F376225

General Info

Members Datasets Scaffolds Average Seq Length
269 182 256 561

Family's Representative Sequence

Representative Sequence 3300015689|Ga0183360_10003|Ga0183360_1000346
Length 597
Sequence MRTCGNGEGFASKERRFVRSNAIKQGPARAXXXXMLRATGLSDAAIARPLVAVVHTWSDVSPCNITLRDLAQHVRRGVVDGGGTPIEFNTIAVTDGIAMGSDGMRASLASRETIADSIELAVSGHCLDAMVLLVGCDKTIPAAAMAAARLDIPTVILYGGTIMPGHCPSKKGSAQDKPLTVQDVFEAVGAHSAGRIDDAELHRIESHACPGAGACGGQFTANTMAMVLTFLGLSPLGYNDVPAIHDDKPETARLCGELVMQRLRDGSPTPRQLITAASLRNAARAVSATAGSTNAALHLLAIAHEAGVAFDLEEFEAAAHTPVIADLKPGGRYTAAEMFEFGGAALVARELETAGLIEDIPTVTGRSFFQELREATMAAQQDVVRPISDPIKPRGGYSIIYGNLAPEGCILKLAGHGREHFEGPARVFDSEEAAFAAVQARKIQAGDVVVIRFEGPTGGPGMREMLAVTAALVGQGLSNDVALITDGRFSGATHGFMVGHISPEAAHGGPIARLREGDRVVIDVATRTLSVTADLAAREPARIAARVTTGVLAKYARSVGSASRGAVTAPGPLQAPKKIEATLIENAVAQTEASEPA

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221573 Lysobacter sp. Root604 Isolate Unclassified
3 2643221586 Lysobacter sp. Root667 Isolate Unclassified
4 2643221593 Lysobacter sp. Root690 Isolate Unclassified
5 2643221612 Lysobacter sp. Root76 Isolate Unclassified
6 2643221695 Lysobacter sp. Root494 Isolate Unclassified
7 2643221720 Lysobacter sp. Root916 Isolate Unclassified
8 2643221727 Lysobacter sp. Root96 Isolate Unclassified
9 2643221728 Lysobacter sp. Root983 Isolate Unclassified
10 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
11 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
12 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0.74
Isolates 4.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.52
Nodule 0
Rhizoplane 7.06
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000118 3300003187 Bacteria 106502
2 JGI25407J50210_10010937 3300003373 Bacteria 2315
3 Ga0055526_1000082 3300003771 Bacteria 87106
4 Ga0055526_1008826 3300003771 Bacteria 4955
5 Ga0055537_1000189 3300003773 Bacteria 46083
6 Ga0055524_1000138 3300003775 Bacteria 87106
7 Ga0055534_1000056 3300003784 Bacteria 87106
8 Ga0055528_1000061 3300003790 Bacteria 87106
9 Ga0070683_100010929 3300005329 Bacteria 7819
10 Ga0070683_100152165 3300005329 Bacteria 2193
11 Ga0068869_100016724 3300005334 Bacteria 4950
12 Ga0070680_100061648 3300005336 Bacteria 3070
13 Ga0070691_10005265 3300005341 Bacteria 5876
14 Ga0070669_100000893 3300005353 Bacteria 21703
15 Ga0070674_100087914 3300005356 Bacteria 2235
16 Ga0070659_100000013 3300005366 Bacteria 178795
17 Ga0070714_100022360 3300005435 Bacteria 5185
18 Ga0070710_10000005 3300005437 Bacteria 238049
19 Ga0070711_100006961 3300005439 Bacteria 6859
20 Ga0070663_100024334 3300005455 Bacteria 4074
21 Ga0070681_10000811 3300005458 Bacteria 26116
22 Ga0070681_10122256 3300005458 Bacteria 2536
23 Ga0070679_100007411 3300005530 Bacteria 10255
24 Ga0070679_100166259 3300005530 Bacteria 2179
25 Ga0070684_100068490 3300005535 Bacteria 3119
26 Ga0070684_100073223 3300005535 Bacteria 3018
27 Ga0068853_100000633 3300005539 Bacteria 24186
28 Ga0068853_100001279 3300005539 Bacteria 18039
29 Ga0068853_100118030 3300005539 Bacteria 2364
30 Ga0068855_100003554 3300005563 Bacteria 19058
31 Ga0068855_100020683 3300005563 Bacteria 7892
32 Ga0068855_100034179 3300005563 Bacteria 6065
33 Ga0068855_100220233 3300005563 Bacteria 2128
34 Ga0068855_100234050 3300005563 Bacteria 2055
35 Ga0068857_100017489 3300005577 Bacteria 6283
36 Ga0068857_100089782 3300005577 Bacteria 2750
37 Ga0068854_100000040 3300005578 Bacteria 94111
38 Ga0068856_100035808 3300005614 Bacteria 4865
39 Ga0068856_100194138 3300005614 Bacteria 2044
40 Ga0068863_100023697 3300005841 Bacteria 5857
41 Ga0081538_10000176 3300005981 Bacteria 69195
42 Ga0081538_10001359 3300005981 Bacteria 25184
43 Ga0081538_10010493 3300005981 Bacteria 7596
44 Ga0081539_10017727 3300005985 Bacteria 4983
45 Ga0075430_100086930 3300006846 Bacteria 2616
46 Ga0105240_10034663 3300009093 Bacteria 6508
47 Ga0105240_10041383 3300009093 Bacteria 5881
48 Ga0105240_10050751 3300009093 Bacteria 5227
49 Ga0114129_10209549 3300009147 Bacteria 2635
50 Ga0105237_10040591 3300009545 Bacteria 4692
51 Ga0105239_10032892 3300010375 Bacteria 5698
52 Ga0157370_10016822 3300013104 Bacteria 7392
53 Ga0157369_10004990 3300013105 Bacteria 15536
54 Ga0163163_10012398 3300014325 Bacteria 7765
55 Ga0183360_10003 3300015689 Bacteria 713221
56 Ga0206353_10536032 3300020082 Bacteria 1873
57 Ga0206353_11402528 3300020082 Bacteria 6533
58 Ga0209565_1000002 3300025263 Bacteria 1423083
59 Ga0209673_1000002 3300025273 Bacteria 1423083
60 Ga0209673_1005456 3300025273 Bacteria 6383
61 Ga0209675_1000002 3300025291 Bacteria 1423083
62 Ga0209675_1006827 3300025291 Bacteria 4501
63 Ga0209676_1000830 3300025292 Bacteria 40120
64 Ga0209676_1001547 3300025292 Bacteria 20686
65 Ga0209676_1003524 3300025292 Bacteria 9546
66 Ga0209676_1016893 3300025292 Bacteria 2608
67 Ga0209025_1000200 3300025294 Bacteria 146048
68 Ga0209025_1004811 3300025294 Bacteria 11425
69 Ga0209025_1010388 3300025294 Bacteria 6312
70 Ga0209564_1000004 3300025295 Bacteria 1424639
71 Ga0209050_1001053 3300025298 Bacteria 33972
72 Ga0209050_1018641 3300025298 Bacteria 2683
73 Ga0209256_1000004 3300025299 Bacteria 1424643
74 Ga0209256_1013480 3300025299 Bacteria 3029
75 Ga0209256_1013488 3300025299 Bacteria 3027
76 Ga0209257_1000499 3300025304 Bacteria 70103
77 Ga0209257_1001516 3300025304 Bacteria 27229
78 Ga0209257_1002421 3300025304 Bacteria 18635
79 Ga0209257_1003982 3300025304 Bacteria 11945
80 Ga0209257_1015828 3300025304 Bacteria 3102
81 Ga0207692_10000009 3300025898 Bacteria 159859
82 Ga0207707_10001956 3300025912 Bacteria 18739
83 Ga0207707_10168980 3300025912 Bacteria 1911
84 Ga0207695_10043202 3300025913 Bacteria 4804
85 Ga0207695_10056351 3300025913 Bacteria 4090
86 Ga0207663_10002794 3300025916 Bacteria 8410
87 Ga0207660_10015418 3300025917 Bacteria 5044
88 Ga0207657_10000220 3300025919 Bacteria 59453
89 Ga0207657_10022582 3300025919 Bacteria 5883
90 Ga0207649_10042039 3300025920 Bacteria 2786
91 Ga0207652_10027198 3300025921 Bacteria 4765
92 Ga0207681_10003242 3300025923 Bacteria 10201
93 Ga0207681_10003454 3300025923 Bacteria 9848
94 Ga0207700_10012104 3300025928 Bacteria 5544
95 Ga0207700_10014165 3300025928 Bacteria 5217
96 Ga0207690_10000017 3300025932 Bacteria 243513
97 Ga0207689_10039835 3300025942 Bacteria 3890
98 Ga0207661_10042504 3300025944 Bacteria 3583
99 Ga0207667_10003176 3300025949 Bacteria 20327
100 Ga0207667_10072108 3300025949 Bacteria 3590
101 Ga0207667_10099612 3300025949 Bacteria 2998
102 Ga0207667_10118425 3300025949 Bacteria 2729
103 Ga0207640_10000164 3300025981 Bacteria 48360
104 Ga0207639_10000507 3300026041 Bacteria 26971
105 Ga0207639_10012976 3300026041 Bacteria 5815
106 Ga0207678_10018329 3300026067 Bacteria 6149
107 Ga0207678_10058812 3300026067 Bacteria 3307
108 Ga0207641_10019526 3300026088 Bacteria 5563
109 Ga0207674_10007130 3300026116 Bacteria 13061
110 Ga0207674_10014751 3300026116 Bacteria 8621
111 Ga0207674_10019237 3300026116 Bacteria 7403
112 Ga0207674_10066821 3300026116 Bacteria 3621
113 Ga0265319_1000118 3300028563 Bacteria 60393
114 Ga0265319_1007788 3300028563 Bacteria 4768
115 Ga0265338_10135841 3300028800 Bacteria 1933
116 Ga0265325_10062156 3300031241 Bacteria 1892
117 Ga0265327_10031446 3300031251 Bacteria 2981
118 Ga0307513_10002988 3300031456 Bacteria 23047
119 Ga0265342_10057437 3300031712 Bacteria 2303
120 Ga0307405_10044548 3300031731 Bacteria 2714
121 Ga0307413_10007492 3300031824 Bacteria 5074
122 Ga0307406_10001670 3300031901 Bacteria 12193
123 Ga0307406_10013183 3300031901 Bacteria 4731
124 Ga0307407_10047887 3300031903 Bacteria 2429
125 Ga0307409_100010796 3300031995 Bacteria 5708
126 Ga0307409_100037236 3300031995 Bacteria 3585
127 Ga0307416_100054477 3300032002 Bacteria 3215
128 Ga0307416_100073891 3300032002 Bacteria 2845
129 Ga0307415_100004144 3300032126 Bacteria 7475
130 Ga0373936_0009627 3300035113 Bacteria 3641
131 Ga0373943_0003537 3300035170 Bacteria 7113
132 Ga0373943_0005936 3300035170 Bacteria 5479
133 Ga0373946_0002397 3300035171 Bacteria 6625
134 Ga0373933_0012034 3300035724 Bacteria 4778
135 Ga0373947_0013339 3300035725 Bacteria 4708
136 Ga0373947_0051540 3300035725 Bacteria 2476
137 Ga0373925_0022169 3300037068 Bacteria 4631
138 Ga0373925_0108349 3300037068 Bacteria 2143
139 Ga0436364_1001093 3300037853 Bacteria 18888
140 Ga0395901_0030010 3300038443 Bacteria 5601
141 Ga0395901_0302500 3300038443 Bacteria 1658
142 Ga0436365_1307359 3300039437 Bacteria 6990
143 Ga0436361_1064348 3300039447 Bacteria 8842
144 Ga0439436_0003541 3300041404 Bacteria 4747
145 Ga0451853_0382273 3300041512 Bacteria 2687
146 Ga0439449_0004633 3300042007 Bacteria 5309
147 Ga0466961_0096252 3300044693 Bacteria 1867
148 Ga0453684_0000437 3300044712 Bacteria 169900
149 Ga0466968_0034521 3300044735 Bacteria 2111
150 Ga0466959_0119481 3300045049 Bacteria 1875
151 Ga0451576_0000081 3300045051 Bacteria 239875
152 Ga0466967_0030223 3300045976 Bacteria 4544
153 Ga0495629_0000259 3300046459 Bacteria 46161
154 Ga0495641_0004478 3300046461 Bacteria 9847
155 Ga0495641_0013440 3300046461 Bacteria 4500
156 Ga0495641_0048306 3300046461 Bacteria 1951
157 Ga0495651_0036802 3300046462 Bacteria 3810
158 Ga0495651_0069105 3300046462 Bacteria 2691
159 Ga0495653_0105450 3300046463 Bacteria 2035
160 Ga0495582_0000691 3300046473 Bacteria 18603
161 Ga0495639_0008897 3300046475 Bacteria 4304
162 Ga0495662_0003250 3300046476 Bacteria 8215
163 Ga0495664_0027758 3300046477 Bacteria 3302
164 Ga0495608_0025557 3300046511 Bacteria 4031
165 Ga0495618_0000030 3300046514 Bacteria 108007
166 Ga0495618_0030602 3300046514 Bacteria 3362
167 Ga0495630_0000468 3300046517 Bacteria 30293
168 Ga0495630_0004772 3300046517 Bacteria 9507
169 Ga0495630_0038867 3300046517 Bacteria 3559
170 Ga0495630_0040319 3300046517 Bacteria 3490
171 Ga0495652_0076327 3300046529 Bacteria 2780
172 Ga0495652_0094002 3300046529 Bacteria 2446
173 Ga0495665_0000285 3300046531 Bacteria 25625
174 Ga0495645_0000021 3300046543 Bacteria 137604
175 Ga0495645_0002081 3300046543 Bacteria 13608
176 Ga0495667_0007617 3300046559 Bacteria 7345
177 Ga0495667_0022535 3300046559 Bacteria 4243
178 Ga0495668_0001014 3300046616 Bacteria 30117
179 Ga0495634_0045308 3300046642 Bacteria 2974
180 Ga0495634_0085306 3300046642 Bacteria 2058
181 Ga0495635_0005061 3300046663 Bacteria 9168
182 Ga0495635_0011242 3300046663 Bacteria 6277
183 Ga0495657_0000017 3300046675 Bacteria 174558
184 Ga0495657_0042625 3300046675 Bacteria 3097
185 Ga0495658_0000432 3300046683 Bacteria 23385
186 Ga0495658_0028655 3300046683 Bacteria 3008
187 Ga0495613_0001501 3300046689 Bacteria 17766
188 Ga0495613_0051188 3300046689 Bacteria 3045
189 Ga0495613_0094246 3300046689 Bacteria 2167
190 Ga0495624_0046525 3300046690 Bacteria 2758
191 Ga0495600_0033197 3300046809 Bacteria 3350
192 Ga0495581_0002629 3300047315 Bacteria 10220
193 Ga0495674_0000162 3300047319 Bacteria 51804
194 Ga0495674_0009798 3300047319 Bacteria 9097
195 Ga0495674_0044222 3300047319 Bacteria 3960
196 Ga0495672_0005870 3300047320 Bacteria 9627
197 Ga0495676_0001661 3300047321 Bacteria 19426
198 Ga0495676_0037570 3300047321 Bacteria 4029
199 Ga0495680_0003807 3300047322 Bacteria 14645
200 Ga0495680_0007205 3300047322 Bacteria 10241
201 Ga0495680_0012825 3300047322 Bacteria 7345
202 Ga0495680_0041021 3300047322 Bacteria 3682
203 Ga0495675_0008763 3300047444 Bacteria 6280
204 Ga0495684_0000907 3300047471 Bacteria 24057
205 Ga0495684_0016248 3300047471 Bacteria 5731
206 Ga0495684_0041772 3300047471 Bacteria 3513
207 Ga0495593_0005218 3300047673 Bacteria 7678
208 Ga0495614_0003740 3300048089 Bacteria 6839
209 Ga0496100_0000105 3300048903 Bacteria 48698
210 Ga0496100_0039109 3300048903 Bacteria 3011
211 Ga0496101_0005434 3300048904 Bacteria 8119
212 Ga0496101_0006376 3300048904 Bacteria 7593
213 Ga0496102_0092455 3300048905 Bacteria 2801
214 Ga0496104_0000037 3300048907 Bacteria 178518
215 Ga0496104_0096628 3300048907 Bacteria 2826
216 Ga0496105_0024118 3300048908 Bacteria 4941
217 Ga0496107_0095553 3300048910 Bacteria 2174
218 Ga0496107_0099978 3300048910 Bacteria 2126
219 Ga0496109_0069875 3300048912 Bacteria 3222
220 Ga0496110_0000266 3300048913 Bacteria 33831
221 Ga0496111_0000672 3300048914 Bacteria 17962
222 Ga0496111_0016445 3300048914 Bacteria 5096
223 Ga0496112_0006681 3300048915 Bacteria 10156
224 Ga0496112_0144052 3300048915 Bacteria 2351
225 Ga0496113_0080615 3300048916 Bacteria 2493
226 Ga0496114_0036230 3300048917 Bacteria 4077
227 Ga0496114_0037591 3300048917 Bacteria 4004
228 Ga0496121_0003183 3300048924 Bacteria 23661
229 Ga0501031_0004350 3300049568 Bacteria 9164
230 Ga0501032_0000994 3300049569 Bacteria 22837
231 Ga0501033_0008456 3300049570 Bacteria 7969
232 Ga0501034_0001262 3300049571 Bacteria 34347
233 Ga0501036_0020650 3300049572 Bacteria 5532
234 Ga0501038_0003208 3300049574 Bacteria 15263
235 Ga0501043_0001501 3300049579 Bacteria 20365
236 Ga0501043_0001679 3300049579 Bacteria 19220
237 Ga0501046_0001275 3300049580 Bacteria 24406
238 Ga0501047_0015182 3300049581 Bacteria 7332
239 Ga0501068_0029227 3300049584 Bacteria 3263
240 Ga0501072_0012835 3300049588 Bacteria 6405
241 Ga0501073_0010811 3300049589 Bacteria 6685
242 Ga0501075_0020337 3300049591 Bacteria 4827
243 Ga0501076_0029046 3300049592 Bacteria 4298
244 Ga0501077_0124488 3300049593 Bacteria 1634
245 Ga0501079_0040998 3300049741 Bacteria 3573
246 Ga0501081_0041203 3300049743 Bacteria 3162
247 Ga0501275_000351 3300049772 Bacteria 5260
248 Ga0501035_0015608 3300049822 Bacteria 7009
249 Ga0501044_0001236 3300049823 Bacteria 30366
250 Ga0501045_0104609 3300049824 Bacteria 2097
251 Ga0495595_0001623 3300053084 Bacteria 8789
252 Ga0495619_0003205 3300053085 Bacteria 10585
253 Ga0495619_0009958 3300053085 Bacteria 5986
254 Ga0495619_0033064 3300053085 Bacteria 3358
255 Ga0500616_0007126 3300053153 Bacteria 7158
256 Ga0501084_0079099 3300054114 Bacteria 2756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0094246 Ga0495613_0094246_19_1389 449
2 3300035724 Ga0373933_0012034 Ga0373933_0012034_3347_4759 463
3 3300048916 Ga0496113_0080615 Ga0496113_0080615_1023_2480 475
4 3300048908 Ga0496105_0024118 Ga0496105_0024118_36_1487 476
5 3300046559 Ga0495667_0022535 Ga0495667_0022535_127_1602 478
6 3300045976 Ga0466967_0030223 Ga0466967_0030223_1969_3558 488
7 3300044693 Ga0466961_0096252 Ga0466961_0096252_13_1536 500
8 3300049593 Ga0501077_0124488 Ga0501077_0124488_88_1620 503
9 3300044712 Ga0453684_0000437 Ga0453684_0000437_125446_127035 504
10 3300045051 Ga0451576_0000081 Ga0451576_0000081_42866_44455 504
11 3300039437 Ga0436365_1307359 Ga0436365_1307359_2868_4481 525
12 3300035725 Ga0373947_0051540 Ga0373947_0051540_71_1675 527
13 3300046463 Ga0495653_0105450 Ga0495653_0105450_402_2006 527
14 3300046642 Ga0495634_0085306 Ga0495634_0085306_444_2048 527
15 3300047322 Ga0495680_0041021 Ga0495680_0041021_75_1679 527
16 3300048917 Ga0496114_0036230 Ga0496114_0036230_2425_4029 527
17 3300038443 Ga0395901_0302500 Ga0395901_0302500_41_1648 528
18 3300054114 Ga0501084_0079099 Ga0501084_0079099_150_1760 529
19 3300048905 Ga0496102_0092455 Ga0496102_0092455_956_2569 531
20 3300035113 Ga0373936_0009627 Ga0373936_0009627_1647_3335 532
21 3300035170 Ga0373943_0003537 Ga0373943_0003537_4133_5821 532
22 3300035725 Ga0373947_0013339 Ga0373947_0013339_1080_2768 532
23 3300037068 Ga0373925_0108349 Ga0373925_0108349_238_1926 532
24 3300046461 Ga0495641_0048306 Ga0495641_0048306_105_1793 532
25 3300046517 Ga0495630_0040319 Ga0495630_0040319_138_1826 532
26 3300046689 Ga0495613_0051188 Ga0495613_0051188_1150_2838 532
27 3300032002 Ga0307416_100073891 Ga0307416_1000738912 536
28 3300032126 Ga0307415_100004144 Ga0307415_1000041444 536
29 3300005336 Ga0070680_100061648 Ga0070680_1000616482 537
30 3300005458 Ga0070681_10000811 Ga0070681_1000081118 537
31 3300005577 Ga0068857_100017489 Ga0068857_1000174897 537
32 3300025912 Ga0207707_10001956 Ga0207707_1000195612 537
33 3300025917 Ga0207660_10015418 Ga0207660_100154184 537
34 3300025920 Ga0207649_10042039 Ga0207649_100420392 537
35 3300026116 Ga0207674_10014751 Ga0207674_100147514 537
36 3300046511 Ga0495608_0025557 Ga0495608_0025557_2028_3716 539
37 3300049584 Ga0501068_0029227 Ga0501068_0029227_1288_2952 542
38 3300049588 Ga0501072_0012835 Ga0501072_0012835_2671_4344 542
39 3300049591 Ga0501075_0020337 Ga0501075_0020337_1415_3088 542
40 3300049592 Ga0501076_0029046 Ga0501076_0029046_357_2030 542
41 3300049741 Ga0501079_0040998 Ga0501079_0040998_1193_2866 542
42 3300049824 Ga0501045_0104609 Ga0501045_0104609_181_1854 542
43 3300005356 Ga0070674_100087914 Ga0070674_1000879141 543
44 3300005366 Ga0070659_100000013 Ga0070659_10000001360 543
45 3300005437 Ga0070710_10000005 Ga0070710_10000005242 543
46 3300005439 Ga0070711_100006961 Ga0070711_1000069617 543
47 3300009093 Ga0105240_10050751 Ga0105240_100507513 543
48 3300025898 Ga0207692_10000009 Ga0207692_10000009152 543
49 3300025913 Ga0207695_10056351 Ga0207695_100563515 543
50 3300025916 Ga0207663_10002794 Ga0207663_100027942 543
51 3300025923 Ga0207681_10003242 Ga0207681_100032428 543
52 3300025928 Ga0207700_10014165 Ga0207700_100141653 543
53 3300025932 Ga0207690_10000017 Ga0207690_10000017248 543
54 3300026116 Ga0207674_10019237 Ga0207674_100192377 543
55 3300045049 Ga0466959_0119481 Ga0466959_0119481_168_1856 543
56 3300046514 Ga0495618_0000030 Ga0495618_0000030_32378_34057 543
57 3300046517 Ga0495630_0000468 Ga0495630_0000468_25399_27078 543
58 3300046543 Ga0495645_0000021 Ga0495645_0000021_67500_69188 543
59 3300046543 Ga0495645_0002081 Ga0495645_0002081_5563_7251 543
60 3300046675 Ga0495657_0000017 Ga0495657_0000017_102810_104489 543
61 3300047320 Ga0495672_0005870 Ga0495672_0005870_6374_8062 543
62 3300047321 Ga0495676_0037570 Ga0495676_0037570_429_2120 543
63 3300047471 Ga0495684_0016248 Ga0495684_0016248_2858_4537 543
64 3300048903 Ga0496100_0000105 Ga0496100_0000105_14097_15785 543
65 3300048904 Ga0496101_0005434 Ga0496101_0005434_5308_6996 543
66 3300048914 Ga0496111_0016445 Ga0496111_0016445_702_2390 543
67 3300003373 JGI25407J50210_10010937 JGI25407J50210_100109372 544
68 3300005329 Ga0070683_100010929 Ga0070683_1000109295 544
69 3300005341 Ga0070691_10005265 Ga0070691_100052654 544
70 3300005435 Ga0070714_100022360 Ga0070714_1000223602 544
71 3300005455 Ga0070663_100024334 Ga0070663_1000243344 544
72 3300005458 Ga0070681_10122256 Ga0070681_101222562 544
73 3300005530 Ga0070679_100007411 Ga0070679_1000074117 544
74 3300005530 Ga0070679_100166259 Ga0070679_1001662592 544
75 3300005535 Ga0070684_100068490 Ga0070684_1000684902 544
76 3300005535 Ga0070684_100073223 Ga0070684_1000732233 544
77 3300005539 Ga0068853_100118030 Ga0068853_1001180302 544
78 3300005563 Ga0068855_100034179 Ga0068855_1000341792 544
79 3300005563 Ga0068855_100220233 Ga0068855_1002202332 544
80 3300005563 Ga0068855_100234050 Ga0068855_1002340501 544
81 3300005578 Ga0068854_100000040 Ga0068854_10000004061 544
82 3300005614 Ga0068856_100035808 Ga0068856_1000358081 544
83 3300005981 Ga0081538_10000176 Ga0081538_1000017615 544
84 3300005981 Ga0081538_10010493 Ga0081538_100104936 544
85 3300006846 Ga0075430_100086930 Ga0075430_1000869302 544
86 3300009093 Ga0105240_10034663 Ga0105240_100346635 544
87 3300009093 Ga0105240_10041383 Ga0105240_100413833 544
88 3300010375 Ga0105239_10032892 Ga0105239_100328923 544
89 3300013104 Ga0157370_10016822 Ga0157370_100168223 544
90 3300013105 Ga0157369_10004990 Ga0157369_1000499011 544
91 3300020082 Ga0206353_10536032 Ga0206353_105360321 544
92 3300020082 Ga0206353_11402528 Ga0206353_114025285 544
93 3300025912 Ga0207707_10168980 Ga0207707_101689802 544
94 3300025913 Ga0207695_10043202 Ga0207695_100432022 544
95 3300025919 Ga0207657_10000220 Ga0207657_1000022047 544
96 3300025919 Ga0207657_10022582 Ga0207657_100225824 544
97 3300025921 Ga0207652_10027198 Ga0207652_100271982 544
98 3300025928 Ga0207700_10012104 Ga0207700_100121043 544
99 3300025944 Ga0207661_10042504 Ga0207661_100425043 544
100 3300025949 Ga0207667_10072108 Ga0207667_100721082 544
101 3300025949 Ga0207667_10099612 Ga0207667_100996122 544
102 3300025949 Ga0207667_10118425 Ga0207667_101184252 544
103 3300025981 Ga0207640_10000164 Ga0207640_100001645 544
104 3300026067 Ga0207678_10018329 Ga0207678_100183293 544
105 3300028563 Ga0265319_1000118 Ga0265319_10001188 544
106 3300028563 Ga0265319_1007788 Ga0265319_10077882 544
107 3300028800 Ga0265338_10135841 Ga0265338_101358412 544
108 3300031241 Ga0265325_10062156 Ga0265325_100621561 544
109 3300031251 Ga0265327_10031446 Ga0265327_100314462 544
110 3300031712 Ga0265342_10057437 Ga0265342_100574372 544
111 3300031995 Ga0307409_100037236 Ga0307409_1000372362 544
112 3300035170 Ga0373943_0005936 Ga0373943_0005936_929_2617 544
113 3300035171 Ga0373946_0002397 Ga0373946_0002397_1098_2786 544
114 3300037068 Ga0373925_0022169 Ga0373925_0022169_2213_3901 544
115 3300037853 Ga0436364_1001093 Ga0436364_1001093_16310_17986 544
116 3300044735 Ga0466968_0034521 Ga0466968_0034521_343_2031 544
117 3300046459 Ga0495629_0000259 Ga0495629_0000259_15754_17442 544
118 3300046461 Ga0495641_0004478 Ga0495641_0004478_4960_6648 544
119 3300046461 Ga0495641_0013440 Ga0495641_0013440_2608_4293 544
120 3300046462 Ga0495651_0036802 Ga0495651_0036802_983_2671 544
121 3300046462 Ga0495651_0069105 Ga0495651_0069105_588_2276 544
122 3300046473 Ga0495582_0000691 Ga0495582_0000691_3636_5324 544
123 3300046475 Ga0495639_0008897 Ga0495639_0008897_738_2426 544
124 3300046476 Ga0495662_0003250 Ga0495662_0003250_4500_6188 544
125 3300046477 Ga0495664_0027758 Ga0495664_0027758_227_1915 544
126 3300046514 Ga0495618_0030602 Ga0495618_0030602_1278_2966 544
127 3300046517 Ga0495630_0004772 Ga0495630_0004772_1789_3477 544
128 3300046517 Ga0495630_0038867 Ga0495630_0038867_248_1939 544
129 3300046529 Ga0495652_0076327 Ga0495652_0076327_28_1716 544
130 3300046529 Ga0495652_0094002 Ga0495652_0094002_37_1725 544
131 3300046531 Ga0495665_0000285 Ga0495665_0000285_6845_8533 544
132 3300046559 Ga0495667_0007617 Ga0495667_0007617_768_2456 544
133 3300046642 Ga0495634_0045308 Ga0495634_0045308_393_2081 544
134 3300046663 Ga0495635_0005061 Ga0495635_0005061_3500_5188 544
135 3300046663 Ga0495635_0011242 Ga0495635_0011242_1497_3185 544
136 3300046675 Ga0495657_0042625 Ga0495657_0042625_1201_2892 544
137 3300046683 Ga0495658_0000432 Ga0495658_0000432_19433_21121 544
138 3300046683 Ga0495658_0028655 Ga0495658_0028655_34_1722 544
139 3300046689 Ga0495613_0001501 Ga0495613_0001501_13013_14701 544
140 3300046690 Ga0495624_0046525 Ga0495624_0046525_1000_2688 544
141 3300046809 Ga0495600_0033197 Ga0495600_0033197_895_2583 544
142 3300047315 Ga0495581_0002629 Ga0495581_0002629_1328_3016 544
143 3300047319 Ga0495674_0000162 Ga0495674_0000162_48558_50246 544
144 3300047319 Ga0495674_0009798 Ga0495674_0009798_666_2354 544
145 3300047319 Ga0495674_0044222 Ga0495674_0044222_544_2232 544
146 3300047321 Ga0495676_0001661 Ga0495676_0001661_16785_18473 544
147 3300047322 Ga0495680_0003807 Ga0495680_0003807_9779_11467 544
148 3300047322 Ga0495680_0007205 Ga0495680_0007205_7287_8978 544
149 3300047322 Ga0495680_0012825 Ga0495680_0012825_1558_3246 544
150 3300047444 Ga0495675_0008763 Ga0495675_0008763_3099_4790 544
151 3300047471 Ga0495684_0000907 Ga0495684_0000907_10789_12477 544
152 3300047471 Ga0495684_0041772 Ga0495684_0041772_482_2170 544
153 3300047673 Ga0495593_0005218 Ga0495593_0005218_114_1802 544
154 3300048089 Ga0495614_0003740 Ga0495614_0003740_4306_5994 544
155 3300048903 Ga0496100_0039109 Ga0496100_0039109_423_2111 544
156 3300048904 Ga0496101_0006376 Ga0496101_0006376_4429_6117 544
157 3300048907 Ga0496104_0000037 Ga0496104_0000037_84101_85792 544
158 3300048907 Ga0496104_0096628 Ga0496104_0096628_394_2082 544
159 3300048910 Ga0496107_0095553 Ga0496107_0095553_427_2115 544
160 3300048910 Ga0496107_0099978 Ga0496107_0099978_423_2111 544
161 3300048912 Ga0496109_0069875 Ga0496109_0069875_579_2267 544
162 3300048913 Ga0496110_0000266 Ga0496110_0000266_13608_15299 544
163 3300048914 Ga0496111_0000672 Ga0496111_0000672_12592_14283 544
164 3300048915 Ga0496112_0006681 Ga0496112_0006681_4544_6232 544
165 3300048915 Ga0496112_0144052 Ga0496112_0144052_157_1845 544
166 3300048917 Ga0496114_0037591 Ga0496114_0037591_2282_3970 544
167 3300053084 Ga0495595_0001623 Ga0495595_0001623_2307_3995 544
168 3300053085 Ga0495619_0003205 Ga0495619_0003205_4065_5753 544
169 3300053085 Ga0495619_0009958 Ga0495619_0009958_552_2240 544
170 3300053085 Ga0495619_0033064 Ga0495619_0033064_1266_2954 544
171 3300005981 Ga0081538_10001359 Ga0081538_1000135913 545
172 3300031731 Ga0307405_10044548 Ga0307405_100445482 545
173 3300031903 Ga0307407_10047887 Ga0307407_100478872 545
174 3300031995 Ga0307409_100010796 Ga0307409_1000107962 545
175 3300032002 Ga0307416_100054477 Ga0307416_1000544772 545
176 3300053153 Ga0500616_0007126 Ga0500616_0007126_406_2094 545
177 3300005329 Ga0070683_100152165 Ga0070683_1001521652 546
178 3300038443 Ga0395901_0030010 Ga0395901_0030010_996_2687 546
179 3300005614 Ga0068856_100194138 Ga0068856_1001941383 547
180 3300005985 Ga0081539_10017727 Ga0081539_100177272 547
181 3300014325 Ga0163163_10012398 Ga0163163_100123987 547
182 3300009147 Ga0114129_10209549 Ga0114129_102095492 549
183 3300039447 Ga0436361_1064348 Ga0436361_1064348_5550_7274 549
184 3300049579 Ga0501043_0001501 Ga0501043_0001501_14481_16166 549
185 3300049743 Ga0501081_0041203 Ga0501081_0041203_341_2041 549
186 iso_pu_bacteria 2643221695 2644530091 550
187 3300009545 Ga0105237_10040591 Ga0105237_100405913 552
188 3300049568 Ga0501031_0004350 Ga0501031_0004350_5872_7542 552
189 3300049569 Ga0501032_0000994 Ga0501032_0000994_2701_4371 552
190 3300049570 Ga0501033_0008456 Ga0501033_0008456_3598_5268 552
191 3300049571 Ga0501034_0001262 Ga0501034_0001262_18449_20119 552
192 3300049572 Ga0501036_0020650 Ga0501036_0020650_1007_2677 552
193 3300049574 Ga0501038_0003208 Ga0501038_0003208_5801_7471 552
194 3300049579 Ga0501043_0001679 Ga0501043_0001679_3221_4891 552
195 3300049580 Ga0501046_0001275 Ga0501046_0001275_8406_10076 552
196 3300049581 Ga0501047_0015182 Ga0501047_0015182_2573_4243 552
197 3300049589 Ga0501073_0010811 Ga0501073_0010811_2315_3985 552
198 3300049822 Ga0501035_0015608 Ga0501035_0015608_3598_5268 552
199 3300049823 Ga0501044_0001236 Ga0501044_0001236_14204_15874 552
200 3300041512 Ga0451853_0382273 Ga0451853_0382273_207_1973 553
201 3300042007 Ga0439449_0004633 Ga0439449_0004633_3101_4801 553
202 3300025304 Ga0209257_1002421 Ga0209257_10024211 554
203 3300031456 Ga0307513_10002988 Ga0307513_100029884 556
204 3300048924 Ga0496121_0003183 Ga0496121_0003183_10048_11739 559
205 3300041404 Ga0439436_0003541 Ga0439436_0003541_2650_4332 560
206 3300031824 Ga0307413_10007492 Ga0307413_100074921 562
207 3300003771 Ga0055526_1008826 Ga0055526_10088263 566
208 3300005334 Ga0068869_100016724 Ga0068869_1000167242 566
209 3300025273 Ga0209673_1005456 Ga0209673_10054562 566
210 3300025292 Ga0209676_1001547 Ga0209676_10015476 566
211 3300025292 Ga0209676_1003524 Ga0209676_10035245 566
212 3300025294 Ga0209025_1004811 Ga0209025_10048116 566
213 3300025298 Ga0209050_1001053 Ga0209050_100105310 566
214 3300025299 Ga0209256_1013480 Ga0209256_10134801 566
215 3300025299 Ga0209256_1013488 Ga0209256_10134882 566
216 3300025304 Ga0209257_1001516 Ga0209257_100151614 566
217 3300025304 Ga0209257_1003982 Ga0209257_10039826 566
218 3300025304 Ga0209257_1015828 Ga0209257_10158283 566
219 3300025942 Ga0207689_10039835 Ga0207689_100398353 566
220 3300025298 Ga0209050_1018641 Ga0209050_10186412 567
221 3300025304 Ga0209257_1000499 Ga0209257_100049932 567
222 iso_pu_bacteria 2894414249 2894414965 567
223 3300025294 Ga0209025_1010388 Ga0209025_10103884 568
224 3300005539 Ga0068853_100000633 Ga0068853_10000063321 569
225 3300005563 Ga0068855_100003554 Ga0068855_1000035543 569
226 3300005841 Ga0068863_100023697 Ga0068863_1000236974 569
227 3300025949 Ga0207667_10003176 Ga0207667_1000317615 569
228 3300026041 Ga0207639_10000507 Ga0207639_1000050721 569
229 3300026067 Ga0207678_10058812 Ga0207678_100588122 569
230 3300026088 Ga0207641_10019526 Ga0207641_100195262 569
231 3300026116 Ga0207674_10066821 Ga0207674_100668212 569
232 3300005539 Ga0068853_100001279 Ga0068853_1000012795 570
233 3300005563 Ga0068855_100020683 Ga0068855_1000206832 570
234 3300005577 Ga0068857_100089782 Ga0068857_1000897822 570
235 3300026041 Ga0207639_10012976 Ga0207639_100129763 570
236 3300026116 Ga0207674_10007130 Ga0207674_100071302 570
237 3300049772 Ga0501275_000351 Ga0501275_000351_2301_4058 570
238 iso_pu_bacteria 8003014200 8003017421 570
239 3300025292 Ga0209676_1016893 Ga0209676_10168932 571
240 iso_pu_bacteria 2941489479 2941492467 572
241 iso_pu_bacteria 2995948881 2995953275 572
242 3300005353 Ga0070669_100000893 Ga0070669_10000089311 573
243 3300025923 Ga0207681_10003454 Ga0207681_100034545 573
244 iso_pu_bacteria 2643221573 2643881064 573
245 iso_pu_bacteria 2643221593 2643977578 573
246 iso_pu_bacteria 2643221720 2644661834 573
247 iso_pu_bacteria 2643221728 2644699975 573
248 3300025291 Ga0209675_1006827 Ga0209675_10068273 574
249 3300025292 Ga0209676_1000830 Ga0209676_10008303 574
250 3300003771 Ga0055526_1000082 Ga0055526_100008230 575
251 3300003773 Ga0055537_1000189 Ga0055537_100018930 575
252 3300003775 Ga0055524_1000138 Ga0055524_100013850 575
253 3300003784 Ga0055534_1000056 Ga0055534_100005650 575
254 3300003790 Ga0055528_1000061 Ga0055528_100006150 575
255 3300025263 Ga0209565_1000002 Ga0209565_100000246 575
256 3300025273 Ga0209673_1000002 Ga0209673_100000246 575
257 3300025291 Ga0209675_1000002 Ga0209675_100000246 575
258 3300025295 Ga0209564_1000004 Ga0209564_100000447 575
259 3300025299 Ga0209256_1000004 Ga0209256_100000447 575
260 3300031901 Ga0307406_10013183 Ga0307406_100131832 575
261 3300015689 Ga0183360_10003 Ga0183360_1000346 576
262 3300031901 Ga0307406_10001670 Ga0307406_100016702 576
263 3300046616 Ga0495668_0001014 Ga0495668_0001014_11837_13576 577
264 iso_pu_bacteria 2643221559 2643816115 577
265 iso_pu_bacteria 2643221586 2643939197 577
266 iso_pu_bacteria 2643221612 2644077878 577
267 iso_pu_bacteria 2643221727 2644697149 577
268 3300003187 JGI25151J46595_10000118 JGI25151J46595_1000011847 578
269 3300025294 Ga0209025_1000200 Ga0209025_100020036 578

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00920

ILVD_EDD

Dehydratase family

48

566

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ovt-assembly1.cif.gz_A crystal structure of ilvd from mycobacterium tuberculosis 0.9627 2 552
5ze4-assembly1.cif.gz_A the structure of holo- structure of dhad complex with [2fe-2s] cluster 0.9466 3 551
6ovt-assembly1.cif.gz_A crystal structure of ilvd from mycobacterium tuberculosis 0.9426 2 552
5ym0-assembly1.cif.gz_A the crystal structure of dhad 0.9408 3 552
6ovt-assembly1.cif.gz_B crystal structure of ilvd from mycobacterium tuberculosis 0.9403 2 552
ID Description Score Start End Superfamily
af_Q58672_371_522_3.50.30.80 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like 0.971 379 517 3.50.30.80
af_I1M137_1_420_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.961 3 377 3.40.50.1820
af_A0A1D6KMC8_411_524_3.50.30.80 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;IlvD/EDD C-terminal domain-like 0.9567 380 487 3.50.30.80
af_Q2FWK7_1_375_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9416 1 378 3.40.50.360
af_Q2FWK7_1_375_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9391 1 378 3.40.50.360
ID Description Score Start End GO Terms
AF-T1CF31-F1-model_v4 Dihydroxy-acid and 6-phosphogluconate dehydratase (EC 4.-.-.-) 0.9892 1 139 GO:0004160
GO:0009082
AF-A0A3L7YQ24-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.988 2 148 GO:0004160
GO:0009082
AF-A0A257VVI1-F1-model_v4 Dihydroxy-acid dehydratase 0.9869 1 136 GO:0004160
GO:0009082
AF-A0A7C9VIY0-F1-model_v4 Dihydroxy-acid dehydratase (EC 4.2.1.9) 0.9855 1 145 GO:0004160
GO:0009082
AF-A0A7V9CE95-F1-model_v4 Dihydroxy-acid dehydratase 0.9852 8 132 GO:0004160
GO:0009082

Feature Viewer

pLDDT pTM Quality
89.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map