F376212

General Info

Members Datasets Scaffolds Average Seq Length
269 165 538 153

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10619921|Ga0157378_106199212
Length 173
Sequence MPAAAPRTWILTSSPDNHVATAERGFSVIGIKERNRARALQMEPGDRIVLYLTKVMRFAAAIRIAGELYEDRERIWPGGTARVRRRGMATTSGDAGGPGKADAYPWRFETEPELVLEQPSWLAAESVKDDLEHIRKWPAEHWKLAFQGQLRIVSDADAALLMDRMHAASGVPA

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 6.32
Rhizosphere 88.85
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10619921 3300013297 Unclassified 1095
2 JGI25407J50210_10000072 3300003373 Bacteria 12528
3 JGI25407J50210_10005263 3300003373 Bacteria 3172
4 JGI25407J50210_10036497 3300003373 Bacteria 1264
5 JGI25407J50210_10042809 3300003373 Bacteria 1158
6 Ga0070658_10639675 3300005327 Bacteria 923
7 Ga0070676_10013011 3300005328 Bacteria 4559
8 Ga0070683_100206027 3300005329 Bacteria 1868
9 Ga0070683_100433612 3300005329 Bacteria 1254
10 Ga0070670_100499967 3300005331 Bacteria 1081
11 Ga0068869_100536412 3300005334 Bacteria 981
12 Ga0068868_100554398 3300005338 Bacteria 1013
13 Ga0070660_100313756 3300005339 Bacteria 1287
14 Ga0070692_10001742 3300005345 Bacteria 8108
15 Ga0070692_10742033 3300005345 Bacteria 665
16 Ga0070692_10746757 3300005345 Bacteria 663
17 Ga0070668_100008084 3300005347 Bacteria 7813
18 Ga0070668_101195369 3300005347 Bacteria 689
19 Ga0070669_100327083 3300005353 Bacteria 1239
20 Ga0070674_100536108 3300005356 Bacteria 980
21 Ga0070659_100802464 3300005366 Bacteria 819
22 Ga0070714_100254063 3300005435 Unclassified 1626
23 Ga0070710_10000010 3300005437 Bacteria 141733
24 Ga0070700_100352553 3300005441 Bacteria 1091
25 Ga0070662_100002821 3300005457 Bacteria 10778
26 Ga0070662_100668634 3300005457 Bacteria 877
27 Ga0070684_100114717 3300005535 Bacteria 2418
28 Ga0070696_100067424 3300005546 Bacteria 2511
29 Ga0070693_100194008 3300005547 Bacteria 1315
30 Ga0070665_100002739 3300005548 Bacteria 19090
31 Ga0068855_102216279 3300005563 Bacteria 551
32 Ga0068855_102558224 3300005563 Bacteria 507
33 Ga0070664_101315507 3300005564 Bacteria 683
34 Ga0068854_100969909 3300005578 Bacteria 751
35 Ga0068856_100078456 3300005614 Bacteria 3274
36 Ga0068861_100013411 3300005719 Bacteria 5735
37 Ga0068861_100984666 3300005719 Unclassified 804
38 Ga0081455_10025470 3300005937 Bacteria 5459
39 Ga0081538_10000067 3300005981 Bacteria 97828
40 Ga0081538_10000123 3300005981 Bacteria 78578
41 Ga0081538_10000178 3300005981 Bacteria 69139
42 Ga0081538_10002572 3300005981 Bacteria 17617
43 Ga0081538_10002656 3300005981 Bacteria 17256
44 Ga0081538_10027834 3300005981 Bacteria 3905
45 Ga0081538_10050278 3300005981 Bacteria 2519
46 Ga0081538_10116951 3300005981 Bacteria 1292
47 Ga0081538_10215066 3300005981 Bacteria 770
48 Ga0081539_10003833 3300005985 Bacteria 17661
49 Ga0070717_10635080 3300006028 Bacteria 969
50 Ga0075365_10040977 3300006038 Bacteria 3023
51 Ga0075365_10436081 3300006038 Unclassified 925
52 Ga0075363_100083932 3300006048 Unclassified 1746
53 Ga0075363_100164349 3300006048 Bacteria 1258
54 Ga0075432_10053009 3300006058 Bacteria 1434
55 Ga0070716_100586810 3300006173 Bacteria 836
56 Ga0075367_10183189 3300006178 Unclassified 1306
57 Ga0075428_100005159 3300006844 Bacteria 14522
58 Ga0075428_100007042 3300006844 Bacteria 12467
59 Ga0075428_100052172 3300006844 Bacteria 4484
60 Ga0075428_100190398 3300006844 Bacteria 2219
61 Ga0075428_100240824 3300006844 Bacteria 1952
62 Ga0075428_100650901 3300006844 Bacteria 1124
63 Ga0075430_100027521 3300006846 Bacteria 4830
64 Ga0075430_100051126 3300006846 Bacteria 3484
65 Ga0075430_100194990 3300006846 Bacteria 1683
66 Ga0075430_100563154 3300006846 Bacteria 940
67 Ga0075431_100013225 3300006847 Bacteria 8336
68 Ga0075431_100171402 3300006847 Bacteria 2229
69 Ga0075431_100182744 3300006847 Bacteria 2152
70 Ga0075431_100763300 3300006847 Bacteria 942
71 Ga0075433_10541223 3300006852 Bacteria 1024
72 Ga0075429_100034035 3300006880 Bacteria 4427
73 Ga0075429_100118324 3300006880 Bacteria 2316
74 Ga0075435_100306626 3300007076 Bacteria 1358
75 Ga0105240_10004015 3300009093 Bacteria 22661
76 Ga0111539_10010062 3300009094 Bacteria 11923
77 Ga0111539_10404343 3300009094 Bacteria 1590
78 Ga0111539_10993826 3300009094 Unclassified 975
79 Ga0111539_10995052 3300009094 Bacteria 975
80 Ga0105245_10005746 3300009098 Bacteria 10886
81 Ga0114129_10008528 3300009147 Bacteria 14609
82 Ga0114129_10090319 3300009147 Bacteria 4247
83 Ga0114129_10095672 3300009147 Bacteria 4113
84 Ga0114129_10663234 3300009147 Bacteria 1345
85 Ga0105243_11305809 3300009148 Bacteria 743
86 Ga0105243_11440700 3300009148 Bacteria 711
87 Ga0105243_12839998 3300009148 Bacteria 525
88 Ga0105249_10093825 3300009553 Bacteria 2812
89 Ga0105239_10756064 3300010375 Bacteria 1113
90 Ga0157369_12079571 3300013105 Bacteria 576
91 Ga0163162_10255401 3300013306 Bacteria 1885
92 Ga0163163_10161234 3300014325 Bacteria 2288
93 Ga0157377_10120014 3300014745 Bacteria 1592
94 Ga0157376_10123469 3300014969 Bacteria 2299
95 Ga0163161_10018143 3300017792 Bacteria 4933
96 Ga0207692_10000006 3300025898 Bacteria 294686
97 Ga0207645_10165436 3300025907 Bacteria 1448
98 Ga0207705_10453129 3300025909 Bacteria 995
99 Ga0207695_10007369 3300025913 Bacteria 14038
100 Ga0207693_10000195 3300025915 Bacteria 54912
101 Ga0207649_10227652 3300025920 Bacteria 1332
102 Ga0207687_10531500 3300025927 Bacteria 985
103 Ga0207664_10000006 3300025929 Bacteria 408702
104 Ga0207664_10181532 3300025929 Unclassified 1807
105 Ga0207690_10572168 3300025932 Bacteria 920
106 Ga0207690_10632680 3300025932 Bacteria 875
107 Ga0207706_10160043 3300025933 Bacteria 1979
108 Ga0207665_10524765 3300025939 Bacteria 917
109 Ga0207679_10360250 3300025945 Bacteria 1270
110 Ga0207712_10048841 3300025961 Bacteria 2946
111 Ga0207712_10657211 3300025961 Bacteria 911
112 Ga0207668_10017202 3300025972 Bacteria 4525
113 Ga0207640_10921925 3300025981 Bacteria 764
114 Ga0207678_10314323 3300026067 Bacteria 1347
115 Ga0207708_10016523 3300026075 Bacteria 5551
116 Ga0207702_10276500 3300026078 Bacteria 1586
117 Ga0207675_100038992 3300026118 Bacteria 4434
118 Ga0207428_10090275 3300027907 Bacteria 2380
119 Ga0207428_10628924 3300027907 Bacteria 772
120 Ga0268266_10004876 3300028379 Bacteria 12729
121 Ga0265338_10030312 3300028800 Bacteria 5332
122 Ga0307408_100078292 3300031548 Bacteria 2464
123 Ga0307405_10602918 3300031731 Unclassified 896
124 Ga0307410_10451737 3300031852 Bacteria 1048
125 Ga0307410_10605593 3300031852 Unclassified 914
126 Ga0307406_10183211 3300031901 Unclassified 1526
127 Ga0307407_10311234 3300031903 Bacteria 1102
128 Ga0307409_100025923 3300031995 Bacteria 4123
129 Ga0307409_100875682 3300031995 Bacteria 910
130 Ga0307409_101766247 3300031995 Bacteria 648
131 Ga0307416_100004151 3300032002 Bacteria 8679
132 Ga0307416_100226364 3300032002 Unclassified 1799
133 Ga0307416_100485905 3300032002 Bacteria 1296
134 Ga0307416_101264272 3300032002 Bacteria 844
135 Ga0307416_102404970 3300032002 Unclassified 626
136 Ga0307414_10114844 3300032004 Bacteria 2058
137 Ga0307411_10469864 3300032005 Bacteria 1057
138 Ga0307415_100287158 3300032126 Bacteria 1356
139 Ga0373949_0027947 3300035090 Bacteria 1329
140 Ga0373952_0068036 3300035092 Bacteria 885
141 Ga0373961_0116254 3300035241 Bacteria 881
142 Ga0373962_0114865 3300035242 Bacteria 853
143 Ga0373931_0056947 3300035691 Bacteria 2095
144 Ga0373947_0292145 3300035725 Bacteria 1085
145 Ga0395901_0306189 3300038443 Bacteria 1647
146 Ga0439440_0026546 3300042993 Bacteria 1341
147 Ga0466960_0066083 3300044901 Bacteria 1787
148 Ga0466960_0137646 3300044901 Bacteria 1294
149 Ga0495605_0049299 3300046474 Bacteria 2058
150 Ga0495584_0139966 3300046491 Bacteria 1229
151 Ga0495584_0177711 3300046491 Bacteria 1082
152 Ga0495584_0368266 3300046491 Bacteria 730
153 Ga0495596_0058427 3300046500 Unclassified 1504
154 Ga0495596_0198203 3300046500 Bacteria 780
155 Ga0495608_0546408 3300046511 Bacteria 698
156 Ga0495616_0100519 3300046513 Unclassified 1357
157 Ga0495620_0242904 3300046515 Bacteria 687
158 Ga0495663_0039647 3300046525 Unclassified 1428
159 Ga0495652_0249403 3300046529 Bacteria 1316
160 Ga0495598_0141755 3300046537 Bacteria 832
161 Ga0495609_0131219 3300046538 Unclassified 1073
162 Ga0495621_0348797 3300046539 Unclassified 621
163 Ga0495633_0325191 3300046558 Bacteria 698
164 Ga0495656_0116949 3300046615 Unclassified 1254
165 Ga0495668_0294223 3300046616 Bacteria 890
166 Ga0495611_0053948 3300046648 Bacteria 1816
167 Ga0495661_0349514 3300046665 Bacteria 728
168 Ga0495646_0239506 3300046680 Bacteria 975
169 Ga0495600_0080855 3300046809 Bacteria 2121
170 Ga0495660_0189570 3300046810 Bacteria 989
171 Ga0495660_0313036 3300046810 Bacteria 708
172 Ga0495604_0001345 3300047317 Bacteria 20102
173 Ga0495672_0026140 3300047320 Bacteria 3727
174 Ga0495672_0140069 3300047320 Unclassified 1264
175 Ga0496100_0035524 3300048903 Bacteria 3135
176 Ga0496100_0216846 3300048903 Bacteria 1403
177 Ga0496100_0926964 3300048903 Bacteria 684
178 Ga0496101_0000268 3300048904 Bacteria 36733
179 Ga0496102_0917541 3300048905 Bacteria 797
180 Ga0496104_0000034 3300048907 Bacteria 186572
181 Ga0496104_0880997 3300048907 Bacteria 800
182 Ga0496105_0333448 3300048908 Unclassified 1214
183 Ga0496108_0107697 3300048911 Bacteria 2380
184 Ga0496108_0853771 3300048911 Bacteria 783
185 Ga0496109_0036449 3300048912 Bacteria 4439
186 Ga0496110_0000056 3300048913 Bacteria 56734
187 Ga0496110_1026798 3300048913 Bacteria 732
188 Ga0496111_0001856 3300048914 Bacteria 12473
189 Ga0496112_0002280 3300048915 Bacteria 15341
190 Ga0496113_0015763 3300048916 Bacteria 5206
191 Ga0496114_0467207 3300048917 Bacteria 1117
192 Ga0496124_0570327 3300048927 Bacteria 743
193 Ga0501031_0185623 3300049568 Bacteria 1358
194 Ga0501031_0478678 3300049568 Bacteria 804
195 Ga0501033_0122121 3300049570 Bacteria 1890
196 Ga0501036_0065324 3300049572 Bacteria 3080
197 Ga0501036_0192845 3300049572 Bacteria 1714
198 Ga0501038_0317751 3300049574 Bacteria 1219
199 Ga0501038_0448271 3300049574 Unclassified 993
200 Ga0501039_0229929 3300049575 Bacteria 1458
201 Ga0501039_0396529 3300049575 Bacteria 1084
202 Ga0501040_0114022 3300049576 Bacteria 1892
203 Ga0501040_0176745 3300049576 Bacteria 1512
204 Ga0501041_0042914 3300049577 Bacteria 2749
205 Ga0501041_0153566 3300049577 Bacteria 1438
206 Ga0501041_0400585 3300049577 Bacteria 869
207 Ga0501042_0037566 3300049578 Bacteria 3437
208 Ga0501042_0129428 3300049578 Bacteria 1819
209 Ga0501042_0332352 3300049578 Bacteria 1098
210 Ga0501046_0624706 3300049580 Bacteria 763
211 Ga0501048_0064806 3300049582 Bacteria 2584
212 Ga0501048_0127721 3300049582 Bacteria 1798
213 Ga0501069_0337198 3300049585 Bacteria 887
214 Ga0501069_0516896 3300049585 Bacteria 713
215 Ga0501070_0925258 3300049586 Bacteria 679
216 Ga0501071_0061353 3300049587 Bacteria 2723
217 Ga0501071_0205095 3300049587 Bacteria 1482
218 Ga0501071_0345238 3300049587 Bacteria 1132
219 Ga0501071_0934945 3300049587 Bacteria 669
220 Ga0501072_0050761 3300049588 Bacteria 3266
221 Ga0501072_0439953 3300049588 Bacteria 1033
222 Ga0501072_0570910 3300049588 Bacteria 893
223 Ga0501072_0628026 3300049588 Bacteria 846
224 Ga0501072_0830182 3300049588 Bacteria 723
225 Ga0501074_0084597 3300049590 Bacteria 2274
226 Ga0501074_0611938 3300049590 Bacteria 770
227 Ga0501076_0079187 3300049592 Bacteria 2637
228 Ga0501076_0175411 3300049592 Bacteria 1747
229 Ga0501076_1298370 3300049592 Bacteria 598
230 Ga0501080_0569375 3300049742 Bacteria 1008
231 Ga0501081_0098349 3300049743 Bacteria 2066
232 Ga0501081_0582316 3300049743 Bacteria 837
233 Ga0501081_0588472 3300049743 Bacteria 833
234 nmdc:mga03n38_411578_c1 3300050490 Bacteria 746
235 nmdc:mga03n38_439822_c1 3300050490 Unclassified 724
236 nmdc:mga00v17_283596_c1 3300050491 Bacteria 1075
237 nmdc:mga0yw44_129832_c1 3300050492 Unclassified 1630
238 nmdc:mga0yw44_447532_c1 3300050492 Bacteria 875
239 nmdc:mga06z11_372230_c1 3300050494 Unclassified 857
240 nmdc:mga06z11_487964_c1 3300050494 Bacteria 746
241 nmdc:mga05p37_403614_c1 3300050507 Bacteria 1595
242 nmdc:mga05p37_406469_c1 3300050507 Bacteria 1588
243 nmdc:mga05p37_766802_c1 3300050507 Bacteria 1061
244 nmdc:mga05p37_81791_c1 3300050507 Bacteria 3979
245 nmdc:mga09592_120655_c1 3300050508 Bacteria 2252
246 nmdc:mga09592_311739_c1 3300050508 Bacteria 1363
247 nmdc:mga09592_55992_c1 3300050508 Bacteria 3332
248 nmdc:mga0qj67_48144_c1 3300050509 Bacteria 3368
249 nmdc:mga0qj67_78120_c1 3300050509 Bacteria 2649
250 nmdc:mga06r32_155536_c1 3300050510 Bacteria 2268
251 nmdc:mga06r32_179888_c1 3300050510 Bacteria 2100
252 nmdc:mga06r32_340538_c1 3300050510 Bacteria 1484
253 nmdc:mga06r32_593195_c1 3300050510 Bacteria 1079
254 nmdc:mga06r32_70401_c1 3300050510 Bacteria 3382
255 nmdc:mga08y16_1927885_c1 3300050511 Bacteria 541
256 nmdc:mga08y16_26125_c1 3300050511 Bacteria 6159
257 nmdc:mga0n895_1362421_c1 3300050512 Bacteria 679
258 nmdc:mga0rr50_394027_c1 3300050513 Bacteria 1169
259 nmdc:mga0a205_718638_c1 3300050515 Bacteria 848
260 Ga0495601_0021927 3300053077 Bacteria 3917
261 Ga0495655_0088688 3300053083 Unclassified 898
262 Ga0501084_0050066 3300054114 Bacteria 3497
263 Ga0501084_0264975 3300054114 Bacteria 1451
264 Ga0501084_0592925 3300054114 Unclassified 936
265 Ga0501082_0058761 3300060353 Bacteria 3314
266 Ga0501082_0149032 3300060353 Bacteria 2032
267 Ga0501082_0267383 3300060353 Bacteria 1488
268 Ga0530510_0007365 3300061734 Bacteria 7662
269 Ga0530510_0830235 3300061734 Bacteria 705
270 Ga0157378_10619921
271 JGI25407J50210_10000072
272 JGI25407J50210_10005263
273 JGI25407J50210_10036497
274 JGI25407J50210_10042809
275 Ga0070658_10639675
276 Ga0070676_10013011
277 Ga0070683_100206027
278 Ga0070683_100433612
279 Ga0070670_100499967
280 Ga0068869_100536412
281 Ga0068868_100554398
282 Ga0070660_100313756
283 Ga0070692_10001742
284 Ga0070692_10742033
285 Ga0070692_10746757
286 Ga0070668_100008084
287 Ga0070668_101195369
288 Ga0070669_100327083
289 Ga0070674_100536108
290 Ga0070659_100802464
291 Ga0070714_100254063
292 Ga0070710_10000010
293 Ga0070700_100352553
294 Ga0070662_100002821
295 Ga0070662_100668634
296 Ga0070684_100114717
297 Ga0070696_100067424
298 Ga0070693_100194008
299 Ga0070665_100002739
300 Ga0068855_102216279
301 Ga0068855_102558224
302 Ga0070664_101315507
303 Ga0068854_100969909
304 Ga0068856_100078456
305 Ga0068861_100013411
306 Ga0068861_100984666
307 Ga0081455_10025470
308 Ga0081538_10000067
309 Ga0081538_10000123
310 Ga0081538_10000178
311 Ga0081538_10002572
312 Ga0081538_10002656
313 Ga0081538_10027834
314 Ga0081538_10050278
315 Ga0081538_10116951
316 Ga0081538_10215066
317 Ga0081539_10003833
318 Ga0070717_10635080
319 Ga0075365_10040977
320 Ga0075365_10436081
321 Ga0075363_100083932
322 Ga0075363_100164349
323 Ga0075432_10053009
324 Ga0070716_100586810
325 Ga0075367_10183189
326 Ga0075428_100005159
327 Ga0075428_100007042
328 Ga0075428_100052172
329 Ga0075428_100190398
330 Ga0075428_100240824
331 Ga0075428_100650901
332 Ga0075430_100027521
333 Ga0075430_100051126
334 Ga0075430_100194990
335 Ga0075430_100563154
336 Ga0075431_100013225
337 Ga0075431_100171402
338 Ga0075431_100182744
339 Ga0075431_100763300
340 Ga0075433_10541223
341 Ga0075429_100034035
342 Ga0075429_100118324
343 Ga0075435_100306626
344 Ga0105240_10004015
345 Ga0111539_10010062
346 Ga0111539_10404343
347 Ga0111539_10993826
348 Ga0111539_10995052
349 Ga0105245_10005746
350 Ga0114129_10008528
351 Ga0114129_10090319
352 Ga0114129_10095672
353 Ga0114129_10663234
354 Ga0105243_11305809
355 Ga0105243_11440700
356 Ga0105243_12839998
357 Ga0105249_10093825
358 Ga0105239_10756064
359 Ga0157369_12079571
360 Ga0163162_10255401
361 Ga0163163_10161234
362 Ga0157377_10120014
363 Ga0157376_10123469
364 Ga0163161_10018143
365 Ga0207692_10000006
366 Ga0207645_10165436
367 Ga0207705_10453129
368 Ga0207695_10007369
369 Ga0207693_10000195
370 Ga0207649_10227652
371 Ga0207687_10531500
372 Ga0207664_10000006
373 Ga0207664_10181532
374 Ga0207690_10572168
375 Ga0207690_10632680
376 Ga0207706_10160043
377 Ga0207665_10524765
378 Ga0207679_10360250
379 Ga0207712_10048841
380 Ga0207712_10657211
381 Ga0207668_10017202
382 Ga0207640_10921925
383 Ga0207678_10314323
384 Ga0207708_10016523
385 Ga0207702_10276500
386 Ga0207675_100038992
387 Ga0207428_10090275
388 Ga0207428_10628924
389 Ga0268266_10004876
390 Ga0265338_10030312
391 Ga0307408_100078292
392 Ga0307405_10602918
393 Ga0307410_10451737
394 Ga0307410_10605593
395 Ga0307406_10183211
396 Ga0307407_10311234
397 Ga0307409_100025923
398 Ga0307409_100875682
399 Ga0307409_101766247
400 Ga0307416_100004151
401 Ga0307416_100226364
402 Ga0307416_100485905
403 Ga0307416_101264272
404 Ga0307416_102404970
405 Ga0307414_10114844
406 Ga0307411_10469864
407 Ga0307415_100287158
408 Ga0373949_0027947
409 Ga0373952_0068036
410 Ga0373961_0116254
411 Ga0373962_0114865
412 Ga0373931_0056947
413 Ga0373947_0292145
414 Ga0395901_0306189
415 Ga0439440_0026546
416 Ga0466960_0066083
417 Ga0466960_0137646
418 Ga0495605_0049299
419 Ga0495584_0139966
420 Ga0495584_0177711
421 Ga0495584_0368266
422 Ga0495596_0058427
423 Ga0495596_0198203
424 Ga0495608_0546408
425 Ga0495616_0100519
426 Ga0495620_0242904
427 Ga0495663_0039647
428 Ga0495652_0249403
429 Ga0495598_0141755
430 Ga0495609_0131219
431 Ga0495621_0348797
432 Ga0495633_0325191
433 Ga0495656_0116949
434 Ga0495668_0294223
435 Ga0495611_0053948
436 Ga0495661_0349514
437 Ga0495646_0239506
438 Ga0495600_0080855
439 Ga0495660_0189570
440 Ga0495660_0313036
441 Ga0495604_0001345
442 Ga0495672_0026140
443 Ga0495672_0140069
444 Ga0496100_0035524
445 Ga0496100_0216846
446 Ga0496100_0926964
447 Ga0496101_0000268
448 Ga0496102_0917541
449 Ga0496104_0000034
450 Ga0496104_0880997
451 Ga0496105_0333448
452 Ga0496108_0107697
453 Ga0496108_0853771
454 Ga0496109_0036449
455 Ga0496110_0000056
456 Ga0496110_1026798
457 Ga0496111_0001856
458 Ga0496112_0002280
459 Ga0496113_0015763
460 Ga0496114_0467207
461 Ga0496124_0570327
462 Ga0501031_0185623
463 Ga0501031_0478678
464 Ga0501033_0122121
465 Ga0501036_0065324
466 Ga0501036_0192845
467 Ga0501038_0317751
468 Ga0501038_0448271
469 Ga0501039_0229929
470 Ga0501039_0396529
471 Ga0501040_0114022
472 Ga0501040_0176745
473 Ga0501041_0042914
474 Ga0501041_0153566
475 Ga0501041_0400585
476 Ga0501042_0037566
477 Ga0501042_0129428
478 Ga0501042_0332352
479 Ga0501046_0624706
480 Ga0501048_0064806
481 Ga0501048_0127721
482 Ga0501069_0337198
483 Ga0501069_0516896
484 Ga0501070_0925258
485 Ga0501071_0061353
486 Ga0501071_0205095
487 Ga0501071_0345238
488 Ga0501071_0934945
489 Ga0501072_0050761
490 Ga0501072_0439953
491 Ga0501072_0570910
492 Ga0501072_0628026
493 Ga0501072_0830182
494 Ga0501074_0084597
495 Ga0501074_0611938
496 Ga0501076_0079187
497 Ga0501076_0175411
498 Ga0501076_1298370
499 Ga0501080_0569375
500 Ga0501081_0098349
501 Ga0501081_0582316
502 Ga0501081_0588472
503 nmdc:mga03n38_411578_c1
504 nmdc:mga03n38_439822_c1
505 nmdc:mga00v17_283596_c1
506 nmdc:mga0yw44_129832_c1
507 nmdc:mga0yw44_447532_c1
508 nmdc:mga06z11_372230_c1
509 nmdc:mga06z11_487964_c1
510 nmdc:mga05p37_403614_c1
511 nmdc:mga05p37_406469_c1
512 nmdc:mga05p37_766802_c1
513 nmdc:mga05p37_81791_c1
514 nmdc:mga09592_120655_c1
515 nmdc:mga09592_311739_c1
516 nmdc:mga09592_55992_c1
517 nmdc:mga0qj67_48144_c1
518 nmdc:mga0qj67_78120_c1
519 nmdc:mga06r32_155536_c1
520 nmdc:mga06r32_179888_c1
521 nmdc:mga06r32_340538_c1
522 nmdc:mga06r32_593195_c1
523 nmdc:mga06r32_70401_c1
524 nmdc:mga08y16_1927885_c1
525 nmdc:mga08y16_26125_c1
526 nmdc:mga0n895_1362421_c1
527 nmdc:mga0rr50_394027_c1
528 nmdc:mga0a205_718638_c1
529 Ga0495601_0021927
530 Ga0495655_0088688
531 Ga0501084_0050066
532 Ga0501084_0264975
533 Ga0501084_0592925
534 Ga0501082_0058761
535 Ga0501082_0149032
536 Ga0501082_0267383
537 Ga0530510_0007365
538 Ga0530510_0830235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

7

90

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hd9-assembly1.cif.gz_A crystal structure of ph1033 from pyrococcus horikoshii ot3 0.8571 3 141
2p5d-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8536 1 139
2zbn-assembly1.cif.gz_A crystal structure of ph1033 from pyrococcus horikoshii ot3 0.8365 3 141
2hd9-assembly1.cif.gz_A crystal structure of ph1033 from pyrococcus horikoshii ot3 0.818 3 141
2p5d-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8146 1 139
ID Description Score Start End Superfamily
2p5dA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8536 1 139 3.10.590.10
2p5dA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8146 1 139 3.10.590.10
af_K7LMR0_63_217_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.7837 1 143 3.10.590.10
af_Q6L4U7_184_271_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.7807 6 91 3.10.590.10
af_Q650Y9_17_142_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.7674 4 140 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A6J4SB97-F1-model_v4 EVE domain-containing protein 0.9931 1 144
AF-A0A7V9MF30-F1-model_v4 EVE domain-containing protein 0.9869 2 144
AF-A0A6I2Y7L8-F1-model_v4 EVE domain-containing protein 0.9862 1 144
AF-A0A7J9YVA6-F1-model_v4 EVE domain-containing protein 0.9731 3 147
AF-A0A7C2ERS1-F1-model_v4 EVE domain-containing protein 0.9716 1 144

Map