307414_10011970 Ga0307414_100119702 389
227 3300041451 Ga0451791_0534889 Ga0451791_0534889_117_1304 389
228 3300046471 Ga0495650_0000134 Ga0495650_0000134_99909_101078 389
229 3300048921 Ga0496118_0022053 Ga0496118_0022053_2929_4119 389
230 3300048925 Ga0496122_0000537 Ga0496122_0000537_35421_36605 389
231 3300048926 Ga0496123_0000987 Ga0496123_0000987_35272_36456 389
232 3300048926 Ga0496123_0009613 Ga0496123_0009613_303_1487 389
233 3300048929 Ga0496126_0003733 Ga0496126_0003733_10713_11882 389
234 3300049569 Ga0501032_0011139 Ga0501032_0011139_2645_3847 389
235 3300049571 Ga0501034_0003503 Ga0501034_0003503_2645_3847 389
236 3300049572 Ga0501036_0013840 Ga0501036_0013840_2889_4091 389
237 3300049573 Ga0501037_0018628 Ga0501037_0018628_1296_2498 389
238 3300049575 Ga0501039_0012881 Ga0501039_0012881_2613_3815 389
239 3300049578 Ga0501042_0072330 Ga0501042_0072330_776_1978 389
240 3300049579 Ga0501043_0006731 Ga0501043_0006731_5355_6557 389
241 3300049580 Ga0501046_0006283 Ga0501046_0006283_5333_6535 389
242 3300049581 Ga0501047_0019765 Ga0501047_0019765_2645_3847 389
243 3300049582 Ga0501048_0012473 Ga0501048_0012473_2597_3799 389
244 3300049583 Ga0501067_0009451 Ga0501067_0009451_3642_4844 389
245 3300049584 Ga0501068_0002222 Ga0501068_0002222_5421_6623 389
246 3300049585 Ga0501069_0003467 Ga0501069_0003467_2089_3291 389
247 3300049586 Ga0501070_0024283 Ga0501070_0024283_2618_3820 389
248 3300049588 Ga0501072_0050393 Ga0501072_0050393_1131_2333 389
249 3300049589 Ga0501073_0024884 Ga0501073_0024884_2645_3847 389
250 3300049590 Ga0501074_0011402 Ga0501074_0011402_2643_3845 389
251 3300049741 Ga0501079_0002990 Ga0501079_0002990_3832_5034 389
252 3300049742 Ga0501080_0011134 Ga0501080_0011134_4388_5590 389
253 3300049744 Ga0501083_0031324 Ga0501083_0031324_98_1300 389
254 3300049822 Ga0501035_0009427 Ga0501035_0009427_2948_4159 389
255 3300049822 Ga0501035_0018237 Ga0501035_0018237_2645_3847 389
256 3300049823 Ga0501044_0031332 Ga0501044_0031332_2645_3847 389
257 3300049823 Ga0501044_0091034 Ga0501044_0091034_626_1837 389
258 3300053139 Ga0500568_0000367 Ga0500568_0000367_7591_8760 389
259 3300054114 Ga0501084_0027267 Ga0501084_0027267_929_2131 389
260 3300060353 Ga0501082_0014631 Ga0501082_0014631_267_1469 389
261 3300025228 Ga0209672_100916 Ga0209672_1009168 391
262 3300005539 Ga0068853_100151334 Ga0068853_1001513342 392
263 3300026041 Ga0207639_10123156 Ga0207639_101231562 392
264 3300013306 Ga0163162_10006875 Ga0163162_100068754 395
265 3300013308 Ga0157375_10001695 Ga0157375_1000169514 395
266 3300025261 Ga0209233_1002533 Ga0209233_10025334 396
267 3300013296 Ga0157374_10287439 Ga0157374_102874391 408
268 3300003316 rootH1_10039347 rootH1_100393472 423
269 3300005466 Ga0070685_10000832 Ga0070685_100008329 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

1

358

0.99

PF00155

Aminotran_1_2

Aminotransferase class I and II

10

219

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e6g-assembly1.cif.gz_D crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.9346 44 419
3e6g-assembly1.cif.gz_B crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.9254 44 419
3e6g-assembly1.cif.gz_D crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.9244 44 419
3e6g-assembly1.cif.gz_B crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.9146 44 419
6k1o-assembly1.cif.gz_A apo form of a putative cystathionine gamma-lyase 0.9109 44 423
ID Description Score Start End Superfamily
3e6gD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.967 44 286 3.40.640.10
3e6gD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9534 44 286 3.40.640.10
af_A0A0P0WV19_29_251_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9081 99 236 3.40.640.10
af_A0A0P0VYR6_1_109_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9033 181 289 3.40.640.10
1pffB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8956 98 289 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A529ZDV4-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9793 125 236 GO:0003962
GO:0004123
GO:0005737
GO:0008483
GO:0019343
GO:0019346
GO:0030170
AF-A0A1Q8BJP4-F1-model_v4 Cystathionine beta-lyase 0.9718 101 355 GO:0003962
GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-A0A529ZDV4-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9708 125 236 GO:0003962
GO:0004123
GO:0005737
GO:0008483
GO:0019343
GO:0019346
GO:0030170
AF-A0A544VQ81-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9656 99 236 GO:0003962
GO:0004123
GO:0005737
GO:0008483
GO:0009086
GO:0019343
GO:0019346
GO:0030170
AF-A0A377VBL2-F1-model_v4 Cystathionine gamma-lyase (EC 4.4.1.8) 0.9622 142 367 GO:0003962
GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170

Feature Viewer

pLDDT pTM Quality
78.6 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map