F376355

General Info

Members Datasets Scaffolds Average Seq Length
269 175 538 349

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0150675|Ga0395899_0150675_24_1202
Length 392
Sequence MRVSQKQHLARVSSDNGRQRTGESGRGNASRDYARGVTTTTVLKPPADRAAGSYPDTLVDAILVVSFGGPEDPDDVMPFLENVTRGRNVPRERLEAVARHYLRLGGVSPINAQNRALVAALETELRAHGIDVPVYFGNRNWHPLLADTVAQMTRDGVRRALAFLTSAFSSYSGCRQYRENLYEAQLTVGDDAPELPRLRMFFNHPGFVEANADRVRAAVANAPAATPVAFAAHSLPMAMAECCAYEAQLAESARLVAEAAGVSEHTVVYQSRSGPPQVRWLEPDVLDHIRDLHARGVRDLVISPLGFLSDHMEVLYDLDVEAAELADELGMTLVRAGTPGTHPAFVTMIRELIQERLDPNAPRRALGRFGPSHDTCAPTCCLPGNGRPSPWA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0150675 3300037312 Bacteria 1648
2 LJNas_1000009 3300000546 Bacteria 25113
3 Ga0065707_10085227 3300005295 Bacteria 6335
4 Ga0070658_10199830 3300005327 Bacteria 1686
5 Ga0070683_100015659 3300005329 Bacteria 6666
6 Ga0070683_100028311 3300005329 Bacteria 5063
7 Ga0070680_100020645 3300005336 Bacteria 5229
8 Ga0070682_100081654 3300005337 Bacteria 2093
9 Ga0070660_100005454 3300005339 Bacteria 8807
10 Ga0070661_100025436 3300005344 Bacteria 4254
11 Ga0070661_100159035 3300005344 Bacteria 1710
12 Ga0070661_100166781 3300005344 Bacteria 1671
13 Ga0070668_100061679 3300005347 Bacteria 2905
14 Ga0070669_100109700 3300005353 Bacteria 2092
15 Ga0070669_100294703 3300005353 Bacteria 1303
16 Ga0070675_100249177 3300005354 Bacteria 1554
17 Ga0070659_100035694 3300005366 Bacteria 3872
18 Ga0070667_100066624 3300005367 Bacteria 3060
19 Ga0070709_10057348 3300005434 Unclassified 2466
20 Ga0070701_10014993 3300005438 Bacteria 3567
21 Ga0070708_100001230 3300005445 Bacteria 19698
22 Ga0070681_10022118 3300005458 Bacteria 6382
23 Ga0070681_10033802 3300005458 Bacteria 5133
24 Ga0070681_10037131 3300005458 Bacteria 4890
25 Ga0070681_10066040 3300005458 Bacteria 3586
26 Ga0070681_10081055 3300005458 Bacteria 3201
27 Ga0070706_100012482 3300005467 Bacteria 7870
28 Ga0070706_100057091 3300005467 Bacteria 3602
29 Ga0070707_100025216 3300005468 Bacteria 5639
30 Ga0070698_100005509 3300005471 Bacteria 13822
31 Ga0070699_100004862 3300005518 Bacteria 11857
32 Ga0070699_100053768 3300005518 Bacteria 3485
33 Ga0070679_100037774 3300005530 Bacteria 4798
34 Ga0070679_100043952 3300005530 Bacteria 4449
35 Ga0070679_100060655 3300005530 Bacteria 3769
36 Ga0070679_100198346 3300005530 Bacteria 1974
37 Ga0070679_100320523 3300005530 Bacteria 1499
38 Ga0070684_100040609 3300005535 Bacteria 4007
39 Ga0070684_100052662 3300005535 Bacteria 3540
40 Ga0070684_100265316 3300005535 Unclassified 1571
41 Ga0070697_100002314 3300005536 Bacteria 14632
42 Ga0070686_100035041 3300005544 Bacteria 3097
43 Ga0070686_100073553 3300005544 Bacteria 2244
44 Ga0070696_100062344 3300005546 Bacteria 2610
45 Ga0070665_100013859 3300005548 Bacteria 8109
46 Ga0070665_100028111 3300005548 Bacteria 5663
47 Ga0068855_100039699 3300005563 Bacteria 5587
48 Ga0068855_100151027 3300005563 Bacteria 2641
49 Ga0068855_100365262 3300005563 Bacteria 1588
50 Ga0068857_100273007 3300005577 Bacteria 1554
51 Ga0068854_100011427 3300005578 Bacteria 5781
52 Ga0068856_100011789 3300005614 Bacteria 8473
53 Ga0068856_100027735 3300005614 Bacteria 5524
54 Ga0068852_100010958 3300005616 Bacteria 6797
55 Ga0068852_100050940 3300005616 Bacteria 3551
56 Ga0068864_100008462 3300005618 Bacteria 8490
57 Ga0068866_10012548 3300005718 Bacteria 3694
58 Ga0068870_10015817 3300005840 Bacteria 3589
59 Ga0068863_100040732 3300005841 Bacteria 4417
60 Ga0068860_100076906 3300005843 Bacteria 3174
61 Ga0070717_10058606 3300006028 Unclassified 3184
62 Ga0070712_100035324 3300006175 Bacteria 3393
63 Ga0070712_100085034 3300006175 Bacteria 2302
64 Ga0097621_100147007 3300006237 Bacteria 2019
65 Ga0068871_100251298 3300006358 Bacteria 1540
66 Ga0075433_10043926 3300006852 Bacteria 3881
67 Ga0075433_10332654 3300006852 Bacteria 1343
68 Ga0105240_10015831 3300009093 Bacteria 10231
69 Ga0105240_10020050 3300009093 Bacteria 8927
70 Ga0114129_10062238 3300009147 Bacteria 5214
71 Ga0114129_10737276 3300009147 Bacteria 1262
72 Ga0114129_10900155 3300009147 Bacteria 1121
73 Ga0105248_10065859 3300009177 Bacteria 4068
74 Ga0105237_10003613 3300009545 Bacteria 18262
75 Ga0105237_10030799 3300009545 Bacteria 5446
76 Ga0105237_10132431 3300009545 Bacteria 2487
77 Ga0105238_10012033 3300009551 Bacteria 8716
78 Ga0105246_10034987 3300011119 Bacteria 3353
79 Ga0157370_10030625 3300013104 Bacteria 5271
80 Ga0157369_10018996 3300013105 Bacteria 7697
81 Ga0157369_10119896 3300013105 Bacteria 2791
82 Ga0157374_10084969 3300013296 Bacteria 3008
83 Ga0157378_10123165 3300013297 Bacteria 2392
84 Ga0157378_10248678 3300013297 Bacteria 1701
85 Ga0163162_10270727 3300013306 Bacteria 1830
86 Ga0163162_10322936 3300013306 Unclassified 1676
87 Ga0157372_10148506 3300013307 Bacteria 2704
88 Ga0157372_10189425 3300013307 Bacteria 2382
89 Ga0157372_10433963 3300013307 Bacteria 1531
90 Ga0157375_10182876 3300013308 Bacteria 2248
91 Ga0157375_10357640 3300013308 Bacteria 1626
92 Ga0163163_10028765 3300014325 Bacteria 5341
93 Ga0163163_10151737 3300014325 Bacteria 2360
94 Ga0163163_10373977 3300014325 Bacteria 1482
95 Ga0157379_10148988 3300014968 Bacteria 2111
96 Ga0157376_10164189 3300014969 Bacteria 2016
97 Ga0206356_10298789 3300020070 Bacteria 5116
98 Ga0206354_11672065 3300020081 Bacteria 2616
99 Ga0206353_10184785 3300020082 Bacteria 4385
100 Ga0206353_11782819 3300020082 Bacteria 3041
101 Ga0213873_10012470 3300021358 Unclassified 1842
102 Ga0213876_10054752 3300021384 Bacteria 2106
103 Ga0213876_10058961 3300021384 Bacteria 2026
104 Ga0213876_10068225 3300021384 Bacteria 1879
105 Ga0213875_10001176 3300021388 Bacteria 17924
106 Ga0213875_10002908 3300021388 Bacteria 10003
107 Ga0224570_101617 3300022730 Bacteria 1634
108 Ga0224572_1007051 3300024225 Bacteria 2048
109 Ga0228598_1000441 3300024227 Bacteria 8455
110 Ga0207699_10050062 3300025906 Unclassified 2462
111 Ga0207645_10001157 3300025907 Bacteria 21815
112 Ga0207643_10004407 3300025908 Bacteria 7572
113 Ga0207705_10011400 3300025909 Bacteria 6436
114 Ga0207684_10001132 3300025910 Bacteria 29813
115 Ga0207684_10075092 3300025910 Bacteria 2873
116 Ga0207707_10005658 3300025912 Bacteria 10940
117 Ga0207707_10057092 3300025912 Bacteria 3398
118 Ga0207707_10153268 3300025912 Bacteria 2015
119 Ga0207707_10222293 3300025912 Bacteria 1644
120 Ga0207695_10047660 3300025913 Bacteria 4532
121 Ga0207695_10175601 3300025913 Bacteria 2065
122 Ga0207671_10053790 3300025914 Bacteria 2983
123 Ga0207693_10090072 3300025915 Bacteria 2404
124 Ga0207657_10000444 3300025919 Bacteria 43862
125 Ga0207657_10001037 3300025919 Bacteria 29400
126 Ga0207649_10156192 3300025920 Bacteria 1576
127 Ga0207652_10026179 3300025921 Bacteria 4855
128 Ga0207652_10048683 3300025921 Bacteria 3624
129 Ga0207652_10049572 3300025921 Bacteria 3595
130 Ga0207646_10000073 3300025922 Bacteria 140267
131 Ga0207690_10081913 3300025932 Bacteria 2256
132 Ga0207706_10000573 3300025933 Bacteria 39137
133 Ga0207686_10035502 3300025934 Bacteria 2993
134 Ga0207661_10138521 3300025944 Bacteria 2092
135 Ga0207661_10152669 3300025944 Bacteria 1997
136 Ga0207667_10446038 3300025949 Bacteria 1315
137 Ga0207668_10305390 3300025972 Bacteria 1315
138 Ga0207658_10107451 3300025986 Bacteria 2199
139 Ga0207639_10055002 3300026041 Bacteria 3044
140 Ga0207639_10084267 3300026041 Bacteria 2525
141 Ga0207639_10439480 3300026041 Bacteria 1182
142 Ga0207708_10011236 3300026075 Bacteria 6664
143 Ga0207702_10033274 3300026078 Bacteria 4305
144 Ga0207702_10046367 3300026078 Bacteria 3659
145 Ga0207641_10019237 3300026088 Bacteria 5604
146 Ga0207648_10000925 3300026089 Bacteria 33055
147 Ga0207676_10016028 3300026095 Bacteria 5422
148 Ga0207674_10365159 3300026116 Bacteria 1395
149 Ga0207698_10201329 3300026142 Bacteria 1783
150 Ga0265355_1001441 3300028036 Bacteria 1545
151 Ga0268266_10031856 3300028379 Bacteria 4479
152 Ga0268265_10073821 3300028380 Bacteria 2666
153 Ga0265319_1020726 3300028563 Bacteria 2429
154 Ga0265318_10003753 3300028577 Bacteria 7558
155 Ga0265338_10025505 3300028800 Bacteria 5996
156 Ga0265338_10173297 3300028800 Bacteria 1652
157 Ga0265762_1001890 3300030760 Bacteria 3799
158 Ga0265762_1002861 3300030760 Bacteria 3085
159 Ga0265760_10000073 3300031090 Bacteria 25519
160 Ga0265332_10032032 3300031238 Bacteria 2292
161 Ga0265320_10040951 3300031240 Bacteria 2306
162 Ga0265325_10000231 3300031241 Bacteria 39732
163 Ga0265339_10000973 3300031249 Bacteria 21959
164 Ga0265331_10000249 3300031250 Bacteria 64057
165 Ga0265313_10000651 3300031595 Bacteria 35713
166 Ga0265313_10009074 3300031595 Bacteria 6506
167 Ga0307508_10002175 3300031616 Bacteria 20989
168 Ga0265314_10000123 3300031711 Bacteria 119667
169 Ga0265314_10114706 3300031711 Bacteria 1706
170 Ga0316576_10072757 3300031727 Bacteria 2538
171 Ga0373926_0035341 3300035083 Bacteria 1772
172 Ga0373934_0063633 3300035086 Bacteria 1471
173 Ga0373945_0032993 3300035116 Bacteria 1837
174 Ga0373945_0062481 3300035116 Bacteria 1392
175 Ga0373943_0008389 3300035170 Bacteria 4636
176 Ga0373943_0038136 3300035170 Bacteria 2309
177 Ga0373947_0000179 3300035725 Bacteria 34924
178 Ga0373937_0190554 3300036401 Bacteria 1927
179 Ga0373925_0000903 3300037068 Bacteria 27131
180 Ga0373925_0042751 3300037068 Bacteria 3362
181 Ga0373925_0103828 3300037068 Bacteria 2188
182 Ga0373925_0446367 3300037068 Bacteria 1059
183 Ga0395899_0010274 3300037312 Bacteria 7176
184 Ga0395900_0006219 3300037418 Bacteria 12468
185 Ga0395900_0079757 3300037418 Bacteria 3364
186 Ga0395900_0135416 3300037418 Bacteria 2524
187 Ga0395898_0010033 3300037466 Bacteria 9917
188 Ga0395898_0025250 3300037466 Bacteria 5990
189 Ga0395905_0007792 3300037471 Bacteria 10621
190 Ga0395905_0119972 3300037471 Bacteria 2472
191 Ga0395905_0299729 3300037471 Bacteria 1495
192 Ga0436364_0230315 3300037853 Bacteria 9350
193 Ga0436364_0290055 3300037853 Bacteria 2020
194 Ga0436364_0725753 3300037853 Bacteria 13036
195 Ga0436364_1135129 3300037853 Bacteria 2005
196 Ga0436364_1249388 3300037853 Bacteria 24580
197 Ga0395901_0025710 3300038443 Bacteria 6044
198 Ga0395901_0108128 3300038443 Bacteria 2919
199 Ga0436365_0156172 3300039437 Bacteria 2087
200 Ga0436365_0839550 3300039437 Bacteria 1982
201 Ga0436365_0992500 3300039437 Bacteria 3628
202 Ga0436365_1693706 3300039437 Unclassified 1446
203 Ga0436362_0296767 3300039453 Bacteria 4299
204 Ga0466969_0073959 3300044656 Bacteria 1635
205 Ga0466966_0046473 3300044684 Bacteria 2771
206 Ga0466961_0011312 3300044693 Bacteria 5706
207 Ga0466963_0002233 3300044694 Bacteria 10738
208 Ga0466963_0003304 3300044694 Bacteria 9198
209 Ga0466963_0003664 3300044694 Bacteria 8840
210 Ga0466971_0000369 3300044719 Bacteria 17368
211 Ga0466957_0008363 3300044842 Bacteria 5884
212 Ga0466959_0069507 3300045049 Bacteria 2551
213 Ga0466959_0278955 3300045049 Bacteria 1147
214 Ga0466958_0056736 3300045836 Bacteria 2380
215 Ga0466967_0009069 3300045976 Bacteria 7355
216 Ga0466967_0207589 3300045976 Bacteria 1857
217 Ga0495651_0011125 3300046462 Bacteria 6921
218 Ga0495651_0030282 3300046462 Bacteria 4221
219 Ga0495580_0003630 3300046472 Bacteria 13068
220 Ga0495580_0017720 3300046472 Bacteria 5317
221 Ga0495580_0079561 3300046472 Bacteria 2286
222 Ga0495580_0184044 3300046472 Bacteria 1442
223 Ga0495664_0010697 3300046477 Bacteria 5154
224 Ga0495664_0044426 3300046477 Bacteria 2633
225 Ga0495594_0211876 3300046499 Bacteria 1105
226 Ga0495652_0060973 3300046529 Bacteria 3186
227 Ga0495640_0106397 3300046533 Bacteria 1837
228 Ga0495587_0113125 3300046536 Bacteria 1558
229 Ga0495645_0173026 3300046543 Bacteria 1485
230 Ga0495599_0076651 3300046678 Bacteria 2088
231 Ga0495623_0030461 3300046679 Bacteria 3470
232 Ga0495647_0032514 3300046681 Bacteria 1945
233 Ga0495658_0094228 3300046683 Bacteria 1778
234 Ga0495600_0160954 3300046809 Bacteria 1451
235 Ga0495636_0082671 3300047318 Bacteria 1385
236 Ga0495674_0010121 3300047319 Bacteria 8935
237 Ga0495672_0005921 3300047320 Bacteria 9582
238 Ga0495680_0032279 3300047322 Bacteria 4252
239 Ga0495680_0189276 3300047322 Bacteria 1481
240 Ga0495602_0004308 3300048088 Bacteria 14817
241 Ga0495602_0188740 3300048088 Bacteria 1582
242 Ga0496100_0065810 3300048903 Bacteria 2403
243 Ga0496104_0000845 3300048907 Bacteria 26457
244 Ga0496105_0000556 3300048908 Bacteria 24657
245 Ga0496114_0106066 3300048917 Unclassified 2404
246 Ga0501036_0059606 3300049572 Bacteria 3234
247 Ga0501043_0004910 3300049579 Bacteria 10810
248 Ga0501046_0003119 3300049580 Bacteria 15298
249 Ga0501046_0096143 3300049580 Bacteria 2276
250 Ga0501047_0072284 3300049581 Bacteria 3320
251 Ga0501047_0143200 3300049581 Bacteria 2268
252 Ga0501070_0001296 3300049586 Bacteria 22442
253 Ga0501070_0098221 3300049586 Bacteria 2422
254 Ga0501072_0088027 3300049588 Bacteria 2464
255 Ga0501075_0201130 3300049591 Bacteria 1519
256 Ga0501076_0047697 3300049592 Bacteria 3387
257 Ga0501077_0054160 3300049593 Bacteria 2548
258 Ga0501077_0143476 3300049593 Bacteria 1515
259 Ga0501079_0055358 3300049741 Bacteria 3061
260 Ga0501080_0283394 3300049742 Bacteria 1506
261 Ga0501044_0424340 3300049823 Bacteria 1240
262 nmdc:mga0a205_74958_c1 3300050515 Bacteria 3269
263 Ga0495619_0012176 3300053085 Bacteria 5414
264 Ga0495619_0040857 3300053085 Bacteria 3032
265 Ga0495619_0057182 3300053085 Bacteria 2587
266 Ga0501084_0197120 3300054114 Bacteria 1699
267 Ga0501082_0091467 3300060353 Bacteria 2627
268 Ga0501082_0221555 3300060353 Bacteria 1646
269 Ga0466962_0001012 3300061719 Bacteria 12845
270 Ga0395899_0150675
271 LJNas_1000009
272 Ga0065707_10085227
273 Ga0070658_10199830
274 Ga0070683_100015659
275 Ga0070683_100028311
276 Ga0070680_100020645
277 Ga0070682_100081654
278 Ga0070660_100005454
279 Ga0070661_100025436
280 Ga0070661_100159035
281 Ga0070661_100166781
282 Ga0070668_100061679
283 Ga0070669_100109700
284 Ga0070669_100294703
285 Ga0070675_100249177
286 Ga0070659_100035694
287 Ga0070667_100066624
288 Ga0070709_10057348
289 Ga0070701_10014993
290 Ga0070708_100001230
291 Ga0070681_10022118
292 Ga0070681_10033802
293 Ga0070681_10037131
294 Ga0070681_10066040
295 Ga0070681_10081055
296 Ga0070706_100012482
297 Ga0070706_100057091
298 Ga0070707_100025216
299 Ga0070698_100005509
300 Ga0070699_100004862
301 Ga0070699_100053768
302 Ga0070679_100037774
303 Ga0070679_100043952
304 Ga0070679_100060655
305 Ga0070679_100198346
306 Ga0070679_100320523
307 Ga0070684_100040609
308 Ga0070684_100052662
309 Ga0070684_100265316
310 Ga0070697_100002314
311 Ga0070686_100035041
312 Ga0070686_100073553
313 Ga0070696_100062344
314 Ga0070665_100013859
315 Ga0070665_100028111
316 Ga0068855_100039699
317 Ga0068855_100151027
318 Ga0068855_100365262
319 Ga0068857_100273007
320 Ga0068854_100011427
321 Ga0068856_100011789
322 Ga0068856_100027735
323 Ga0068852_100010958
324 Ga0068852_100050940
325 Ga0068864_100008462
326 Ga0068866_10012548
327 Ga0068870_10015817
328 Ga0068863_100040732
329 Ga0068860_100076906
330 Ga0070717_10058606
331 Ga0070712_100035324
332 Ga0070712_100085034
333 Ga0097621_100147007
334 Ga0068871_100251298
335 Ga0075433_10043926
336 Ga0075433_10332654
337 Ga0105240_10015831
338 Ga0105240_10020050
339 Ga0114129_10062238
340 Ga0114129_10737276
341 Ga0114129_10900155
342 Ga0105248_10065859
343 Ga0105237_10003613
344 Ga0105237_10030799
345 Ga0105237_10132431
346 Ga0105238_10012033
347 Ga0105246_10034987
348 Ga0157370_10030625
349 Ga0157369_10018996
350 Ga0157369_10119896
351 Ga0157374_10084969
352 Ga0157378_10123165
353 Ga0157378_10248678
354 Ga0163162_10270727
355 Ga0163162_10322936
356 Ga0157372_10148506
357 Ga0157372_10189425
358 Ga0157372_10433963
359 Ga0157375_10182876
360 Ga0157375_10357640
361 Ga0163163_10028765
362 Ga0163163_10151737
363 Ga0163163_10373977
364 Ga0157379_10148988
365 Ga0157376_10164189
366 Ga0206356_10298789
367 Ga0206354_11672065
368 Ga0206353_10184785
369 Ga0206353_11782819
370 Ga0213873_10012470
371 Ga0213876_10054752
372 Ga0213876_10058961
373 Ga0213876_10068225
374 Ga0213875_10001176
375 Ga0213875_10002908
376 Ga0224570_101617
377 Ga0224572_1007051
378 Ga0228598_1000441
379 Ga0207699_10050062
380 Ga0207645_10001157
381 Ga0207643_10004407
382 Ga0207705_10011400
383 Ga0207684_10001132
384 Ga0207684_10075092
385 Ga0207707_10005658
386 Ga0207707_10057092
387 Ga0207707_10153268
388 Ga0207707_10222293
389 Ga0207695_10047660
390 Ga0207695_10175601
391 Ga0207671_10053790
392 Ga0207693_10090072
393 Ga0207657_10000444
394 Ga0207657_10001037
395 Ga0207649_10156192
396 Ga0207652_10026179
397 Ga0207652_10048683
398 Ga0207652_10049572
399 Ga0207646_10000073
400 Ga0207690_10081913
401 Ga0207706_10000573
402 Ga0207686_10035502
403 Ga0207661_10138521
404 Ga0207661_10152669
405 Ga0207667_10446038
406 Ga0207668_10305390
407 Ga0207658_10107451
408 Ga0207639_10055002
409 Ga0207639_10084267
410 Ga0207639_10439480
411 Ga0207708_10011236
412 Ga0207702_10033274
413 Ga0207702_10046367
414 Ga0207641_10019237
415 Ga0207648_10000925
416 Ga0207676_10016028
417 Ga0207674_10365159
418 Ga0207698_10201329
419 Ga0265355_1001441
420 Ga0268266_10031856
421 Ga0268265_10073821
422 Ga0265319_1020726
423 Ga0265318_10003753
424 Ga0265338_10025505
425 Ga0265338_10173297
426 Ga0265762_1001890
427 Ga0265762_1002861
428 Ga0265760_10000073
429 Ga0265332_10032032
430 Ga0265320_10040951
431 Ga0265325_10000231
432 Ga0265339_10000973
433 Ga0265331_10000249
434 Ga0265313_10000651
435 Ga0265313_10009074
436 Ga0307508_10002175
437 Ga0265314_10000123
438 Ga0265314_10114706
439 Ga0316576_10072757
440 Ga0373926_0035341
441 Ga0373934_0063633
442 Ga0373945_0032993
443 Ga0373945_0062481
444 Ga0373943_0008389
445 Ga0373943_0038136
446 Ga0373947_0000179
447 Ga0373937_0190554
448 Ga0373925_0000903
449 Ga0373925_0042751
450 Ga0373925_0103828
451 Ga0373925_0446367
452 Ga0395899_0010274
453 Ga0395900_0006219
454 Ga0395900_0079757
455 Ga0395900_0135416
456 Ga0395898_0010033
457 Ga0395898_0025250
458 Ga0395905_0007792
459 Ga0395905_0119972
460 Ga0395905_0299729
461 Ga0436364_0230315
462 Ga0436364_0290055
463 Ga0436364_0725753
464 Ga0436364_1135129
465 Ga0436364_1249388
466 Ga0395901_0025710
467 Ga0395901_0108128
468 Ga0436365_0156172
469 Ga0436365_0839550
470 Ga0436365_0992500
471 Ga0436365_1693706
472 Ga0436362_0296767
473 Ga0466969_0073959
474 Ga0466966_0046473
475 Ga0466961_0011312
476 Ga0466963_0002233
477 Ga0466963_0003304
478 Ga0466963_0003664
479 Ga0466971_0000369
480 Ga0466957_0008363
481 Ga0466959_0069507
482 Ga0466959_0278955
483 Ga0466958_0056736
484 Ga0466967_0009069
485 Ga0466967_0207589
486 Ga0495651_0011125
487 Ga0495651_0030282
488 Ga0495580_0003630
489 Ga0495580_0017720
490 Ga0495580_0079561
491 Ga0495580_0184044
492 Ga0495664_0010697
493 Ga0495664_0044426
494 Ga0495594_0211876
495 Ga0495652_0060973
496 Ga0495640_0106397
497 Ga0495587_0113125
498 Ga0495645_0173026
499 Ga0495599_0076651
500 Ga0495623_0030461
501 Ga0495647_0032514
502 Ga0495658_0094228
503 Ga0495600_0160954
504 Ga0495636_0082671
505 Ga0495674_0010121
506 Ga0495672_0005921
507 Ga0495680_0032279
508 Ga0495680_0189276
509 Ga0495602_0004308
510 Ga0495602_0188740
511 Ga0496100_0065810
512 Ga0496104_0000845
513 Ga0496105_0000556
514 Ga0496114_0106066
515 Ga0501036_0059606
516 Ga0501043_0004910
517 Ga0501046_0003119
518 Ga0501046_0096143
519 Ga0501047_0072284
520 Ga0501047_0143200
521 Ga0501070_0001296
522 Ga0501070_0098221
523 Ga0501072_0088027
524 Ga0501075_0201130
525 Ga0501076_0047697
526 Ga0501077_0054160
527 Ga0501077_0143476
528 Ga0501079_0055358
529 Ga0501080_0283394
530 Ga0501044_0424340
531 nmdc:mga0a205_74958_c1
532 Ga0495619_0012176
533 Ga0495619_0040857
534 Ga0495619_0057182
535 Ga0501084_0197120
536 Ga0501082_0091467
537 Ga0501082_0221555
538 Ga0466962_0001012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

59

357

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9113 26 327
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9031 24 327
2h1v-assembly1.cif.gz_A crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase 0.9026 26 327
4kla-assembly1.cif.gz_B e343d variant of human ferrochelatase 0.8998 25 330
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.8973 26 327
ID Description Score Start End Superfamily
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9487 27 150 3.40.50.1400
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9334 27 150 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9281 171 309 3.40.50.1400
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9079 173 308 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9033 171 309 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A2V9XY23-F1-model_v4 Ferrochelatase 0.9851 23 119 GO:0004325
GO:0006783
AF-A0A2M8N8P5-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9826 20 355 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A0K2R4X5-F1-model_v4 deleted 0.9807 24 110
AF-A0A7Y3JI25-F1-model_v4 Ferrochelatase 0.977 23 171 GO:0004325
GO:0006783
AF-A0A7C1FLS8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9751 24 355 GO:0004325
GO:0005737
GO:0006783
GO:0046872

Map