F376445
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 169 | 263 | 388 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0000562|Ga0495606_0000562_38637_39713 |
| Length | 358 |
| Sequence | MTPIYATSTYVQESPGKHKGYEYSRTQNPTRMAYERCVAELEGGKAGFAFGSGLAAAATVLDMLDSGSHVIAMDDLYGGTYRLFERVRRRSAGLDFTFVDLNDASALKAALKPNTRMIWAETPTNPMLKLVDLAKLAAFAKKHGLLLVVDNTFCSPMLQRPLEYGADLVLHSATKYLNGHSDMVGGIVVAGTQELAEQMAFLQNSVGAVSGPFDAFLAMRGLKTLHLRMRAHCESAMELARWLEAHPAIERVIYPGLKSHPQHQLAKRQMDGFGGIISVEVKGGLKKARRVLERCNLFALAESLGGVESLIEHPAIMTHASVPLANRKRLGISDSLIRLSVGVEDLRDLQNELAAALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 2 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 3 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 4 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 5 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 6 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 51 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 82 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 83 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 84 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 85 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 86 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 88 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 93 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 94 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 95 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 121 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 122 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 123 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 125 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 126 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 127 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 128 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 129 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 130 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 131 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 158 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 163 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 164 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 165 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 166 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 167 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 0 |
| Isolates | 2.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.46 |
| Nodule | 0 |
| Rhizoplane | 3.35 |
| Rhizosphere | 83.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10039347 | 3300003316 | Bacteria | 17782 |
| 2 | rootH1_10039347 | 3300003323 | Bacteria | 1765 |
| 3 | Ga0065704_10070432 | 3300005289 | Bacteria | 25018 |
| 4 | Ga0068869_100064068 | 3300005334 | Bacteria | 2703 |
| 5 | Ga0070666_10028013 | 3300005335 | Bacteria | 3694 |
| 6 | Ga0070680_100114763 | 3300005336 | Bacteria | 2244 |
| 7 | Ga0070668_100013024 | 3300005347 | Bacteria | 6193 |
| 8 | Ga0070671_100002748 | 3300005355 | Bacteria | 13664 |
| 9 | Ga0070671_100018190 | 3300005355 | Bacteria | 5705 |
| 10 | Ga0070688_100070605 | 3300005365 | Bacteria | 2234 |
| 11 | Ga0070659_100026601 | 3300005366 | Bacteria | 4453 |
| 12 | Ga0070663_100010572 | 3300005455 | Bacteria | 5756 |
| 13 | Ga0070685_10000832 | 3300005466 | Bacteria | 16796 |
| 14 | Ga0070685_10001362 | 3300005466 | Bacteria | 12825 |
| 15 | Ga0070707_100198741 | 3300005468 | Bacteria | 1954 |
| 16 | Ga0070679_100095301 | 3300005530 | Bacteria | 2964 |
| 17 | Ga0070684_100056815 | 3300005535 | Bacteria | 3416 |
| 18 | Ga0070697_100036882 | 3300005536 | Bacteria | 3949 |
| 19 | Ga0068853_100001164 | 3300005539 | Bacteria | 18703 |
| 20 | Ga0068853_100045349 | 3300005539 | Bacteria | 3765 |
| 21 | Ga0068853_100151334 | 3300005539 | Bacteria | 2089 |
| 22 | Ga0070665_100013639 | 3300005548 | Bacteria | 8174 |
| 23 | Ga0070665_100193852 | 3300005548 | Bacteria | 2032 |
| 24 | Ga0068854_100048723 | 3300005578 | Bacteria | 3024 |
| 25 | Ga0068856_100007715 | 3300005614 | Bacteria | 10505 |
| 26 | Ga0068856_100072187 | 3300005614 | Bacteria | 3417 |
| 27 | Ga0068856_100411989 | 3300005614 | Bacteria | 1371 |
| 28 | Ga0068852_100046538 | 3300005616 | Bacteria | 3697 |
| 29 | Ga0068859_100001513 | 3300005617 | Bacteria | 23736 |
| 30 | Ga0068858_100038835 | 3300005842 | Bacteria | 4415 |
| 31 | Ga0068860_100016399 | 3300005843 | Bacteria | 7223 |
| 32 | Ga0068862_100001035 | 3300005844 | Bacteria | 26724 |
| 33 | Ga0070717_10123333 | 3300006028 | Bacteria | 2222 |
| 34 | Ga0075364_10078527 | 3300006051 | Bacteria | 2180 |
| 35 | Ga0097621_100012705 | 3300006237 | Bacteria | 6256 |
| 36 | Ga0097621_100085810 | 3300006237 | Bacteria | 2626 |
| 37 | Ga0068871_100022247 | 3300006358 | Bacteria | 4888 |
| 38 | Ga0068871_100024257 | 3300006358 | Bacteria | 4701 |
| 39 | Ga0068871_100034839 | 3300006358 | Bacteria | 3997 |
| 40 | Ga0068865_100055243 | 3300006881 | Bacteria | 2762 |
| 41 | Ga0068865_100070515 | 3300006881 | Bacteria | 2476 |
| 42 | Ga0097620_100001513 | 3300006931 | Bacteria | 23736 |
| 43 | Ga0105240_10056465 | 3300009093 | Bacteria | 4913 |
| 44 | Ga0105241_10264791 | 3300009174 | Bacteria | 1462 |
| 45 | Ga0105248_10020716 | 3300009177 | Bacteria | 7286 |
| 46 | Ga0105238_10004253 | 3300009551 | Bacteria | 14227 |
| 47 | Ga0105238_10039489 | 3300009551 | Bacteria | 4786 |
| 48 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 49 | Ga0105239_10008484 | 3300010375 | Bacteria | 11682 |
| 50 | Ga0157370_10006138 | 3300013104 | Bacteria | 13332 |
| 51 | Ga0157369_10001729 | 3300013105 | Bacteria | 26531 |
| 52 | Ga0157369_10004216 | 3300013105 | Bacteria | 17028 |
| 53 | Ga0157374_10000538 | 3300013296 | Bacteria | 33948 |
| 54 | Ga0157374_10021970 | 3300013296 | Bacteria | 5685 |
| 55 | Ga0157374_10201779 | 3300013296 | Bacteria | 1947 |
| 56 | Ga0157374_10287439 | 3300013296 | Bacteria | 1624 |
| 57 | Ga0157378_10026522 | 3300013297 | Bacteria | 5107 |
| 58 | Ga0157378_10166117 | 3300013297 | Bacteria | 2067 |
| 59 | Ga0163162_10000017 | 3300013306 | Bacteria | 233474 |
| 60 | Ga0163162_10006875 | 3300013306 | Bacteria | 11040 |
| 61 | Ga0157375_10001695 | 3300013308 | Bacteria | 18933 |
| 62 | Ga0157375_10001992 | 3300013308 | Bacteria | 17624 |
| 63 | Ga0157375_10182285 | 3300013308 | Bacteria | 2252 |
| 64 | Ga0163163_10000029 | 3300014325 | Bacteria | 174973 |
| 65 | Ga0163163_10055588 | 3300014325 | Bacteria | 3912 |
| 66 | Ga0157376_10173144 | 3300014969 | Bacteria | 1967 |
| 67 | Ga0213876_10017051 | 3300021384 | Bacteria | 3837 |
| 68 | Ga0209672_100916 | 3300025228 | Bacteria | 13362 |
| 69 | Ga0209233_1002533 | 3300025261 | Bacteria | 6676 |
| 70 | Ga0209455_1005703 | 3300025272 | Bacteria | 3797 |
| 71 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 72 | Ga0209025_1004686 | 3300025294 | Bacteria | 11676 |
| 73 | Ga0207680_10124276 | 3300025903 | Bacteria | 1692 |
| 74 | Ga0207647_10002622 | 3300025904 | Bacteria | 13595 |
| 75 | Ga0207654_10000391 | 3300025911 | Bacteria | 25490 |
| 76 | Ga0207695_10002627 | 3300025913 | Bacteria | 26289 |
| 77 | Ga0207695_10023815 | 3300025913 | Bacteria | 6910 |
| 78 | Ga0207671_10005357 | 3300025914 | Bacteria | 11864 |
| 79 | Ga0207694_10019790 | 3300025924 | Bacteria | 5092 |
| 80 | Ga0207650_10012334 | 3300025925 | Bacteria | 5899 |
| 81 | Ga0207644_10003468 | 3300025931 | Bacteria | 10194 |
| 82 | Ga0207644_10028300 | 3300025931 | Bacteria | 3878 |
| 83 | Ga0207686_10010628 | 3300025934 | Bacteria | 5016 |
| 84 | Ga0207704_10004451 | 3300025938 | Bacteria | 6406 |
| 85 | Ga0207691_10044460 | 3300025940 | Bacteria | 4089 |
| 86 | Ga0207691_10230969 | 3300025940 | Bacteria | 1602 |
| 87 | Ga0207711_10021180 | 3300025941 | Bacteria | 5429 |
| 88 | Ga0207667_10002857 | 3300025949 | Bacteria | 21430 |
| 89 | Ga0207712_10159724 | 3300025961 | Bacteria | 1750 |
| 90 | Ga0207640_10208637 | 3300025981 | Bacteria | 1486 |
| 91 | Ga0207639_10000455 | 3300026041 | Bacteria | 28193 |
| 92 | Ga0207639_10001038 | 3300026041 | Bacteria | 18865 |
| 93 | Ga0207639_10123156 | 3300026041 | Bacteria | 2134 |
| 94 | Ga0207678_10002061 | 3300026067 | Bacteria | 18229 |
| 95 | Ga0207702_10042561 | 3300026078 | Bacteria | 3810 |
| 96 | Ga0207648_10177038 | 3300026089 | Bacteria | 1887 |
| 97 | Ga0207674_10049210 | 3300026116 | Bacteria | 4312 |
| 98 | Ga0207683_10131122 | 3300026121 | Bacteria | 2255 |
| 99 | Ga0207698_10023858 | 3300026142 | Bacteria | 4282 |
| 100 | Ga0207698_10138506 | 3300026142 | Bacteria | 2092 |
| 101 | Ga0207698_10213149 | 3300026142 | Bacteria | 1739 |
| 102 | Ga0268266_10152720 | 3300028379 | Bacteria | 2083 |
| 103 | Ga0268266_10243529 | 3300028379 | Bacteria | 1660 |
| 104 | Ga0268265_10000372 | 3300028380 | Bacteria | 48383 |
| 105 | Ga0268264_10013160 | 3300028381 | Bacteria | 6805 |
| 106 | Ga0268264_10014160 | 3300028381 | Bacteria | 6559 |
| 107 | Ga0265327_10001771 | 3300031251 | Bacteria | 25517 |
| 108 | Ga0307513_10005508 | 3300031456 | Bacteria | 16712 |
| 109 | Ga0307516_10078800 | 3300031730 | Bacteria | 3140 |
| 110 | Ga0307406_10010696 | 3300031901 | Bacteria | 5183 |
| 111 | Ga0307414_10003716 | 3300032004 | Bacteria | 8185 |
| 112 | Ga0307414_10007110 | 3300032004 | Bacteria | 6280 |
| 113 | Ga0307414_10011970 | 3300032004 | Bacteria | 5114 |
| 114 | Ga0373956_0045183 | 3300035119 | Bacteria | 1965 |
| 115 | Ga0395899_0053253 | 3300037312 | Bacteria | 2997 |
| 116 | Ga0395900_0020527 | 3300037418 | Bacteria | 6745 |
| 117 | Ga0395898_0191245 | 3300037466 | Bacteria | 1955 |
| 118 | Ga0395905_0003783 | 3300037471 | Bacteria | 16014 |
| 119 | Ga0395901_0007245 | 3300038443 | Bacteria | 11190 |
| 120 | Ga0436365_1756022 | 3300039437 | Bacteria | 12858 |
| 121 | Ga0451791_0534889 | 3300041451 | Bacteria | 1765 |
| 122 | Ga0451791_0890502 | 3300041451 | Bacteria | 2128 |
| 123 | Ga0451837_0306698 | 3300041494 | Bacteria | 7218 |
| 124 | Ga0439432_007466 | 3300042006 | Bacteria | 3874 |
| 125 | Ga0495592_0015247 | 3300046454 | Bacteria | 5834 |
| 126 | Ga0495629_0055141 | 3300046459 | Bacteria | 2780 |
| 127 | Ga0495650_0000134 | 3300046471 | Bacteria | 173331 |
| 128 | Ga0495580_0059037 | 3300046472 | Bacteria | 2696 |
| 129 | Ga0495582_0022570 | 3300046473 | Bacteria | 3445 |
| 130 | Ga0495639_0041940 | 3300046475 | Bacteria | 2062 |
| 131 | Ga0495594_0122076 | 3300046499 | Bacteria | 1473 |
| 132 | Ga0495606_0000562 | 3300046507 | Bacteria | 59044 |
| 133 | Ga0495618_0070680 | 3300046514 | Bacteria | 2220 |
| 134 | Ga0495663_0000265 | 3300046525 | Bacteria | 20102 |
| 135 | Ga0495665_0067680 | 3300046531 | Bacteria | 1884 |
| 136 | Ga0495621_0000203 | 3300046539 | Bacteria | 13807 |
| 137 | Ga0495645_0107251 | 3300046543 | Bacteria | 1980 |
| 138 | Ga0495656_0004389 | 3300046615 | Bacteria | 4828 |
| 139 | Ga0495635_0044160 | 3300046663 | Bacteria | 3075 |
| 140 | Ga0495657_0077576 | 3300046675 | Bacteria | 2155 |
| 141 | Ga0495623_0002598 | 3300046679 | Bacteria | 11923 |
| 142 | Ga0495658_0004509 | 3300046683 | Bacteria | 6847 |
| 143 | Ga0495649_0014075 | 3300046694 | Bacteria | 4595 |
| 144 | Ga0495604_0044423 | 3300047317 | Bacteria | 3471 |
| 145 | Ga0495636_0034663 | 3300047318 | Bacteria | 2078 |
| 146 | Ga0495680_0068274 | 3300047322 | Bacteria | 2716 |
| 147 | Ga0495675_0111633 | 3300047444 | Bacteria | 1706 |
| 148 | Ga0495684_0168119 | 3300047471 | Bacteria | 1632 |
| 149 | Ga0496103_0133938 | 3300048906 | Bacteria | 1583 |
| 150 | Ga0496104_0000109 | 3300048907 | Bacteria | 78168 |
| 151 | Ga0496105_0000012 | 3300048908 | Bacteria | 261713 |
| 152 | Ga0496109_0049500 | 3300048912 | Bacteria | 3825 |
| 153 | Ga0496112_0016331 | 3300048915 | Bacteria | 6952 |
| 154 | Ga0496115_0000014 | 3300048918 | Bacteria | 204935 |
| 155 | Ga0496115_0000193 | 3300048918 | Bacteria | 56720 |
| 156 | Ga0496117_0128383 | 3300048920 | Bacteria | 1542 |
| 157 | Ga0496118_0000184 | 3300048921 | Bacteria | 109873 |
| 158 | Ga0496118_0003995 | 3300048921 | Bacteria | 17974 |
| 159 | Ga0496118_0022053 | 3300048921 | Bacteria | 5583 |
| 160 | Ga0496122_0000537 | 3300048925 | Bacteria | 78505 |
| 161 | Ga0496122_0014349 | 3300048925 | Bacteria | 7668 |
| 162 | Ga0496123_0000987 | 3300048926 | Bacteria | 43765 |
| 163 | Ga0496123_0009613 | 3300048926 | Bacteria | 8680 |
| 164 | Ga0496123_0053791 | 3300048926 | Bacteria | 2657 |
| 165 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 166 | Ga0496126_0003733 | 3300048929 | Bacteria | 18974 |
| 167 | Ga0495682_0008232 | 3300049460 | Bacteria | 4118 |
| 168 | Ga0501031_0046779 | 3300049568 | Bacteria | 2821 |
| 169 | Ga0501032_0002443 | 3300049569 | Bacteria | 14510 |
| 170 | Ga0501032_0011139 | 3300049569 | Bacteria | 6464 |
| 171 | Ga0501032_0016623 | 3300049569 | Bacteria | 5172 |
| 172 | Ga0501033_0000348 | 3300049570 | Bacteria | 43990 |
| 173 | Ga0501033_0017194 | 3300049570 | Bacteria | 5465 |
| 174 | Ga0501034_0001456 | 3300049571 | Bacteria | 31331 |
| 175 | Ga0501034_0003503 | 3300049571 | Bacteria | 17820 |
| 176 | Ga0501034_0005075 | 3300049571 | Bacteria | 14459 |
| 177 | Ga0501034_0013484 | 3300049571 | Bacteria | 8413 |
| 178 | Ga0501034_0033790 | 3300049571 | Bacteria | 5184 |
| 179 | Ga0501036_0002512 | 3300049572 | Bacteria | 14389 |
| 180 | Ga0501036_0010356 | 3300049572 | Bacteria | 7697 |
| 181 | Ga0501036_0013840 | 3300049572 | Bacteria | 6708 |
| 182 | Ga0501036_0015939 | 3300049572 | Bacteria | 6277 |
| 183 | Ga0501036_0066591 | 3300049572 | Bacteria | 3048 |
| 184 | Ga0501037_0003230 | 3300049573 | Bacteria | 11814 |
| 185 | Ga0501037_0018129 | 3300049573 | Bacteria | 5186 |
| 186 | Ga0501037_0018628 | 3300049573 | Bacteria | 5115 |
| 187 | Ga0501038_0026626 | 3300049574 | Bacteria | 5149 |
| 188 | Ga0501038_0063451 | 3300049574 | Bacteria | 3153 |
| 189 | Ga0501038_0082824 | 3300049574 | Bacteria | 2701 |
| 190 | Ga0501038_0088934 | 3300049574 | Bacteria | 2591 |
| 191 | Ga0501039_0006094 | 3300049575 | Bacteria | 9154 |
| 192 | Ga0501039_0012881 | 3300049575 | Bacteria | 6395 |
| 193 | Ga0501039_0018800 | 3300049575 | Bacteria | 5303 |
| 194 | Ga0501042_0072330 | 3300049578 | Bacteria | 2467 |
| 195 | Ga0501043_0003809 | 3300049579 | Bacteria | 12408 |
| 196 | Ga0501043_0006731 | 3300049579 | Bacteria | 9174 |
| 197 | Ga0501043_0059907 | 3300049579 | Bacteria | 2988 |
| 198 | Ga0501043_0160564 | 3300049579 | Bacteria | 1756 |
| 199 | Ga0501046_0005282 | 3300049580 | Bacteria | 11553 |
| 200 | Ga0501046_0006283 | 3300049580 | Bacteria | 10535 |
| 201 | Ga0501046_0054128 | 3300049580 | Bacteria | 3158 |
| 202 | Ga0501046_0134092 | 3300049580 | Bacteria | 1877 |
| 203 | Ga0501047_0001202 | 3300049581 | Bacteria | 25643 |
| 204 | Ga0501047_0004649 | 3300049581 | Bacteria | 12914 |
| 205 | Ga0501047_0019765 | 3300049581 | Bacteria | 6464 |
| 206 | Ga0501047_0030614 | 3300049581 | Bacteria | 5187 |
| 207 | Ga0501047_0054009 | 3300049581 | Bacteria | 3886 |
| 208 | Ga0501048_0012473 | 3300049582 | Bacteria | 6322 |
| 209 | Ga0501048_0098016 | 3300049582 | Bacteria | 2068 |
| 210 | Ga0501048_0115335 | 3300049582 | Bacteria | 1898 |
| 211 | Ga0501067_0000323 | 3300049583 | Bacteria | 26159 |
| 212 | Ga0501067_0004757 | 3300049583 | Bacteria | 7518 |
| 213 | Ga0501067_0009451 | 3300049583 | Bacteria | 5403 |
| 214 | Ga0501068_0002222 | 3300049584 | Bacteria | 10326 |
| 215 | Ga0501068_0032360 | 3300049584 | Bacteria | 3110 |
| 216 | Ga0501068_0037627 | 3300049584 | Bacteria | 2896 |
| 217 | Ga0501069_0000679 | 3300049585 | Bacteria | 15824 |
| 218 | Ga0501069_0003467 | 3300049585 | Bacteria | 8120 |
| 219 | Ga0501070_0004712 | 3300049586 | Bacteria | 11687 |
| 220 | Ga0501070_0024283 | 3300049586 | Bacteria | 5083 |
| 221 | Ga0501070_0026695 | 3300049586 | Bacteria | 4844 |
| 222 | Ga0501071_0054970 | 3300049587 | Bacteria | 2873 |
| 223 | Ga0501072_0050393 | 3300049588 | Bacteria | 3278 |
| 224 | Ga0501073_0000520 | 3300049589 | Bacteria | 26965 |
| 225 | Ga0501073_0003010 | 3300049589 | Bacteria | 12627 |
| 226 | Ga0501073_0006133 | 3300049589 | Bacteria | 8970 |
| 227 | Ga0501073_0009258 | 3300049589 | Bacteria | 7264 |
| 228 | Ga0501073_0024884 | 3300049589 | Bacteria | 4296 |
| 229 | Ga0501074_0011402 | 3300049590 | Bacteria | 6462 |
| 230 | Ga0501074_0050464 | 3300049590 | Bacteria | 3003 |
| 231 | Ga0501077_0002130 | 3300049593 | Bacteria | 11949 |
| 232 | Ga0501079_0002990 | 3300049741 | Bacteria | 12362 |
| 233 | Ga0501079_0094448 | 3300049741 | Bacteria | 2317 |
| 234 | Ga0501079_0136807 | 3300049741 | Bacteria | 1908 |
| 235 | Ga0501079_0351422 | 3300049741 | Bacteria | 1155 |
| 236 | Ga0501080_0000421 | 3300049742 | Bacteria | 32612 |
| 237 | Ga0501080_0001116 | 3300049742 | Bacteria | 22115 |
| 238 | Ga0501080_0005115 | 3300049742 | Bacteria | 11685 |
| 239 | Ga0501080_0011134 | 3300049742 | Bacteria | 8234 |
| 240 | Ga0501080_0028843 | 3300049742 | Bacteria | 5166 |
| 241 | Ga0501083_0000277 | 3300049744 | Bacteria | 32515 |
| 242 | Ga0501083_0031324 | 3300049744 | Bacteria | 3650 |
| 243 | Ga0501266_011199 | 3300049763 | Bacteria | 1147 |
| 244 | Ga0501035_0009427 | 3300049822 | Bacteria | 9076 |
| 245 | Ga0501035_0018237 | 3300049822 | Bacteria | 6464 |
| 246 | Ga0501035_0027652 | 3300049822 | Bacteria | 5183 |
| 247 | Ga0501044_0031332 | 3300049823 | Bacteria | 5597 |
| 248 | Ga0501044_0043475 | 3300049823 | Bacteria | 4666 |
| 249 | Ga0501044_0091034 | 3300049823 | Bacteria | 3077 |
| 250 | Ga0501044_0228459 | 3300049823 | Bacteria | 1809 |
| 251 | nmdc:mga08x19_71937_c1 | 3300050514 | Bacteria | 2255 |
| 252 | Ga0495595_0017255 | 3300053084 | Bacteria | 3105 |
| 253 | Ga0500651_0000154 | 3300053093 | Bacteria | 43979 |
| 254 | Ga0500651_0011299 | 3300053093 | Bacteria | 5382 |
| 255 | Ga0500652_028118 | 3300053131 | Bacteria | 2181 |
| 256 | Ga0500568_0000367 | 3300053139 | Bacteria | 34838 |
| 257 | Ga0500620_002872 | 3300053155 | Bacteria | 3577 |
| 258 | Ga0500622_0010133 | 3300053156 | Bacteria | 5186 |
| 259 | Ga0501084_0022432 | 3300054114 | Bacteria | 5268 |
| 260 | Ga0501084_0027267 | 3300054114 | Bacteria | 4774 |
| 261 | Ga0501082_0000609 | 3300060353 | Bacteria | 31514 |
| 262 | Ga0501082_0001406 | 3300060353 | Bacteria | 21188 |
| 263 | Ga0501082_0014631 | 3300060353 | Bacteria | 6758 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009174 | Ga0105241_10264791 | Ga0105241_102647912 | 342 |
| 2 | 3300049763 | Ga0501266_011199 | Ga0501266_011199_20_1054 | 343 |
| 3 | 3300046507 | Ga0495606_0000562 | Ga0495606_0000562_38637_39713 | 358 |
| 4 | 3300046694 | Ga0495649_0014075 | Ga0495649_0014075_2232_3308 | 358 |
| 5 | 3300048918 | Ga0496115_0000193 | Ga0496115_0000193_33478_34554 | 358 |
| 6 | 3300049460 | Ga0495682_0008232 | Ga0495682_0008232_2139_3215 | 358 |
| 7 | 3300049741 | Ga0501079_0351422 | Ga0501079_0351422_30_1109 | 358 |
| 8 | 3300053131 | Ga0500652_028118 | Ga0500652_028118_17_1099 | 358 |
| 9 | 3300048920 | Ga0496117_0128383 | Ga0496117_0128383_450_1529 | 359 |
| 10 | iso_pu_bacteria | 2842780639 | 2842782049 | 374 |
| 11 | 3300049571 | Ga0501034_0005075 | Ga0501034_0005075_12945_14129 | 377 |
| 12 | 3300050514 | nmdc:mga08x19_71937_c1 | nmdc:mga08x19_71937_c1_956_2107 | 381 |
| 13 | 3300005468 | Ga0070707_100198741 | Ga0070707_1001987412 | 382 |
| 14 | 3300005536 | Ga0070697_100036882 | Ga0070697_1000368822 | 382 |
| 15 | 3300006237 | Ga0097621_100012705 | Ga0097621_1000127054 | 383 |
| 16 | 3300006358 | Ga0068871_100034839 | Ga0068871_1000348392 | 383 |
| 17 | 3300009551 | Ga0105238_10004253 | Ga0105238_100042538 | 383 |
| 18 | 3300013297 | Ga0157378_10026522 | Ga0157378_100265223 | 383 |
| 19 | 3300013308 | Ga0157375_10182285 | Ga0157375_101822852 | 383 |
| 20 | 3300025924 | Ga0207694_10019790 | Ga0207694_100197903 | 383 |
| 21 | 3300049583 | Ga0501067_0004757 | Ga0501067_0004757_5659_6822 | 384 |
| 22 | 3300049589 | Ga0501073_0006133 | Ga0501073_0006133_4368_5531 | 384 |
| 23 | 3300049593 | Ga0501077_0002130 | Ga0501077_0002130_8307_9470 | 384 |
| 24 | 3300049742 | Ga0501080_0005115 | Ga0501080_0005115_1805_2968 | 384 |
| 25 | 3300053156 | Ga0500622_0010133 | Ga0500622_0010133_2908_4071 | 384 |
| 26 | 3300054114 | Ga0501084_0022432 | Ga0501084_0022432_1784_2947 | 384 |
| 27 | 3300060353 | Ga0501082_0000609 | Ga0501082_0000609_2588_3751 | 384 |
| 28 | iso_pu_bacteria | 2842757796 | 2842759500 | 384 |
| 29 | 3300005355 | Ga0070671_100002748 | Ga0070671_1000027484 | 385 |
| 30 | 3300005365 | Ga0070688_100070605 | Ga0070688_1000706052 | 385 |
| 31 | 3300005455 | Ga0070663_100010572 | Ga0070663_1000105722 | 385 |
| 32 | 3300005548 | Ga0070665_100013639 | Ga0070665_1000136394 | 385 |
| 33 | 3300005548 | Ga0070665_100193852 | Ga0070665_1001938522 | 385 |
| 34 | 3300005843 | Ga0068860_100016399 | Ga0068860_1000163995 | 385 |
| 35 | 3300006028 | Ga0070717_10123333 | Ga0070717_101233331 | 385 |
| 36 | 3300006051 | Ga0075364_10078527 | Ga0075364_100785272 | 385 |
| 37 | 3300006881 | Ga0068865_100070515 | Ga0068865_1000705152 | 385 |
| 38 | 3300013296 | Ga0157374_10201779 | Ga0157374_102017792 | 385 |
| 39 | 3300014325 | Ga0163163_10055588 | Ga0163163_100555882 | 385 |
| 40 | 3300025913 | Ga0207695_10023815 | Ga0207695_100238156 | 385 |
| 41 | 3300025925 | Ga0207650_10012334 | Ga0207650_100123345 | 385 |
| 42 | 3300025931 | Ga0207644_10003468 | Ga0207644_100034687 | 385 |
| 43 | 3300025934 | Ga0207686_10010628 | Ga0207686_100106282 | 385 |
| 44 | 3300025938 | Ga0207704_10004451 | Ga0207704_100044515 | 385 |
| 45 | 3300025940 | Ga0207691_10044460 | Ga0207691_100444603 | 385 |
| 46 | 3300025961 | Ga0207712_10159724 | Ga0207712_101597241 | 385 |
| 47 | 3300026067 | Ga0207678_10002061 | Ga0207678_1000206115 | 385 |
| 48 | 3300026089 | Ga0207648_10177038 | Ga0207648_101770381 | 385 |
| 49 | 3300028379 | Ga0268266_10243529 | Ga0268266_102435291 | 385 |
| 50 | 3300028381 | Ga0268264_10013160 | Ga0268264_100131602 | 385 |
| 51 | 3300035119 | Ga0373956_0045183 | Ga0373956_0045183_473_1633 | 385 |
| 52 | 3300046454 | Ga0495592_0015247 | Ga0495592_0015247_4000_5160 | 385 |
| 53 | 3300046459 | Ga0495629_0055141 | Ga0495629_0055141_1324_2484 | 385 |
| 54 | 3300046472 | Ga0495580_0059037 | Ga0495580_0059037_986_2146 | 385 |
| 55 | 3300046473 | Ga0495582_0022570 | Ga0495582_0022570_1528_2688 | 385 |
| 56 | 3300046475 | Ga0495639_0041940 | Ga0495639_0041940_288_1448 | 385 |
| 57 | 3300046499 | Ga0495594_0122076 | Ga0495594_0122076_27_1187 | 385 |
| 58 | 3300046514 | Ga0495618_0070680 | Ga0495618_0070680_207_1367 | 385 |
| 59 | 3300046531 | Ga0495665_0067680 | Ga0495665_0067680_74_1234 | 385 |
| 60 | 3300046539 | Ga0495621_0000203 | Ga0495621_0000203_2882_4045 | 385 |
| 61 | 3300046543 | Ga0495645_0107251 | Ga0495645_0107251_202_1362 | 385 |
| 62 | 3300046663 | Ga0495635_0044160 | Ga0495635_0044160_1826_2986 | 385 |
| 63 | 3300046675 | Ga0495657_0077576 | Ga0495657_0077576_442_1602 | 385 |
| 64 | 3300046679 | Ga0495623_0002598 | Ga0495623_0002598_1032_2192 | 385 |
| 65 | 3300046683 | Ga0495658_0004509 | Ga0495658_0004509_5066_6226 | 385 |
| 66 | 3300047317 | Ga0495604_0044423 | Ga0495604_0044423_721_1881 | 385 |
| 67 | 3300047318 | Ga0495636_0034663 | Ga0495636_0034663_826_1989 | 385 |
| 68 | 3300047322 | Ga0495680_0068274 | Ga0495680_0068274_749_1909 | 385 |
| 69 | 3300047444 | Ga0495675_0111633 | Ga0495675_0111633_520_1680 | 385 |
| 70 | 3300047471 | Ga0495684_0168119 | Ga0495684_0168119_189_1349 | 385 |
| 71 | 3300048906 | Ga0496103_0133938 | Ga0496103_0133938_362_1519 | 385 |
| 72 | 3300048907 | Ga0496104_0000109 | Ga0496104_0000109_50793_51956 | 385 |
| 73 | 3300048908 | Ga0496105_0000012 | Ga0496105_0000012_26187_27350 | 385 |
| 74 | 3300048915 | Ga0496112_0016331 | Ga0496112_0016331_3528_4688 | 385 |
| 75 | 3300048921 | Ga0496118_0000184 | Ga0496118_0000184_52883_54052 | 385 |
| 76 | 3300048921 | Ga0496118_0003995 | Ga0496118_0003995_10243_11400 | 385 |
| 77 | 3300049568 | Ga0501031_0046779 | Ga0501031_0046779_736_1893 | 385 |
| 78 | 3300049569 | Ga0501032_0016623 | Ga0501032_0016623_988_2145 | 385 |
| 79 | 3300049570 | Ga0501033_0017194 | Ga0501033_0017194_3321_4478 | 385 |
| 80 | 3300049571 | Ga0501034_0033790 | Ga0501034_0033790_3040_4197 | 385 |
| 81 | 3300049572 | Ga0501036_0010356 | Ga0501036_0010356_5553_6710 | 385 |
| 82 | 3300049573 | Ga0501037_0018129 | Ga0501037_0018129_988_2145 | 385 |
| 83 | 3300049574 | Ga0501038_0026626 | Ga0501038_0026626_3014_4171 | 385 |
| 84 | 3300049575 | Ga0501039_0006094 | Ga0501039_0006094_3039_4196 | 385 |
| 85 | 3300049580 | Ga0501046_0054128 | Ga0501046_0054128_1022_2179 | 385 |
| 86 | 3300049580 | Ga0501046_0134092 | Ga0501046_0134092_73_1230 | 385 |
| 87 | 3300049581 | Ga0501047_0030614 | Ga0501047_0030614_3043_4200 | 385 |
| 88 | 3300049582 | Ga0501048_0098016 | Ga0501048_0098016_406_1563 | 385 |
| 89 | 3300049584 | Ga0501068_0032360 | Ga0501068_0032360_980_2137 | 385 |
| 90 | 3300049586 | Ga0501070_0026695 | Ga0501070_0026695_2700_3857 | 385 |
| 91 | 3300049589 | Ga0501073_0009258 | Ga0501073_0009258_988_2145 | 385 |
| 92 | 3300049590 | Ga0501074_0050464 | Ga0501074_0050464_988_2145 | 385 |
| 93 | 3300049741 | Ga0501079_0136807 | Ga0501079_0136807_617_1774 | 385 |
| 94 | 3300049742 | Ga0501080_0028843 | Ga0501080_0028843_988_2145 | 385 |
| 95 | 3300049822 | Ga0501035_0027652 | Ga0501035_0027652_3039_4196 | 385 |
| 96 | 3300049823 | Ga0501044_0043475 | Ga0501044_0043475_988_2145 | 385 |
| 97 | 3300049823 | Ga0501044_0228459 | Ga0501044_0228459_455_1612 | 385 |
| 98 | 3300053084 | Ga0495595_0017255 | Ga0495595_0017255_160_1320 | 385 |
| 99 | 3300053093 | Ga0500651_0000154 | Ga0500651_0000154_29325_30488 | 385 |
| 100 | 3300060353 | Ga0501082_0001406 | Ga0501082_0001406_5039_6196 | 385 |
| 101 | iso_pu_bacteria | 2643221579 | 2643906980 | 385 |
| 102 | iso_pu_bacteria | 2747842501 | 2748019005 | 385 |
| 103 | iso_pu_bacteria | 2923516293 | 2923519542 | 385 |
| 104 | iso_pu_bacteria | 2987605356 | 2987608875 | 385 |
| 105 | 3300005355 | Ga0070671_100018190 | Ga0070671_1000181904 | 386 |
| 106 | 3300005539 | Ga0068853_100001164 | Ga0068853_10000116411 | 386 |
| 107 | 3300005614 | Ga0068856_100411989 | Ga0068856_1004119891 | 386 |
| 108 | 3300005616 | Ga0068852_100046538 | Ga0068852_1000465381 | 386 |
| 109 | 3300013104 | Ga0157370_10006138 | Ga0157370_100061387 | 386 |
| 110 | 3300025931 | Ga0207644_10028300 | Ga0207644_100283002 | 386 |
| 111 | 3300026041 | Ga0207639_10001038 | Ga0207639_1000103810 | 386 |
| 112 | 3300026142 | Ga0207698_10213149 | Ga0207698_102131491 | 386 |
| 113 | 3300031251 | Ga0265327_10001771 | Ga0265327_1000177118 | 386 |
| 114 | 3300031730 | Ga0307516_10078800 | Ga0307516_100788003 | 386 |
| 115 | 3300048912 | Ga0496109_0049500 | Ga0496109_0049500_2077_3240 | 386 |
| 116 | 3300049569 | Ga0501032_0002443 | Ga0501032_0002443_12374_13534 | 386 |
| 117 | 3300049570 | Ga0501033_0000348 | Ga0501033_0000348_2730_3890 | 386 |
| 118 | 3300049571 | Ga0501034_0001456 | Ga0501034_0001456_25926_27086 | 386 |
| 119 | 3300049571 | Ga0501034_0013484 | Ga0501034_0013484_1236_2396 | 386 |
| 120 | 3300049572 | Ga0501036_0002512 | Ga0501036_0002512_4434_5594 | 386 |
| 121 | 3300049572 | Ga0501036_0015939 | Ga0501036_0015939_3348_4508 | 386 |
| 122 | 3300049573 | Ga0501037_0003230 | Ga0501037_0003230_245_1405 | 386 |
| 123 | 3300049574 | Ga0501038_0063451 | Ga0501038_0063451_1075_2235 | 386 |
| 124 | 3300049574 | Ga0501038_0082824 | Ga0501038_0082824_1370_2530 | 386 |
| 125 | 3300049574 | Ga0501038_0088934 | Ga0501038_0088934_997_2157 | 386 |
| 126 | 3300049575 | Ga0501039_0018800 | Ga0501039_0018800_2457_3617 | 386 |
| 127 | 3300049579 | Ga0501043_0003809 | Ga0501043_0003809_2681_3841 | 386 |
| 128 | 3300049579 | Ga0501043_0160564 | Ga0501043_0160564_95_1255 | 386 |
| 129 | 3300049580 | Ga0501046_0005282 | Ga0501046_0005282_8314_9474 | 386 |
| 130 | 3300049581 | Ga0501047_0001202 | Ga0501047_0001202_19832_20992 | 386 |
| 131 | 3300049581 | Ga0501047_0054009 | Ga0501047_0054009_2681_3841 | 386 |
| 132 | 3300049582 | Ga0501048_0115335 | Ga0501048_0115335_26_1186 | 386 |
| 133 | 3300049583 | Ga0501067_0000323 | Ga0501067_0000323_16695_17855 | 386 |
| 134 | 3300049584 | Ga0501068_0037627 | Ga0501068_0037627_1677_2837 | 386 |
| 135 | 3300049585 | Ga0501069_0000679 | Ga0501069_0000679_4623_5783 | 386 |
| 136 | 3300049586 | Ga0501070_0004712 | Ga0501070_0004712_6443_7603 | 386 |
| 137 | 3300049587 | Ga0501071_0054970 | Ga0501071_0054970_105_1265 | 386 |
| 138 | 3300049589 | Ga0501073_0000520 | Ga0501073_0000520_21463_22623 | 386 |
| 139 | 3300049589 | Ga0501073_0003010 | Ga0501073_0003010_8806_9966 | 386 |
| 140 | 3300049742 | Ga0501080_0001116 | Ga0501080_0001116_3722_4882 | 386 |
| 141 | 3300049744 | Ga0501083_0000277 | Ga0501083_0000277_11318_12478 | 386 |
| 142 | 3300053093 | Ga0500651_0011299 | Ga0500651_0011299_1153_2313 | 386 |
| 143 | 3300053155 | Ga0500620_002872 | Ga0500620_002872_26_1186 | 386 |
| 144 | 3300005289 | Ga0065704_10070432 | Ga0065704_100704322 | 387 |
| 145 | 3300005334 | Ga0068869_100064068 | Ga0068869_1000640682 | 387 |
| 146 | 3300005335 | Ga0070666_10028013 | Ga0070666_100280133 | 387 |
| 147 | 3300005336 | Ga0070680_100114763 | Ga0070680_1001147632 | 387 |
| 148 | 3300005366 | Ga0070659_100026601 | Ga0070659_1000266014 | 387 |
| 149 | 3300005530 | Ga0070679_100095301 | Ga0070679_1000953013 | 387 |
| 150 | 3300005535 | Ga0070684_100056815 | Ga0070684_1000568151 | 387 |
| 151 | 3300005539 | Ga0068853_100045349 | Ga0068853_1000453492 | 387 |
| 152 | 3300005578 | Ga0068854_100048723 | Ga0068854_1000487231 | 387 |
| 153 | 3300005614 | Ga0068856_100007715 | Ga0068856_1000077152 | 387 |
| 154 | 3300005614 | Ga0068856_100072187 | Ga0068856_1000721873 | 387 |
| 155 | 3300005617 | Ga0068859_100001513 | Ga0068859_1000015139 | 387 |
| 156 | 3300005842 | Ga0068858_100038835 | Ga0068858_1000388354 | 387 |
| 157 | 3300005844 | Ga0068862_100001035 | Ga0068862_10000103513 | 387 |
| 158 | 3300006237 | Ga0097621_100085810 | Ga0097621_1000858102 | 387 |
| 159 | 3300006358 | Ga0068871_100022247 | Ga0068871_1000222473 | 387 |
| 160 | 3300006358 | Ga0068871_100024257 | Ga0068871_1000242574 | 387 |
| 161 | 3300006881 | Ga0068865_100055243 | Ga0068865_1000552432 | 387 |
| 162 | 3300006931 | Ga0097620_100001513 | Ga0097620_10000151313 | 387 |
| 163 | 3300009093 | Ga0105240_10056465 | Ga0105240_100564654 | 387 |
| 164 | 3300009177 | Ga0105248_10020716 | Ga0105248_100207166 | 387 |
| 165 | 3300009551 | Ga0105238_10039489 | Ga0105238_100394892 | 387 |
| 166 | 3300010375 | Ga0105239_10008484 | Ga0105239_100084842 | 387 |
| 167 | 3300013105 | Ga0157369_10001729 | Ga0157369_1000172913 | 387 |
| 168 | 3300013105 | Ga0157369_10004216 | Ga0157369_100042165 | 387 |
| 169 | 3300013296 | Ga0157374_10000538 | Ga0157374_1000053817 | 387 |
| 170 | 3300013296 | Ga0157374_10021970 | Ga0157374_100219702 | 387 |
| 171 | 3300013297 | Ga0157378_10166117 | Ga0157378_101661171 | 387 |
| 172 | 3300013306 | Ga0163162_10000017 | Ga0163162_1000001716 | 387 |
| 173 | 3300013308 | Ga0157375_10001992 | Ga0157375_100019926 | 387 |
| 174 | 3300014325 | Ga0163163_10000029 | Ga0163163_10000029127 | 387 |
| 175 | 3300014969 | Ga0157376_10173144 | Ga0157376_101731442 | 387 |
| 176 | 3300021384 | Ga0213876_10017051 | Ga0213876_100170513 | 387 |
| 177 | 3300025292 | Ga0209676_1000052 | Ga0209676_100005247 | 387 |
| 178 | 3300025294 | Ga0209025_1004686 | Ga0209025_10046864 | 387 |
| 179 | 3300025903 | Ga0207680_10124276 | Ga0207680_101242762 | 387 |
| 180 | 3300025904 | Ga0207647_10002622 | Ga0207647_100026226 | 387 |
| 181 | 3300025911 | Ga0207654_10000391 | Ga0207654_1000039118 | 387 |
| 182 | 3300025913 | Ga0207695_10002627 | Ga0207695_100026279 | 387 |
| 183 | 3300025914 | Ga0207671_10005357 | Ga0207671_100053578 | 387 |
| 184 | 3300025940 | Ga0207691_10230969 | Ga0207691_102309691 | 387 |
| 185 | 3300025941 | Ga0207711_10021180 | Ga0207711_100211804 | 387 |
| 186 | 3300025949 | Ga0207667_10002857 | Ga0207667_1000285712 | 387 |
| 187 | 3300025981 | Ga0207640_10208637 | Ga0207640_102086372 | 387 |
| 188 | 3300026041 | Ga0207639_10000455 | Ga0207639_100004555 | 387 |
| 189 | 3300026078 | Ga0207702_10042561 | Ga0207702_100425614 | 387 |
| 190 | 3300026116 | Ga0207674_10049210 | Ga0207674_100492103 | 387 |
| 191 | 3300026121 | Ga0207683_10131122 | Ga0207683_101311222 | 387 |
| 192 | 3300026142 | Ga0207698_10023858 | Ga0207698_100238584 | 387 |
| 193 | 3300026142 | Ga0207698_10138506 | Ga0207698_101385062 | 387 |
| 194 | 3300028379 | Ga0268266_10152720 | Ga0268266_101527201 | 387 |
| 195 | 3300028380 | Ga0268265_10000372 | Ga0268265_1000037213 | 387 |
| 196 | 3300028381 | Ga0268264_10014160 | Ga0268264_100141602 | 387 |
| 197 | 3300031901 | Ga0307406_10010696 | Ga0307406_100106962 | 387 |
| 198 | 3300039437 | Ga0436365_1756022 | Ga0436365_1756022_5265_6437 | 387 |
| 199 | 3300041494 | Ga0451837_0306698 | Ga0451837_0306698_3998_5182 | 387 |
| 200 | 3300042006 | Ga0439432_007466 | Ga0439432_007466_947_2128 | 387 |
| 201 | 3300046615 | Ga0495656_0004389 | Ga0495656_0004389_270_1448 | 387 |
| 202 | 3300048918 | Ga0496115_0000014 | Ga0496115_0000014_92873_94036 | 387 |
| 203 | 3300048929 | Ga0496126_0000047 | Ga0496126_0000047_110655_111818 | 387 |
| 204 | 3300049572 | Ga0501036_0066591 | Ga0501036_0066591_1812_2981 | 387 |
| 205 | 3300049579 | Ga0501043_0059907 | Ga0501043_0059907_956_2119 | 387 |
| 206 | 3300049581 | Ga0501047_0004649 | Ga0501047_0004649_11613_12776 | 387 |
| 207 | 3300049741 | Ga0501079_0094448 | Ga0501079_0094448_238_1407 | 387 |
| 208 | iso_pu_bacteria | 8002869464 | 8002869828 | 387 |
| 209 | 3300005347 | Ga0070668_100013024 | Ga0070668_1000130242 | 388 |
| 210 | 3300010375 | Ga0105239_10000033 | Ga0105239_10000033131 | 388 |
| 211 | 3300031456 | Ga0307513_10005508 | Ga0307513_100055082 | 388 |
| 212 | 3300037312 | Ga0395899_0053253 | Ga0395899_0053253_392_1564 | 388 |
| 213 | 3300037418 | Ga0395900_0020527 | Ga0395900_0020527_2659_3831 | 388 |
| 214 | 3300037466 | Ga0395898_0191245 | Ga0395898_0191245_87_1259 | 388 |
| 215 | 3300037471 | Ga0395905_0003783 | Ga0395905_0003783_12014_13186 | 388 |
| 216 | 3300038443 | Ga0395901_0007245 | Ga0395901_0007245_3015_4187 | 388 |
| 217 | 3300041451 | Ga0451791_0890502 | Ga0451791_0890502_482_1669 | 388 |
| 218 | 3300046525 | Ga0495663_0000265 | Ga0495663_0000265_15835_17016 | 388 |
| 219 | 3300048925 | Ga0496122_0014349 | Ga0496122_0014349_5920_7101 | 388 |
| 220 | 3300048926 | Ga0496123_0053791 | Ga0496123_0053791_250_1431 | 388 |
| 221 | 3300049742 | Ga0501080_0000421 | Ga0501080_0000421_187_1353 | 388 |
| 222 | 3300005466 | Ga0070685_10001362 | Ga0070685_100013624 | 389 |
| 223 | 3300025272 | Ga0209455_1005703 | Ga0209455_10057032 | 389 |
| 224 | 3300032004 | Ga0307414_10003716 | Ga0307414_100037166 | 389 |
| 225 | 3300032004 | Ga0307414_10007110 | Ga0307414_100071103 | 389 |
| 226 | 3300032004 | Ga0307414_10011970 | Ga0307414_100119702 | 389 |
| 227 | 3300041451 | Ga0451791_0534889 | Ga0451791_0534889_117_1304 | 389 |
| 228 | 3300046471 | Ga0495650_0000134 | Ga0495650_0000134_99909_101078 | 389 |
| 229 | 3300048921 | Ga0496118_0022053 | Ga0496118_0022053_2929_4119 | 389 |
| 230 | 3300048925 | Ga0496122_0000537 | Ga0496122_0000537_35421_36605 | 389 |
| 231 | 3300048926 | Ga0496123_0000987 | Ga0496123_0000987_35272_36456 | 389 |
| 232 | 3300048926 | Ga0496123_0009613 | Ga0496123_0009613_303_1487 | 389 |
| 233 | 3300048929 | Ga0496126_0003733 | Ga0496126_0003733_10713_11882 | 389 |
| 234 | 3300049569 | Ga0501032_0011139 | Ga0501032_0011139_2645_3847 | 389 |
| 235 | 3300049571 | Ga0501034_0003503 | Ga0501034_0003503_2645_3847 | 389 |
| 236 | 3300049572 | Ga0501036_0013840 | Ga0501036_0013840_2889_4091 | 389 |
| 237 | 3300049573 | Ga0501037_0018628 | Ga0501037_0018628_1296_2498 | 389 |
| 238 | 3300049575 | Ga0501039_0012881 | Ga0501039_0012881_2613_3815 | 389 |
| 239 | 3300049578 | Ga0501042_0072330 | Ga0501042_0072330_776_1978 | 389 |
| 240 | 3300049579 | Ga0501043_0006731 | Ga0501043_0006731_5355_6557 | 389 |
| 241 | 3300049580 | Ga0501046_0006283 | Ga0501046_0006283_5333_6535 | 389 |
| 242 | 3300049581 | Ga0501047_0019765 | Ga0501047_0019765_2645_3847 | 389 |
| 243 | 3300049582 | Ga0501048_0012473 | Ga0501048_0012473_2597_3799 | 389 |
| 244 | 3300049583 | Ga0501067_0009451 | Ga0501067_0009451_3642_4844 | 389 |
| 245 | 3300049584 | Ga0501068_0002222 | Ga0501068_0002222_5421_6623 | 389 |
| 246 | 3300049585 | Ga0501069_0003467 | Ga0501069_0003467_2089_3291 | 389 |
| 247 | 3300049586 | Ga0501070_0024283 | Ga0501070_0024283_2618_3820 | 389 |
| 248 | 3300049588 | Ga0501072_0050393 | Ga0501072_0050393_1131_2333 | 389 |
| 249 | 3300049589 | Ga0501073_0024884 | Ga0501073_0024884_2645_3847 | 389 |
| 250 | 3300049590 | Ga0501074_0011402 | Ga0501074_0011402_2643_3845 | 389 |
| 251 | 3300049741 | Ga0501079_0002990 | Ga0501079_0002990_3832_5034 | 389 |
| 252 | 3300049742 | Ga0501080_0011134 | Ga0501080_0011134_4388_5590 | 389 |
| 253 | 3300049744 | Ga0501083_0031324 | Ga0501083_0031324_98_1300 | 389 |
| 254 | 3300049822 | Ga0501035_0009427 | Ga0501035_0009427_2948_4159 | 389 |
| 255 | 3300049822 | Ga0501035_0018237 | Ga0501035_0018237_2645_3847 | 389 |
| 256 | 3300049823 | Ga0501044_0031332 | Ga0501044_0031332_2645_3847 | 389 |
| 257 | 3300049823 | Ga0501044_0091034 | Ga0501044_0091034_626_1837 | 389 |
| 258 | 3300053139 | Ga0500568_0000367 | Ga0500568_0000367_7591_8760 | 389 |
| 259 | 3300054114 | Ga0501084_0027267 | Ga0501084_0027267_929_2131 | 389 |
| 260 | 3300060353 | Ga0501082_0014631 | Ga0501082_0014631_267_1469 | 389 |
| 261 | 3300025228 | Ga0209672_100916 | Ga0209672_1009168 | 391 |
| 262 | 3300005539 | Ga0068853_100151334 | Ga0068853_1001513342 | 392 |
| 263 | 3300026041 | Ga0207639_10123156 | Ga0207639_101231562 | 392 |
| 264 | 3300013306 | Ga0163162_10006875 | Ga0163162_100068754 | 395 |
| 265 | 3300013308 | Ga0157375_10001695 | Ga0157375_1000169514 | 395 |
| 266 | 3300025261 | Ga0209233_1002533 | Ga0209233_10025334 | 396 |
| 267 | 3300013296 | Ga0157374_10287439 | Ga0157374_102874391 | 408 |
| 268 | 3300003316 | rootH1_10039347 | rootH1_100393472 | 423 |
| 269 | 3300005466 | Ga0070685_10000832 | Ga0070685_100008329 | 423 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e6g-assembly1.cif.gz_D | crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae | 0.9346 | 44 | 419 |
| 3e6g-assembly1.cif.gz_B | crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae | 0.9254 | 44 | 419 |
| 3e6g-assembly1.cif.gz_D | crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae | 0.9244 | 44 | 419 |
| 3e6g-assembly1.cif.gz_B | crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae | 0.9146 | 44 | 419 |
| 6k1o-assembly1.cif.gz_A | apo form of a putative cystathionine gamma-lyase | 0.9109 | 44 | 423 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e6gD01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.967 | 44 | 286 | 3.40.640.10 |
| 3e6gD01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9534 | 44 | 286 | 3.40.640.10 |
| af_A0A0P0WV19_29_251_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9081 | 99 | 236 | 3.40.640.10 |
| af_A0A0P0VYR6_1_109_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9033 | 181 | 289 | 3.40.640.10 |
| 1pffB01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8956 | 98 | 289 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529ZDV4-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9793 | 125 | 236 |
GO:0003962
GO:0004123 GO:0005737 GO:0008483 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A1Q8BJP4-F1-model_v4 | Cystathionine beta-lyase | 0.9718 | 101 | 355 |
GO:0003962
GO:0004123 GO:0005737 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A529ZDV4-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9708 | 125 | 236 |
GO:0003962
GO:0004123 GO:0005737 GO:0008483 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A544VQ81-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9656 | 99 | 236 |
GO:0003962
GO:0004123 GO:0005737 GO:0008483 GO:0009086 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A377VBL2-F1-model_v4 | Cystathionine gamma-lyase (EC 4.4.1.8) | 0.9622 | 142 | 367 |
GO:0003962
GO:0004123 GO:0005737 GO:0019343 GO:0019346 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar