F376346

General Info

Members Datasets Scaffolds Average Seq Length
269 172 538 557

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0018552|Ga0373937_0018552_4292_6046
Length 584
Sequence MTSIQRRRFLQYGLGAGAAAFAVPSVMRVPVASAAIRGGASMPSGVRVPASPLKGATLTKYLEPVPRPGAGIVVARPSGPNQYTFTQTEIARQLHPELPPTPLWAYDDGSGLGGQAGSFGMAVVAHSGAPLAVSYTNALPETYPSWLPVDTRLTPLGNQVRLMTHLHGGFVAADSDGNPAVTPNGFGPGETQHVFYGNEKPQMPASLLWFHDHGLGTTRLNVFAGLAAAYIVRDEFDTGDEPNPIGIPGGAYELPLVIQDRQFSSDGSFHYPTSDIPGATWIGEYFGDTMLVNGKVWPFLDVEPRMYRFRILNGCNARIMSLDIGGPNLWQIGAEGGLFDIPVPVKHLVLAPAERADVLVDFTRFAGETLVMKNHKPPAPVSTPAPSLPSVMQIRVGTTVSHPGPTAIPSALPGRQADVSGPVATRYLTLNEIDPDDPTWFLNLNGVHFDQGPTTENPKVGTVEDWVYINMTPDTHPMHTHLVTFQVIGRTPFDVQAYEDAHEGPNGVPGGIDPTPFATGPIQPPAPEERGFKDTVKANPGYFTTVRAKFDLPSGVTAPQNYVYHCHIIEHEDNDMMRPFTVTT

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
166 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 3.35
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0018552 3300036401 Bacteria 6215
2 JGI25406J46586_10012870 3300003203 Bacteria 3614
3 Ga0065712_10072623 3300005290 Bacteria 4663
4 Ga0065707_10003374 3300005295 Bacteria 3806
5 Ga0070676_10068418 3300005328 Bacteria 2125
6 Ga0070683_100039976 3300005329 Bacteria 4309
7 Ga0070683_100101918 3300005329 Unclassified 2703
8 Ga0070683_100203046 3300005329 Bacteria 1882
9 Ga0070670_100113039 3300005331 Bacteria 2340
10 Ga0068868_100051334 3300005338 Bacteria 3243
11 Ga0070689_100027649 3300005340 Bacteria 4277
12 Ga0070687_100045157 3300005343 Bacteria 2248
13 Ga0070671_100040193 3300005355 Unclassified 3884
14 Ga0070674_100016754 3300005356 Bacteria 4596
15 Ga0070673_100067848 3300005364 Bacteria 2854
16 Ga0070673_100110159 3300005364 Bacteria 2282
17 Ga0070688_100086695 3300005365 Bacteria 2037
18 Ga0070709_10030343 3300005434 Bacteria 3243
19 Ga0070714_100058766 3300005435 Bacteria 3296
20 Ga0070714_100075969 3300005435 Bacteria 2916
21 Ga0070713_100000296 3300005436 Bacteria 32917
22 Ga0070710_10012042 3300005437 Bacteria 4288
23 Ga0070711_100013466 3300005439 Bacteria 5138
24 Ga0070678_100014110 3300005456 Bacteria 5030
25 Ga0070662_100068941 3300005457 Bacteria 2601
26 Ga0070685_10010093 3300005466 Bacteria 4899
27 Ga0070707_100094102 3300005468 Bacteria 2901
28 Ga0070698_100015943 3300005471 Bacteria 7936
29 Ga0070672_100073979 3300005543 Bacteria 2717
30 Ga0070664_100031629 3300005564 Bacteria 4423
31 Ga0070664_100148533 3300005564 Bacteria 2068
32 Ga0068856_100055998 3300005614 Unclassified 3891
33 Ga0068856_100099257 3300005614 Bacteria 2902
34 Ga0068856_100163443 3300005614 Bacteria 2237
35 Ga0068852_100028804 3300005616 Bacteria 4550
36 Ga0068859_100113018 3300005617 Bacteria 2779
37 Ga0068864_100017693 3300005618 Bacteria 5945
38 Ga0068870_10033054 3300005840 Bacteria 2636
39 Ga0068858_100115749 3300005842 Bacteria 2505
40 Ga0068862_100099459 3300005844 Bacteria 2542
41 Ga0070717_10031427 3300006028 Bacteria 4273
42 Ga0070717_10069684 3300006028 Bacteria 2929
43 Ga0075366_10058463 3300006195 Bacteria 2290
44 Ga0068871_100083901 3300006358 Bacteria 2643
45 Ga0075431_100011459 3300006847 Bacteria 8934
46 Ga0075433_10079321 3300006852 Bacteria 2893
47 Ga0068865_100034657 3300006881 Bacteria 3389
48 Ga0097620_100113026 3300006931 Bacteria 2779
49 Ga0111539_10109617 3300009094 Bacteria 3240
50 Ga0105245_10034455 3300009098 Bacteria 4491
51 Ga0105247_10016871 3300009101 Bacteria 4378
52 Ga0114129_10034718 3300009147 Bacteria 7126
53 Ga0114129_10066078 3300009147 Bacteria 5045
54 Ga0105248_10007843 3300009177 Bacteria 11725
55 Ga0105248_10026952 3300009177 Bacteria 6391
56 Ga0105237_10004952 3300009545 Bacteria 15206
57 Ga0105238_10235774 3300009551 Bacteria 1807
58 Ga0105239_10013752 3300010375 Bacteria 8983
59 Ga0105239_10241449 3300010375 Bacteria 2027
60 Ga0157369_10039622 3300013105 Bacteria 5148
61 Ga0157369_10156039 3300013105 Unclassified 2411
62 Ga0157374_10155864 3300013296 Bacteria 2223
63 Ga0163162_10115750 3300013306 Bacteria 2781
64 Ga0157377_10002263 3300014745 Bacteria 8467
65 Ga0157379_10114773 3300014968 Unclassified 2421
66 Ga0207682_10003549 3300025893 Bacteria 6748
67 Ga0207699_10062638 3300025906 Bacteria 2243
68 Ga0207645_10023132 3300025907 Bacteria 4039
69 Ga0207643_10027749 3300025908 Bacteria 3141
70 Ga0207695_10058972 3300025913 Bacteria 3983
71 Ga0207671_10020459 3300025914 Bacteria 5036
72 Ga0207693_10024096 3300025915 Bacteria 4831
73 Ga0207646_10087629 3300025922 Bacteria 2786
74 Ga0207681_10079095 3300025923 Bacteria 2316
75 Ga0207650_10004200 3300025925 Bacteria 9839
76 Ga0207650_10070479 3300025925 Bacteria 2628
77 Ga0207700_10001004 3300025928 Bacteria 16290
78 Ga0207700_10048733 3300025928 Bacteria 3147
79 Ga0207664_10019878 3300025929 Bacteria 4970
80 Ga0207706_10062042 3300025933 Bacteria 3293
81 Ga0207706_10111134 3300025933 Bacteria 2411
82 Ga0207665_10038461 3300025939 Bacteria 3186
83 Ga0207691_10090725 3300025940 Bacteria 2739
84 Ga0207711_10009182 3300025941 Bacteria 8260
85 Ga0207711_10050700 3300025941 Bacteria 3553
86 Ga0207661_10098335 3300025944 Bacteria 2452
87 Ga0207679_10044326 3300025945 Unclassified 3209
88 Ga0207712_10054419 3300025961 Bacteria 2811
89 Ga0207678_10010008 3300026067 Bacteria 8321
90 Ga0207702_10004876 3300026078 Bacteria 11814
91 Ga0207702_10089301 3300026078 Bacteria 2695
92 Ga0207702_10151934 3300026078 Bacteria 2107
93 Ga0207676_10076011 3300026095 Bacteria 2712
94 Ga0207674_10000205 3300026116 Bacteria 73346
95 Ga0207674_10083206 3300026116 Bacteria 3200
96 Ga0207683_10022237 3300026121 Bacteria 5441
97 Ga0265338_10002840 3300028800 Bacteria 25299
98 Ga0307408_100002305 3300031548 Bacteria 13568
99 Ga0307413_10010518 3300031824 Bacteria 4494
100 Ga0307406_10038383 3300031901 Bacteria 2964
101 Ga0307407_10000489 3300031903 Bacteria 12197
102 Ga0307412_10008872 3300031911 Bacteria 5760
103 Ga0307416_100040575 3300032002 Bacteria 3617
104 Ga0307414_10022499 3300032004 Bacteria 3977
105 Ga0307411_10043930 3300032005 Bacteria 2862
106 Ga0307415_100011845 3300032126 Bacteria 5014
107 Ga0373934_0025314 3300035086 Bacteria 2297
108 Ga0373923_0003702 3300035111 Bacteria 4950
109 Ga0373923_0020616 3300035111 Bacteria 2563
110 Ga0373936_0005844 3300035113 Bacteria 4633
111 Ga0373945_0003487 3300035116 Bacteria 4951
112 Ga0373953_0000462 3300035117 Bacteria 11173
113 Ga0373954_0000725 3300035118 Bacteria 12713
114 Ga0373956_0002808 3300035119 Bacteria 7039
115 Ga0373957_0002429 3300035120 Bacteria 5313
116 Ga0373943_0006374 3300035170 Bacteria 5303
117 Ga0373946_0002558 3300035171 Bacteria 6428
118 Ga0373946_0007847 3300035171 Bacteria 3917
119 Ga0373955_0005873 3300035172 Bacteria 5548
120 Ga0373935_0007608 3300035692 Bacteria 6489
121 Ga0373935_0016429 3300035692 Bacteria 4477
122 Ga0373927_0006466 3300035695 Bacteria 7982
123 Ga0373933_0008096 3300035724 Bacteria 5737
124 Ga0373933_0009039 3300035724 Bacteria 5436
125 Ga0373947_0010026 3300035725 Bacteria 5440
126 Ga0373947_0023326 3300035725 Bacteria 3598
127 Ga0373937_0027596 3300036401 Bacteria 5135
128 Ga0373937_0027618 3300036401 Bacteria 5133
129 Ga0373937_0036842 3300036401 Bacteria 4457
130 Ga0373937_0058889 3300036401 Bacteria 3529
131 Ga0373937_0174948 3300036401 Bacteria 2015
132 Ga0373925_0015696 3300037068 Bacteria 5481
133 Ga0373925_0038792 3300037068 Bacteria 3523
134 Ga0373925_0049160 3300037068 Bacteria 3143
135 Ga0395900_0153416 3300037418 Bacteria 2353
136 Ga0395898_0014131 3300037466 Bacteria 8207
137 Ga0395898_0026551 3300037466 Bacteria 5824
138 Ga0395905_0001567 3300037471 Bacteria 27302
139 Ga0395905_0005189 3300037471 Bacteria 13351
140 Ga0395905_0121417 3300037471 Bacteria 2456
141 Ga0395901_0021829 3300038443 Bacteria 6562
142 Ga0439453_0000255 3300041408 Bacteria 5394
143 Ga0439448_0005154 3300042005 Bacteria 3719
144 Ga0450910_002403 3300042147 Bacteria 2456
145 Ga0439435_0000717 3300042436 Bacteria 5544
146 Ga0439459_0006832 3300042438 Bacteria 1912
147 Ga0495592_0039213 3300046454 Bacteria 3559
148 Ga0495603_0003823 3300046455 Bacteria 8965
149 Ga0495603_0008399 3300046455 Bacteria 6237
150 Ga0495629_0005925 3300046459 Bacteria 9111
151 Ga0495629_0008917 3300046459 Bacteria 7373
152 Ga0495641_0001084 3300046461 Bacteria 23453
153 Ga0495641_0010077 3300046461 Bacteria 5532
154 Ga0495641_0036415 3300046461 Bacteria 2312
155 Ga0495651_0001297 3300046462 Bacteria 19387
156 Ga0495651_0015486 3300046462 Bacteria 5899
157 Ga0495653_0016689 3300046463 Bacteria 5976
158 Ga0495653_0016796 3300046463 Bacteria 5955
159 Ga0495653_0027376 3300046463 Bacteria 4562
160 Ga0495580_0074995 3300046472 Bacteria 2361
161 Ga0495582_0000035 3300046473 Bacteria 71933
162 Ga0495582_0005404 3300046473 Bacteria 7129
163 Ga0495582_0007365 3300046473 Bacteria 6096
164 Ga0495639_0004210 3300046475 Bacteria 6172
165 Ga0495662_0005208 3300046476 Bacteria 6518
166 Ga0495664_0002744 3300046477 Bacteria 9466
167 Ga0495664_0014370 3300046477 Bacteria 4487
168 Ga0495664_0045711 3300046477 Bacteria 2597
169 Ga0495594_0004176 3300046499 Bacteria 7416
170 Ga0495608_0016064 3300046511 Bacteria 5180
171 Ga0495608_0016818 3300046511 Bacteria 5061
172 Ga0495618_0019997 3300046514 Bacteria 4120
173 Ga0495628_0013693 3300046516 Bacteria 6815
174 Ga0495628_0049891 3300046516 Bacteria 3312
175 Ga0495628_0106309 3300046516 Bacteria 2161
176 Ga0495630_0003737 3300046517 Bacteria 10617
177 Ga0495630_0034006 3300046517 Bacteria 3803
178 Ga0495666_0029073 3300046526 Bacteria 2719
179 Ga0495652_0004765 3300046529 Bacteria 12906
180 Ga0495652_0007106 3300046529 Bacteria 10330
181 Ga0495652_0097026 3300046529 Bacteria 2399
182 Ga0495665_0005078 3300046531 Bacteria 7097
183 Ga0495665_0018872 3300046531 Bacteria 3706
184 Ga0495665_0034470 3300046531 Bacteria 2707
185 Ga0495640_0004078 3300046533 Bacteria 11687
186 Ga0495640_0005487 3300046533 Bacteria 10085
187 Ga0495640_0046913 3300046533 Bacteria 2991
188 Ga0495640_0051097 3300046533 Bacteria 2843
189 Ga0495587_0002663 3300046536 Bacteria 11921
190 Ga0495587_0010501 3300046536 Bacteria 5889
191 Ga0495587_0028938 3300046536 Bacteria 3366
192 Ga0495667_0007086 3300046559 Bacteria 7605
193 Ga0495667_0007794 3300046559 Bacteria 7251
194 Ga0495667_0028872 3300046559 Bacteria 3734
195 Ga0495667_0031534 3300046559 Bacteria 3557
196 Ga0495634_0002674 3300046642 Bacteria 14646
197 Ga0495634_0010340 3300046642 Bacteria 6837
198 Ga0495635_0006865 3300046663 Bacteria 7953
199 Ga0495635_0011407 3300046663 Bacteria 6233
200 Ga0495635_0025218 3300046663 Bacteria 4141
201 Ga0495635_0026750 3300046663 Bacteria 4012
202 Ga0495588_0003486 3300046674 Bacteria 6854
203 Ga0495657_0004694 3300046675 Bacteria 10887
204 Ga0495657_0010072 3300046675 Bacteria 7124
205 Ga0495657_0012147 3300046675 Bacteria 6406
206 Ga0495657_0015126 3300046675 Bacteria 5654
207 Ga0495657_0031560 3300046675 Bacteria 3702
208 Ga0495599_0002017 3300046678 Bacteria 11744
209 Ga0495623_0002796 3300046679 Bacteria 11515
210 Ga0495646_0000774 3300046680 Bacteria 17844
211 Ga0495646_0045674 3300046680 Bacteria 2674
212 Ga0495647_0025902 3300046681 Bacteria 2145
213 Ga0495658_0000093 3300046683 Bacteria 46236
214 Ga0495658_0006918 3300046683 Bacteria 5593
215 Ga0495613_0034090 3300046689 Bacteria 3781
216 Ga0495613_0040367 3300046689 Bacteria 3458
217 Ga0495624_0009713 3300046690 Bacteria 6660
218 Ga0495624_0027236 3300046690 Bacteria 3743
219 Ga0495624_0036713 3300046690 Bacteria 3157
220 Ga0495600_0012341 3300046809 Bacteria 5340
221 Ga0495600_0014366 3300046809 Bacteria 4989
222 Ga0495600_0028147 3300046809 Bacteria 3635
223 Ga0495581_0013723 3300047315 Bacteria 4697
224 Ga0495604_0003357 3300047317 Bacteria 12764
225 Ga0495604_0007824 3300047317 Bacteria 8462
226 Ga0495604_0028985 3300047317 Bacteria 4404
227 Ga0495674_0006512 3300047319 Bacteria 11206
228 Ga0495674_0009558 3300047319 Bacteria 9207
229 Ga0495674_0015959 3300047319 Bacteria 7011
230 Ga0495674_0090081 3300047319 Bacteria 2622
231 Ga0495676_0001211 3300047321 Bacteria 22079
232 Ga0495676_0016944 3300047321 Bacteria 6451
233 Ga0495680_0005865 3300047322 Bacteria 11491
234 Ga0495680_0005883 3300047322 Bacteria 11475
235 Ga0495680_0022496 3300047322 Bacteria 5251
236 Ga0495680_0028812 3300047322 Bacteria 4551
237 Ga0495675_0002634 3300047444 Bacteria 10759
238 Ga0495675_0045557 3300047444 Bacteria 2793
239 Ga0495684_0010472 3300047471 Bacteria 7171
240 Ga0495684_0013054 3300047471 Bacteria 6413
241 Ga0495684_0022031 3300047471 Bacteria 4905
242 Ga0495593_0002208 3300047673 Bacteria 11658
243 Ga0495593_0070386 3300047673 Bacteria 1818
244 Ga0495602_0039128 3300048088 Bacteria 4372
245 Ga0495602_0067757 3300048088 Bacteria 3068
246 Ga0496100_0085660 3300048903 Bacteria 2139
247 Ga0496105_0005519 3300048908 Bacteria 9598
248 Ga0496105_0037119 3300048908 Bacteria 4014
249 Ga0496108_0004148 3300048911 Bacteria 11654
250 Ga0496109_0007296 3300048912 Bacteria 9345
251 Ga0496109_0082807 3300048912 Bacteria 2958
252 Ga0496112_0014241 3300048915 Bacteria 7370
253 Ga0496112_0087154 3300048915 Bacteria 3089
254 Ga0496113_0027033 3300048916 Bacteria 4109
255 Ga0501298_008149 3300049521 Bacteria 1753
256 Ga0501040_0138022 3300049576 Bacteria 1716
257 Ga0501048_0112722 3300049582 Bacteria 1921
258 Ga0501198_000004 3300049649 Bacteria 175146
259 Ga0501222_000011 3300049662 Bacteria 100553
260 nmdc:mga05p37_21587_c1 3300050507 Bacteria 7801
261 nmdc:mga05p37_86069_c1 3300050507 Bacteria 3874
262 nmdc:mga09592_32701_c1 3300050508 Bacteria 4337
263 nmdc:mga06r32_116202_c1 3300050510 Bacteria 2636
264 nmdc:mga08y16_89579_c1 3300050511 Bacteria 3206
265 Ga0495595_0000403 3300053084 Bacteria 16426
266 Ga0495595_0041131 3300053084 Bacteria 2114
267 Ga0495595_0045137 3300053084 Bacteria 2026
268 Ga0495595_0045194 3300053084 Bacteria 2025
269 Ga0495619_0009636 3300053085 Bacteria 6092
270 Ga0373937_0018552
271 JGI25406J46586_10012870
272 Ga0065712_10072623
273 Ga0065707_10003374
274 Ga0070676_10068418
275 Ga0070683_100039976
276 Ga0070683_100101918
277 Ga0070683_100203046
278 Ga0070670_100113039
279 Ga0068868_100051334
280 Ga0070689_100027649
281 Ga0070687_100045157
282 Ga0070671_100040193
283 Ga0070674_100016754
284 Ga0070673_100067848
285 Ga0070673_100110159
286 Ga0070688_100086695
287 Ga0070709_10030343
288 Ga0070714_100058766
289 Ga0070714_100075969
290 Ga0070713_100000296
291 Ga0070710_10012042
292 Ga0070711_100013466
293 Ga0070678_100014110
294 Ga0070662_100068941
295 Ga0070685_10010093
296 Ga0070707_100094102
297 Ga0070698_100015943
298 Ga0070672_100073979
299 Ga0070664_100031629
300 Ga0070664_100148533
301 Ga0068856_100055998
302 Ga0068856_100099257
303 Ga0068856_100163443
304 Ga0068852_100028804
305 Ga0068859_100113018
306 Ga0068864_100017693
307 Ga0068870_10033054
308 Ga0068858_100115749
309 Ga0068862_100099459
310 Ga0070717_10031427
311 Ga0070717_10069684
312 Ga0075366_10058463
313 Ga0068871_100083901
314 Ga0075431_100011459
315 Ga0075433_10079321
316 Ga0068865_100034657
317 Ga0097620_100113026
318 Ga0111539_10109617
319 Ga0105245_10034455
320 Ga0105247_10016871
321 Ga0114129_10034718
322 Ga0114129_10066078
323 Ga0105248_10007843
324 Ga0105248_10026952
325 Ga0105237_10004952
326 Ga0105238_10235774
327 Ga0105239_10013752
328 Ga0105239_10241449
329 Ga0157369_10039622
330 Ga0157369_10156039
331 Ga0157374_10155864
332 Ga0163162_10115750
333 Ga0157377_10002263
334 Ga0157379_10114773
335 Ga0207682_10003549
336 Ga0207699_10062638
337 Ga0207645_10023132
338 Ga0207643_10027749
339 Ga0207695_10058972
340 Ga0207671_10020459
341 Ga0207693_10024096
342 Ga0207646_10087629
343 Ga0207681_10079095
344 Ga0207650_10004200
345 Ga0207650_10070479
346 Ga0207700_10001004
347 Ga0207700_10048733
348 Ga0207664_10019878
349 Ga0207706_10062042
350 Ga0207706_10111134
351 Ga0207665_10038461
352 Ga0207691_10090725
353 Ga0207711_10009182
354 Ga0207711_10050700
355 Ga0207661_10098335
356 Ga0207679_10044326
357 Ga0207712_10054419
358 Ga0207678_10010008
359 Ga0207702_10004876
360 Ga0207702_10089301
361 Ga0207702_10151934
362 Ga0207676_10076011
363 Ga0207674_10000205
364 Ga0207674_10083206
365 Ga0207683_10022237
366 Ga0265338_10002840
367 Ga0307408_100002305
368 Ga0307413_10010518
369 Ga0307406_10038383
370 Ga0307407_10000489
371 Ga0307412_10008872
372 Ga0307416_100040575
373 Ga0307414_10022499
374 Ga0307411_10043930
375 Ga0307415_100011845
376 Ga0373934_0025314
377 Ga0373923_0003702
378 Ga0373923_0020616
379 Ga0373936_0005844
380 Ga0373945_0003487
381 Ga0373953_0000462
382 Ga0373954_0000725
383 Ga0373956_0002808
384 Ga0373957_0002429
385 Ga0373943_0006374
386 Ga0373946_0002558
387 Ga0373946_0007847
388 Ga0373955_0005873
389 Ga0373935_0007608
390 Ga0373935_0016429
391 Ga0373927_0006466
392 Ga0373933_0008096
393 Ga0373933_0009039
394 Ga0373947_0010026
395 Ga0373947_0023326
396 Ga0373937_0027596
397 Ga0373937_0027618
398 Ga0373937_0036842
399 Ga0373937_0058889
400 Ga0373937_0174948
401 Ga0373925_0015696
402 Ga0373925_0038792
403 Ga0373925_0049160
404 Ga0395900_0153416
405 Ga0395898_0014131
406 Ga0395898_0026551
407 Ga0395905_0001567
408 Ga0395905_0005189
409 Ga0395905_0121417
410 Ga0395901_0021829
411 Ga0439453_0000255
412 Ga0439448_0005154
413 Ga0450910_002403
414 Ga0439435_0000717
415 Ga0439459_0006832
416 Ga0495592_0039213
417 Ga0495603_0003823
418 Ga0495603_0008399
419 Ga0495629_0005925
420 Ga0495629_0008917
421 Ga0495641_0001084
422 Ga0495641_0010077
423 Ga0495641_0036415
424 Ga0495651_0001297
425 Ga0495651_0015486
426 Ga0495653_0016689
427 Ga0495653_0016796
428 Ga0495653_0027376
429 Ga0495580_0074995
430 Ga0495582_0000035
431 Ga0495582_0005404
432 Ga0495582_0007365
433 Ga0495639_0004210
434 Ga0495662_0005208
435 Ga0495664_0002744
436 Ga0495664_0014370
437 Ga0495664_0045711
438 Ga0495594_0004176
439 Ga0495608_0016064
440 Ga0495608_0016818
441 Ga0495618_0019997
442 Ga0495628_0013693
443 Ga0495628_0049891
444 Ga0495628_0106309
445 Ga0495630_0003737
446 Ga0495630_0034006
447 Ga0495666_0029073
448 Ga0495652_0004765
449 Ga0495652_0007106
450 Ga0495652_0097026
451 Ga0495665_0005078
452 Ga0495665_0018872
453 Ga0495665_0034470
454 Ga0495640_0004078
455 Ga0495640_0005487
456 Ga0495640_0046913
457 Ga0495640_0051097
458 Ga0495587_0002663
459 Ga0495587_0010501
460 Ga0495587_0028938
461 Ga0495667_0007086
462 Ga0495667_0007794
463 Ga0495667_0028872
464 Ga0495667_0031534
465 Ga0495634_0002674
466 Ga0495634_0010340
467 Ga0495635_0006865
468 Ga0495635_0011407
469 Ga0495635_0025218
470 Ga0495635_0026750
471 Ga0495588_0003486
472 Ga0495657_0004694
473 Ga0495657_0010072
474 Ga0495657_0012147
475 Ga0495657_0015126
476 Ga0495657_0031560
477 Ga0495599_0002017
478 Ga0495623_0002796
479 Ga0495646_0000774
480 Ga0495646_0045674
481 Ga0495647_0025902
482 Ga0495658_0000093
483 Ga0495658_0006918
484 Ga0495613_0034090
485 Ga0495613_0040367
486 Ga0495624_0009713
487 Ga0495624_0027236
488 Ga0495624_0036713
489 Ga0495600_0012341
490 Ga0495600_0014366
491 Ga0495600_0028147
492 Ga0495581_0013723
493 Ga0495604_0003357
494 Ga0495604_0007824
495 Ga0495604_0028985
496 Ga0495674_0006512
497 Ga0495674_0009558
498 Ga0495674_0015959
499 Ga0495674_0090081
500 Ga0495676_0001211
501 Ga0495676_0016944
502 Ga0495680_0005865
503 Ga0495680_0005883
504 Ga0495680_0022496
505 Ga0495680_0028812
506 Ga0495675_0002634
507 Ga0495675_0045557
508 Ga0495684_0010472
509 Ga0495684_0013054
510 Ga0495684_0022031
511 Ga0495593_0002208
512 Ga0495593_0070386
513 Ga0495602_0039128
514 Ga0495602_0067757
515 Ga0496100_0085660
516 Ga0496105_0005519
517 Ga0496105_0037119
518 Ga0496108_0004148
519 Ga0496109_0007296
520 Ga0496109_0082807
521 Ga0496112_0014241
522 Ga0496112_0087154
523 Ga0496113_0027033
524 Ga0501298_008149
525 Ga0501040_0138022
526 Ga0501048_0112722
527 Ga0501198_000004
528 Ga0501222_000011
529 nmdc:mga05p37_21587_c1
530 nmdc:mga05p37_86069_c1
531 nmdc:mga09592_32701_c1
532 nmdc:mga06r32_116202_c1
533 nmdc:mga08y16_89579_c1
534 Ga0495595_0000403
535 Ga0495595_0041131
536 Ga0495595_0045137
537 Ga0495595_0045194
538 Ga0495619_0009636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07731

Cu-oxidase_2

Multicopper oxidase

422

584

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uxv-assembly1.cif.gz_A sufi protein from escherichia coli 0.8698 43 561
4a66-assembly1.cif.gz_A mutations in the neighbourhood of cota-laccase trinuclear site: d116a mutant 0.8681 37 561
7y8c-assembly1.cif.gz_A crystal structure of cota laccase complexed with syringaldehyde 0.8679 37 561
4yvn-assembly1.cif.gz_A crystal structure of cota laccase complexed with abts at a novel binding site 0.8675 37 561
4q8b-assembly2.cif.gz_B the crystal structure of cota laccase complexed with sinapic acid 0.8669 37 561
ID Description Score Start End Superfamily
1hkpA02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8954 224 390 2.60.40.420
af_A0A1D6MMA6_228_418_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8824 222 390 2.60.40.420
2wsdA03 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8752 396 561 2.60.40.420
2uxtB02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.853 222 391 2.60.40.420
2xu9A03 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.851 396 561 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A2V5V2D2-F1-model_v4 Plastocyanin-like domain-containing protein 0.9555 329 560 GO:0005507
GO:0016491
AF-A0A2V5V2D2-F1-model_v4 Plastocyanin-like domain-containing protein 0.9282 329 560 GO:0005507
GO:0016491
AF-A0A532AG91-F1-model_v4 Multicopper oxidase family protein 0.9218 280 357
AF-A0A7W8IVF7-F1-model_v4 deleted 0.9074 37 560
AF-A0A6P3ZC87-F1-model_v4 Uncharacterized protein LOC107409543 0.9048 65 561 GO:0005507
GO:0016491

Map