F376161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 269 | 197 | 268 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10001793|Ga0105240_1000179323 |
| Length | 150 |
| Sequence | MTIMVIFYKCRHARGRMIDIGGFIMFKDSKAYSGFSVDNIEKAKNFYGEVLGLAVSEEHGMLDLHLATGGTVLVYPKENHEPATYTILNFPVDNIDAAADELISKGVSFEIYEGMHQDEKGIARGKAANMGPDIAWFKDPAGNILSILTE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 153 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 160 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 175 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 178 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 186 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 187 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 188 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 189 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 190 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 191 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 192 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 193 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 194 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 195 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 196 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 0.74 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.9 |
| Nodule | 0 |
| Rhizoplane | 4.46 |
| Rhizosphere | 82.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10008398 | 3300001991 | Bacteria | 1811 |
| 2 | JGI24735J21928_10072936 | 3300002067 | Bacteria | 983 |
| 3 | JGI25162J39368_1003264 | 3300002737 | Bacteria | 4940 |
| 4 | JGI25164J39214_1001531 | 3300002772 | Bacteria | 5113 |
| 5 | JGI25165J46597_1002917 | 3300003214 | Bacteria | 4816 |
| 6 | rootH2_10066540 | 3300003320 | Bacteria | 1941 |
| 7 | rootH1_10010186 | 3300003323 | Bacteria | 30481 |
| 8 | rootH1_10064102 | 3300003323 | Bacteria | 13160 |
| 9 | JGI25405J52794_10007249 | 3300003911 | Bacteria | 2042 |
| 10 | Ga0070658_10000133 | 3300005327 | Bacteria | 65613 |
| 11 | Ga0070658_10037511 | 3300005327 | Bacteria | 3907 |
| 12 | Ga0070676_10237858 | 3300005328 | Bacteria | 1210 |
| 13 | Ga0070670_100000561 | 3300005331 | Bacteria | 29475 |
| 14 | Ga0070670_100983723 | 3300005331 | Bacteria | 767 |
| 15 | Ga0070682_100008304 | 3300005337 | Bacteria | 5853 |
| 16 | Ga0070682_101387910 | 3300005337 | Bacteria | 600 |
| 17 | Ga0068868_100819944 | 3300005338 | Bacteria | 841 |
| 18 | Ga0070660_100002654 | 3300005339 | Bacteria | 12286 |
| 19 | Ga0070689_100038218 | 3300005340 | Bacteria | 3672 |
| 20 | Ga0070689_100214079 | 3300005340 | Bacteria | 1578 |
| 21 | Ga0070661_100030754 | 3300005344 | Bacteria | 3880 |
| 22 | Ga0070692_10009627 | 3300005345 | Bacteria | 4366 |
| 23 | Ga0070668_100354639 | 3300005347 | Bacteria | 1242 |
| 24 | Ga0070668_100453657 | 3300005347 | Bacteria | 1103 |
| 25 | Ga0070669_100003090 | 3300005353 | Bacteria | 11985 |
| 26 | Ga0070675_100013319 | 3300005354 | Bacteria | 6462 |
| 27 | Ga0070674_100054278 | 3300005356 | Bacteria | 2771 |
| 28 | Ga0070673_100163169 | 3300005364 | Bacteria | 1896 |
| 29 | Ga0070673_100171162 | 3300005364 | Bacteria | 1854 |
| 30 | Ga0070659_100000154 | 3300005366 | Bacteria | 52564 |
| 31 | Ga0070659_100012503 | 3300005366 | Bacteria | 6294 |
| 32 | Ga0070667_100046637 | 3300005367 | Bacteria | 3646 |
| 33 | Ga0070701_10087584 | 3300005438 | Bacteria | 1699 |
| 34 | Ga0070700_100315763 | 3300005441 | Bacteria | 1146 |
| 35 | Ga0070694_100139487 | 3300005444 | Bacteria | 1759 |
| 36 | Ga0070708_100236174 | 3300005445 | Bacteria | 1716 |
| 37 | Ga0070708_100990187 | 3300005445 | Bacteria | 788 |
| 38 | Ga0070708_102114825 | 3300005445 | Bacteria | 520 |
| 39 | Ga0070663_100038626 | 3300005455 | Bacteria | 3331 |
| 40 | Ga0070662_100031044 | 3300005457 | Bacteria | 3746 |
| 41 | Ga0070681_11163650 | 3300005458 | Bacteria | 693 |
| 42 | Ga0070685_10021541 | 3300005466 | Bacteria | 3504 |
| 43 | Ga0070685_10125866 | 3300005466 | Bacteria | 1596 |
| 44 | Ga0070706_100020489 | 3300005467 | Bacteria | 6094 |
| 45 | Ga0070706_101690325 | 3300005467 | Bacteria | 576 |
| 46 | Ga0070707_100005771 | 3300005468 | Archaea | 11544 |
| 47 | Ga0070707_102265756 | 3300005468 | Bacteria | 511 |
| 48 | Ga0070698_100253185 | 3300005471 | Unclassified | 1693 |
| 49 | Ga0070698_101191525 | 3300005471 | Bacteria | 711 |
| 50 | Ga0070699_100019573 | 3300005518 | Bacteria | 5832 |
| 51 | Ga0070699_100650776 | 3300005518 | Bacteria | 962 |
| 52 | Ga0070679_100067786 | 3300005530 | Bacteria | 3559 |
| 53 | Ga0070679_100874486 | 3300005530 | Unclassified | 842 |
| 54 | Ga0070684_100007158 | 3300005535 | Bacteria | 8669 |
| 55 | Ga0070684_100260828 | 3300005535 | Bacteria | 1585 |
| 56 | Ga0070684_100485562 | 3300005535 | Bacteria | 1144 |
| 57 | Ga0070684_101021385 | 3300005535 | Bacteria | 776 |
| 58 | Ga0070684_101805894 | 3300005535 | Bacteria | 577 |
| 59 | Ga0070697_100044178 | 3300005536 | Bacteria | 3608 |
| 60 | Ga0070697_100827091 | 3300005536 | Bacteria | 820 |
| 61 | Ga0070697_101108503 | 3300005536 | Bacteria | 704 |
| 62 | Ga0068853_100013645 | 3300005539 | Bacteria | 6639 |
| 63 | Ga0070672_100030751 | 3300005543 | Bacteria | 4037 |
| 64 | Ga0070686_100104363 | 3300005544 | Bacteria | 1920 |
| 65 | Ga0070695_100388029 | 3300005545 | Bacteria | 1055 |
| 66 | Ga0070696_100015186 | 3300005546 | Bacteria | 5169 |
| 67 | Ga0070696_100923496 | 3300005546 | Bacteria | 725 |
| 68 | Ga0070665_100200700 | 3300005548 | Bacteria | 1995 |
| 69 | Ga0070704_100092631 | 3300005549 | Bacteria | 2256 |
| 70 | Ga0068855_100001288 | 3300005563 | Bacteria | 31095 |
| 71 | Ga0070664_100013100 | 3300005564 | Bacteria | 6748 |
| 72 | Ga0068857_100084632 | 3300005577 | Unclassified | 2834 |
| 73 | Ga0068854_100022037 | 3300005578 | Bacteria | 4332 |
| 74 | Ga0068854_101038877 | 3300005578 | Bacteria | 727 |
| 75 | Ga0068856_100590227 | 3300005614 | Unclassified | 1132 |
| 76 | Ga0068856_102075325 | 3300005614 | Unclassified | 578 |
| 77 | Ga0070702_100143011 | 3300005615 | Bacteria | 1526 |
| 78 | Ga0068852_100037693 | 3300005616 | Unclassified | 4056 |
| 79 | Ga0068852_100509982 | 3300005616 | Bacteria | 1199 |
| 80 | Ga0068859_101324275 | 3300005617 | Bacteria | 794 |
| 81 | Ga0068864_100052331 | 3300005618 | Bacteria | 3519 |
| 82 | Ga0068861_100351359 | 3300005719 | Bacteria | 1293 |
| 83 | Ga0068858_100469740 | 3300005842 | Unclassified | 1213 |
| 84 | Ga0068858_101424543 | 3300005842 | Bacteria | 683 |
| 85 | Ga0068860_100097276 | 3300005843 | Bacteria | 2806 |
| 86 | Ga0081455_10007938 | 3300005937 | Bacteria | 11106 |
| 87 | Ga0081455_10483004 | 3300005937 | Bacteria | 837 |
| 88 | Ga0081539_10003435 | 3300005985 | Bacteria | 19473 |
| 89 | Ga0075365_10055598 | 3300006038 | Bacteria | 2628 |
| 90 | Ga0075365_10153378 | 3300006038 | Unclassified | 1603 |
| 91 | Ga0075365_10280207 | 3300006038 | Bacteria | 1173 |
| 92 | Ga0075364_10162367 | 3300006051 | Bacteria | 1508 |
| 93 | Ga0075367_10187605 | 3300006178 | Bacteria | 1290 |
| 94 | Ga0075366_10041806 | 3300006195 | Bacteria | 2714 |
| 95 | Ga0075430_100349991 | 3300006846 | Bacteria | 1220 |
| 96 | Ga0075433_10024772 | 3300006852 | Bacteria | 5068 |
| 97 | Ga0075434_100138285 | 3300006871 | Bacteria | 2455 |
| 98 | Ga0097620_101324120 | 3300006931 | Bacteria | 794 |
| 99 | Ga0075435_100143533 | 3300007076 | Bacteria | 2004 |
| 100 | Ga0099794_10077201 | 3300007265 | Bacteria | 1638 |
| 101 | Ga0099794_10264601 | 3300007265 | Unclassified | 888 |
| 102 | Ga0105240_10001793 | 3300009093 | Bacteria | 36153 |
| 103 | Ga0111539_10707909 | 3300009094 | Bacteria | 1172 |
| 104 | Ga0105245_10017038 | 3300009098 | Bacteria | 6343 |
| 105 | Ga0105245_10961495 | 3300009098 | Bacteria | 897 |
| 106 | Ga0105245_12156295 | 3300009098 | Bacteria | 611 |
| 107 | Ga0114129_10020817 | 3300009147 | Bacteria | 9317 |
| 108 | Ga0114129_10188103 | 3300009147 | Bacteria | 2805 |
| 109 | Ga0114129_11545931 | 3300009147 | Bacteria | 814 |
| 110 | Ga0105243_12554591 | 3300009148 | Bacteria | 550 |
| 111 | Ga0105243_12725532 | 3300009148 | Bacteria | 535 |
| 112 | Ga0105241_10047104 | 3300009174 | Bacteria | 3277 |
| 113 | Ga0105242_11981682 | 3300009176 | Bacteria | 624 |
| 114 | Ga0105242_13032812 | 3300009176 | Unclassified | 520 |
| 115 | Ga0105238_12329179 | 3300009551 | Bacteria | 571 |
| 116 | Ga0105249_10194992 | 3300009553 | Bacteria | 1979 |
| 117 | Ga0105249_10436821 | 3300009553 | Bacteria | 1345 |
| 118 | Ga0105239_10275216 | 3300010375 | Bacteria | 1894 |
| 119 | Ga0105239_11634151 | 3300010375 | Bacteria | 745 |
| 120 | Ga0105246_10492484 | 3300011119 | Bacteria | 1039 |
| 121 | Ga0157373_10008892 | 3300013100 | Bacteria | 7433 |
| 122 | Ga0157369_10000063 | 3300013105 | Bacteria | 147327 |
| 123 | Ga0157369_10573840 | 3300013105 | Bacteria | 1165 |
| 124 | Ga0157369_10940478 | 3300013105 | Bacteria | 886 |
| 125 | Ga0157374_10616003 | 3300013296 | Bacteria | 1096 |
| 126 | Ga0157374_11167915 | 3300013296 | Unclassified | 791 |
| 127 | Ga0157374_12028349 | 3300013296 | Bacteria | 602 |
| 128 | Ga0157378_10124198 | 3300013297 | Bacteria | 2383 |
| 129 | Ga0157378_10455970 | 3300013297 | Bacteria | 1270 |
| 130 | Ga0157378_11336497 | 3300013297 | Bacteria | 758 |
| 131 | Ga0157378_11338223 | 3300013297 | Bacteria | 758 |
| 132 | Ga0157378_11525906 | 3300013297 | Bacteria | 713 |
| 133 | Ga0163162_10164782 | 3300013306 | Bacteria | 2340 |
| 134 | Ga0157372_10098117 | 3300013307 | Bacteria | 3342 |
| 135 | Ga0157375_10264878 | 3300013308 | Bacteria | 1880 |
| 136 | Ga0163163_10436095 | 3300014325 | Bacteria | 1369 |
| 137 | Ga0157380_10228019 | 3300014326 | Bacteria | 1671 |
| 138 | Ga0182008_10228324 | 3300014497 | Bacteria | 954 |
| 139 | Ga0157377_10134515 | 3300014745 | Bacteria | 1513 |
| 140 | Ga0182007_10354646 | 3300015262 | Bacteria | 551 |
| 141 | Ga0163161_11373738 | 3300017792 | Bacteria | 616 |
| 142 | Ga0197907_11251192 | 3300020069 | Bacteria | 598 |
| 143 | Ga0206353_10105443 | 3300020082 | Bacteria | 1448 |
| 144 | Ga0209563_115748 | 3300025230 | Unclassified | 943 |
| 145 | Ga0207427_100076 | 3300025231 | Bacteria | 149885 |
| 146 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 147 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 148 | Ga0207656_10021466 | 3300025321 | Bacteria | 2581 |
| 149 | Ga0207688_10004778 | 3300025901 | Bacteria | 7382 |
| 150 | Ga0207645_10295523 | 3300025907 | Bacteria | 1078 |
| 151 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 152 | Ga0207705_11288761 | 3300025909 | Bacteria | 558 |
| 153 | Ga0207684_10000108 | 3300025910 | Bacteria | 156641 |
| 154 | Ga0207695_10002102 | 3300025913 | Bacteria | 30254 |
| 155 | Ga0207657_10002420 | 3300025919 | Bacteria | 20165 |
| 156 | Ga0207657_10385589 | 3300025919 | Bacteria | 1103 |
| 157 | Ga0207652_10320344 | 3300025921 | Bacteria | 1400 |
| 158 | Ga0207646_10000487 | 3300025922 | Bacteria | 53200 |
| 159 | Ga0207646_10008002 | 3300025922 | Archaea | 10658 |
| 160 | Ga0207646_11655597 | 3300025922 | Unclassified | 551 |
| 161 | Ga0207681_10008541 | 3300025923 | Bacteria | 6254 |
| 162 | Ga0207694_10799307 | 3300025924 | Bacteria | 797 |
| 163 | Ga0207650_10000484 | 3300025925 | Bacteria | 33197 |
| 164 | Ga0207650_10702619 | 3300025925 | Bacteria | 854 |
| 165 | Ga0207687_10129608 | 3300025927 | Bacteria | 1899 |
| 166 | Ga0207687_11873551 | 3300025927 | Bacteria | 513 |
| 167 | Ga0207690_10000518 | 3300025932 | Bacteria | 25073 |
| 168 | Ga0207690_10155949 | 3300025932 | Bacteria | 1697 |
| 169 | Ga0207706_10005581 | 3300025933 | Bacteria | 11723 |
| 170 | Ga0207670_10078504 | 3300025936 | Bacteria | 2302 |
| 171 | Ga0207670_10665671 | 3300025936 | Bacteria | 859 |
| 172 | Ga0207669_10122802 | 3300025937 | Bacteria | 1767 |
| 173 | Ga0207704_10105357 | 3300025938 | Bacteria | 1891 |
| 174 | Ga0207691_10015477 | 3300025940 | Bacteria | 7252 |
| 175 | Ga0207661_10032950 | 3300025944 | Bacteria | 4019 |
| 176 | Ga0207661_10260696 | 3300025944 | Unclassified | 1544 |
| 177 | Ga0207679_10035180 | 3300025945 | Bacteria | 3541 |
| 178 | Ga0207667_10170535 | 3300025949 | Unclassified | 2237 |
| 179 | Ga0207667_10445917 | 3300025949 | Bacteria | 1316 |
| 180 | Ga0207712_11982868 | 3300025961 | Bacteria | 521 |
| 181 | Ga0207668_10332571 | 3300025972 | Bacteria | 1264 |
| 182 | Ga0207668_11091304 | 3300025972 | Bacteria | 715 |
| 183 | Ga0207640_10052216 | 3300025981 | Bacteria | 2662 |
| 184 | Ga0207640_10809277 | 3300025981 | Bacteria | 812 |
| 185 | Ga0207658_10108712 | 3300025986 | Bacteria | 2188 |
| 186 | Ga0207677_10511688 | 3300026023 | Bacteria | 1040 |
| 187 | Ga0207703_10420138 | 3300026035 | Unclassified | 1244 |
| 188 | Ga0207639_10018612 | 3300026041 | Bacteria | 4939 |
| 189 | Ga0207678_10055243 | 3300026067 | Bacteria | 3420 |
| 190 | Ga0207708_10003445 | 3300026075 | Bacteria | 11656 |
| 191 | Ga0207702_10287368 | 3300026078 | Unclassified | 1557 |
| 192 | Ga0207641_10011830 | 3300026088 | Bacteria | 7161 |
| 193 | Ga0207676_10165453 | 3300026095 | Bacteria | 1921 |
| 194 | Ga0207674_10190521 | 3300026116 | Bacteria | 2000 |
| 195 | Ga0207675_100095691 | 3300026118 | Bacteria | 2795 |
| 196 | Ga0207698_10054426 | 3300026142 | Bacteria | 3079 |
| 197 | Ga0207698_10085974 | 3300026142 | Unclassified | 2556 |
| 198 | Ga0209588_1060941 | 3300027671 | Bacteria | 1219 |
| 199 | Ga0209998_10024045 | 3300027717 | Bacteria | 1320 |
| 200 | Ga0268264_10406516 | 3300028381 | Bacteria | 1309 |
| 201 | Ga0316182_1064039 | 3300030745 | Bacteria | 5802 |
| 202 | Ga0307513_10502355 | 3300031456 | Bacteria | 930 |
| 203 | Ga0307408_100230659 | 3300031548 | Bacteria | 1516 |
| 204 | Ga0307408_100699053 | 3300031548 | Bacteria | 911 |
| 205 | Ga0307408_100810956 | 3300031548 | Bacteria | 850 |
| 206 | Ga0307413_10109691 | 3300031824 | Bacteria | 1845 |
| 207 | Ga0307410_11242802 | 3300031852 | Bacteria | 650 |
| 208 | Ga0307406_10134505 | 3300031901 | Bacteria | 1740 |
| 209 | Ga0307409_100096642 | 3300031995 | Bacteria | 2438 |
| 210 | Ga0307416_100133199 | 3300032002 | Bacteria | 2242 |
| 211 | Ga0307414_11264733 | 3300032004 | Bacteria | 684 |
| 212 | Ga0307415_100231115 | 3300032126 | Bacteria | 1489 |
| 213 | Ga0307415_100796910 | 3300032126 | Bacteria | 862 |
| 214 | Ga0373930_0040907 | 3300034816 | Bacteria | 987 |
| 215 | Ga0373931_0081761 | 3300035691 | Unclassified | 1784 |
| 216 | Ga0395899_0825129 | 3300037312 | Bacteria | 571 |
| 217 | Ga0395900_0003457 | 3300037418 | Bacteria | 17070 |
| 218 | Ga0395900_0858152 | 3300037418 | Bacteria | 833 |
| 219 | Ga0395898_0044424 | 3300037466 | Bacteria | 4373 |
| 220 | Ga0395898_1143895 | 3300037466 | Bacteria | 711 |
| 221 | Ga0395898_1805796 | 3300037466 | Bacteria | 532 |
| 222 | Ga0395905_0003554 | 3300037471 | Bacteria | 16603 |
| 223 | Ga0395901_0114008 | 3300038443 | Bacteria | 2839 |
| 224 | Ga0451802_0310731 | 3300041460 | Bacteria | 1279 |
| 225 | Ga0450906_030661 | 3300042145 | Bacteria | 951 |
| 226 | Ga0466961_0195310 | 3300044693 | Bacteria | 1253 |
| 227 | Ga0495596_0104238 | 3300046500 | Bacteria | 1102 |
| 228 | Ga0495609_0271657 | 3300046538 | Bacteria | 695 |
| 229 | Ga0495658_0394202 | 3300046683 | Bacteria | 882 |
| 230 | Ga0496100_0424993 | 3300048903 | Bacteria | 1015 |
| 231 | Ga0496101_0082929 | 3300048904 | Bacteria | 2373 |
| 232 | Ga0496102_0975060 | 3300048905 | Bacteria | 768 |
| 233 | Ga0496107_0016039 | 3300048910 | Bacteria | 5257 |
| 234 | Ga0496107_0163008 | 3300048910 | Bacteria | 1653 |
| 235 | Ga0496109_0035981 | 3300048912 | Bacteria | 4469 |
| 236 | Ga0496110_1507819 | 3300048913 | Bacteria | 582 |
| 237 | Ga0496111_0536970 | 3300048914 | Bacteria | 859 |
| 238 | Ga0496111_0562170 | 3300048914 | Bacteria | 837 |
| 239 | Ga0496112_0003198 | 3300048915 | Bacteria | 13478 |
| 240 | Ga0496113_0072506 | 3300048916 | Bacteria | 2621 |
| 241 | nmdc:mga03n38_45494_c1 | 3300050490 | Bacteria | 1933 |
| 242 | nmdc:mga00v17_352689_c1 | 3300050491 | Bacteria | 956 |
| 243 | nmdc:mga0yw44_10219_c1 | 3300050492 | Bacteria | 4785 |
| 244 | nmdc:mga0yw44_134037_c1 | 3300050492 | Unclassified | 1605 |
| 245 | nmdc:mga0yw44_251057_c1 | 3300050492 | Bacteria | 1177 |
| 246 | nmdc:mga0k408_8542_c1 | 3300050493 | Bacteria | 2731 |
| 247 | nmdc:mga06z11_654071_c1 | 3300050494 | Bacteria | 640 |
| 248 | nmdc:mga05p37_132284_c1 | 3300050507 | Bacteria | 3061 |
| 249 | nmdc:mga05p37_19741_c1 | 3300050507 | Bacteria | 8153 |
| 250 | nmdc:mga0qj67_308741_c1 | 3300050509 | Bacteria | 1281 |
| 251 | nmdc:mga06r32_367416_c1 | 3300050510 | Bacteria | 1422 |
| 252 | nmdc:mga0n895_50838_c1 | 3300050512 | Bacteria | 4065 |
| 253 | nmdc:mga08x19_166579_c1 | 3300050514 | Bacteria | 1499 |
| 254 | nmdc:mga0a205_19707_c1 | 3300050515 | Bacteria | 3719 |
| 255 | Ga0500643_000022 | 3300053087 | Bacteria | 277519 |
| 256 | Ga0500646_0001410 | 3300053090 | Bacteria | 6378 |
| 257 | Ga0500583_0017696 | 3300053092 | Bacteria | 2879 |
| 258 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 259 | Ga0500562_000009 | 3300053108 | Bacteria | 187538 |
| 260 | Ga0500562_001747 | 3300053108 | Bacteria | 5419 |
| 261 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 262 | Ga0500655_000233 | 3300053133 | Bacteria | 13340 |
| 263 | Ga0500577_0003350 | 3300053142 | Bacteria | 4157 |
| 264 | Ga0500579_000849 | 3300053143 | Bacteria | 17560 |
| 265 | Ga0500620_238013 | 3300053155 | Bacteria | 609 |
| 266 | Ga0500633_0011613 | 3300053160 | Bacteria | 2402 |
| 267 | Ga0501084_1293844 | 3300054114 | Bacteria | 611 |
| 268 | Ga0590075_040187 | 3300059424 | Bacteria | 1194 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_102075325 | Ga0068856_1020753252 | 116 |
| 2 | iso_pu_bacteria | 2852646457 | 2852648492 | 119 |
| 3 | 3300005719 | Ga0068861_100351359 | Ga0068861_1003513592 | 121 |
| 4 | 3300005937 | Ga0081455_10483004 | Ga0081455_104830042 | 121 |
| 5 | 3300006038 | Ga0075365_10153378 | Ga0075365_101533781 | 121 |
| 6 | 3300009148 | Ga0105243_12554591 | Ga0105243_125545912 | 121 |
| 7 | 3300026118 | Ga0207675_100095691 | Ga0207675_1000956913 | 121 |
| 8 | 3300027717 | Ga0209998_10024045 | Ga0209998_100240452 | 121 |
| 9 | 3300031456 | Ga0307513_10502355 | Ga0307513_105023552 | 121 |
| 10 | 3300046500 | Ga0495596_0104238 | Ga0495596_0104238_554_973 | 121 |
| 11 | 3300050492 | nmdc:mga0yw44_134037_c1 | nmdc:mga0yw44_134037_c1_1081_1458 | 121 |
| 12 | 3300003911 | JGI25405J52794_10007249 | JGI25405J52794_100072492 | 122 |
| 13 | 3300005327 | Ga0070658_10000133 | Ga0070658_1000013348 | 122 |
| 14 | 3300005347 | Ga0070668_100354639 | Ga0070668_1003546392 | 122 |
| 15 | 3300005530 | Ga0070679_100874486 | Ga0070679_1008744861 | 122 |
| 16 | 3300005563 | Ga0068855_100001288 | Ga0068855_1000012884 | 122 |
| 17 | 3300005578 | Ga0068854_101038877 | Ga0068854_1010388771 | 122 |
| 18 | 3300005614 | Ga0068856_100590227 | Ga0068856_1005902271 | 122 |
| 19 | 3300005616 | Ga0068852_100037693 | Ga0068852_1000376934 | 122 |
| 20 | 3300005937 | Ga0081455_10007938 | Ga0081455_100079387 | 122 |
| 21 | 3300009093 | Ga0105240_10001793 | Ga0105240_1000179323 | 122 |
| 22 | 3300009174 | Ga0105241_10047104 | Ga0105241_100471041 | 122 |
| 23 | 3300013105 | Ga0157369_10000063 | Ga0157369_1000006368 | 122 |
| 24 | 3300013296 | Ga0157374_10616003 | Ga0157374_106160032 | 122 |
| 25 | 3300013296 | Ga0157374_11167915 | Ga0157374_111679151 | 122 |
| 26 | 3300013297 | Ga0157378_11336497 | Ga0157378_113364971 | 122 |
| 27 | 3300013297 | Ga0157378_11525906 | Ga0157378_115259062 | 122 |
| 28 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011387 | 122 |
| 29 | 3300025913 | Ga0207695_10002102 | Ga0207695_1000210227 | 122 |
| 30 | 3300025949 | Ga0207667_10170535 | Ga0207667_101705353 | 122 |
| 31 | 3300025949 | Ga0207667_10445917 | Ga0207667_104459172 | 122 |
| 32 | 3300025972 | Ga0207668_10332571 | Ga0207668_103325712 | 122 |
| 33 | 3300025981 | Ga0207640_10809277 | Ga0207640_108092772 | 122 |
| 34 | 3300026078 | Ga0207702_10287368 | Ga0207702_102873683 | 122 |
| 35 | 3300026142 | Ga0207698_10085974 | Ga0207698_100859743 | 122 |
| 36 | 3300031824 | Ga0307413_10109691 | Ga0307413_101096914 | 122 |
| 37 | 3300037418 | Ga0395900_0003457 | Ga0395900_0003457_6343_6723 | 122 |
| 38 | 3300037466 | Ga0395898_0044424 | Ga0395898_0044424_3656_4036 | 122 |
| 39 | 3300037471 | Ga0395905_0003554 | Ga0395905_0003554_48_428 | 122 |
| 40 | 3300053090 | Ga0500646_0001410 | Ga0500646_0001410_2694_3074 | 122 |
| 41 | 3300053092 | Ga0500583_0017696 | Ga0500583_0017696_419_799 | 122 |
| 42 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_117126_117506 | 122 |
| 43 | 3300053108 | Ga0500562_000009 | Ga0500562_000009_111676_112059 | 122 |
| 44 | 3300053108 | Ga0500562_001747 | Ga0500562_001747_669_1049 | 122 |
| 45 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_781924_782304 | 122 |
| 46 | 3300053133 | Ga0500655_000233 | Ga0500655_000233_11365_11745 | 122 |
| 47 | 3300053142 | Ga0500577_0003350 | Ga0500577_0003350_1251_1631 | 122 |
| 48 | 3300053143 | Ga0500579_000849 | Ga0500579_000849_13018_13398 | 122 |
| 49 | 3300053160 | Ga0500633_0011613 | Ga0500633_0011613_437_817 | 122 |
| 50 | 3300005445 | Ga0070708_100236174 | Ga0070708_1002361743 | 123 |
| 51 | 3300005466 | Ga0070685_10125866 | Ga0070685_101258663 | 123 |
| 52 | 3300005471 | Ga0070698_101191525 | Ga0070698_1011915252 | 123 |
| 53 | 3300005518 | Ga0070699_100650776 | Ga0070699_1006507762 | 123 |
| 54 | 3300005535 | Ga0070684_100260828 | Ga0070684_1002608282 | 123 |
| 55 | 3300005546 | Ga0070696_100923496 | Ga0070696_1009234962 | 123 |
| 56 | 3300005577 | Ga0068857_100084632 | Ga0068857_1000846322 | 123 |
| 57 | 3300005842 | Ga0068858_100469740 | Ga0068858_1004697402 | 123 |
| 58 | 3300005985 | Ga0081539_10003435 | Ga0081539_100034358 | 123 |
| 59 | 3300013105 | Ga0157369_10573840 | Ga0157369_105738402 | 123 |
| 60 | 3300014497 | Ga0182008_10228324 | Ga0182008_102283243 | 123 |
| 61 | 3300020069 | Ga0197907_11251192 | Ga0197907_112511921 | 123 |
| 62 | 3300020082 | Ga0206353_10105443 | Ga0206353_101054432 | 123 |
| 63 | 3300025944 | Ga0207661_10260696 | Ga0207661_102606962 | 123 |
| 64 | 3300026035 | Ga0207703_10420138 | Ga0207703_104201382 | 123 |
| 65 | 3300030745 | Ga0316182_1064039 | Ga0316182_10640394 | 123 |
| 66 | 3300032126 | Ga0307415_100796910 | Ga0307415_1007969102 | 123 |
| 67 | 3300037312 | Ga0395899_0825129 | Ga0395899_0825129_150_536 | 123 |
| 68 | 3300037418 | Ga0395900_0858152 | Ga0395900_0858152_299_685 | 123 |
| 69 | 3300037466 | Ga0395898_1143895 | Ga0395898_1143895_302_688 | 123 |
| 70 | 3300038443 | Ga0395901_0114008 | Ga0395901_0114008_2162_2548 | 123 |
| 71 | 3300041460 | Ga0451802_0310731 | Ga0451802_0310731_834_1211 | 123 |
| 72 | 3300044693 | Ga0466961_0195310 | Ga0466961_0195310_795_1181 | 123 |
| 73 | 3300048910 | Ga0496107_0163008 | Ga0496107_0163008_436_807 | 123 |
| 74 | 3300048913 | Ga0496110_1507819 | Ga0496110_1507819_88_459 | 123 |
| 75 | 3300048914 | Ga0496111_0562170 | Ga0496111_0562170_448_819 | 123 |
| 76 | 3300048915 | Ga0496112_0003198 | Ga0496112_0003198_5452_5823 | 123 |
| 77 | 3300053087 | Ga0500643_000022 | Ga0500643_000022_71375_71758 | 123 |
| 78 | 3300054114 | Ga0501084_1293844 | Ga0501084_1293844_185_556 | 123 |
| 79 | 3300059424 | Ga0590075_040187 | Ga0590075_040187_476_853 | 123 |
| 80 | 3300005339 | Ga0070660_100002654 | Ga0070660_1000026546 | 124 |
| 81 | 3300005366 | Ga0070659_100000154 | Ga0070659_10000015412 | 124 |
| 82 | 3300005445 | Ga0070708_100990187 | Ga0070708_1009901872 | 124 |
| 83 | 3300005445 | Ga0070708_102114825 | Ga0070708_1021148251 | 124 |
| 84 | 3300005467 | Ga0070706_100020489 | Ga0070706_1000204896 | 124 |
| 85 | 3300005467 | Ga0070706_101690325 | Ga0070706_1016903251 | 124 |
| 86 | 3300005468 | Ga0070707_100005771 | Ga0070707_10000577111 | 124 |
| 87 | 3300005468 | Ga0070707_102265756 | Ga0070707_1022657562 | 124 |
| 88 | 3300005471 | Ga0070698_100253185 | Ga0070698_1002531852 | 124 |
| 89 | 3300005518 | Ga0070699_100019573 | Ga0070699_1000195733 | 124 |
| 90 | 3300005536 | Ga0070697_100044178 | Ga0070697_1000441782 | 124 |
| 91 | 3300005536 | Ga0070697_100827091 | Ga0070697_1008270912 | 124 |
| 92 | 3300005536 | Ga0070697_101108503 | Ga0070697_1011085032 | 124 |
| 93 | 3300006852 | Ga0075433_10024772 | Ga0075433_100247725 | 124 |
| 94 | 3300006871 | Ga0075434_100138285 | Ga0075434_1001382855 | 124 |
| 95 | 3300007076 | Ga0075435_100143533 | Ga0075435_1001435332 | 124 |
| 96 | 3300007265 | Ga0099794_10077201 | Ga0099794_100772012 | 124 |
| 97 | 3300007265 | Ga0099794_10264601 | Ga0099794_102646012 | 124 |
| 98 | 3300009147 | Ga0114129_10020817 | Ga0114129_100208178 | 124 |
| 99 | 3300009147 | Ga0114129_10188103 | Ga0114129_101881034 | 124 |
| 100 | 3300013297 | Ga0157378_10455970 | Ga0157378_104559703 | 124 |
| 101 | 3300025910 | Ga0207684_10000108 | Ga0207684_1000010821 | 124 |
| 102 | 3300025919 | Ga0207657_10385589 | Ga0207657_103855892 | 124 |
| 103 | 3300025922 | Ga0207646_10000487 | Ga0207646_1000048726 | 124 |
| 104 | 3300025922 | Ga0207646_10008002 | Ga0207646_100080029 | 124 |
| 105 | 3300025932 | Ga0207690_10000518 | Ga0207690_1000051817 | 124 |
| 106 | 3300026116 | Ga0207674_10190521 | Ga0207674_101905212 | 124 |
| 107 | 3300027671 | Ga0209588_1060941 | Ga0209588_10609413 | 124 |
| 108 | 3300032002 | Ga0307416_100133199 | Ga0307416_1001331993 | 124 |
| 109 | 3300032126 | Ga0307415_100231115 | Ga0307415_1002311152 | 124 |
| 110 | 3300037466 | Ga0395898_1805796 | Ga0395898_1805796_28_402 | 124 |
| 111 | 3300050507 | nmdc:mga05p37_132284_c1 | nmdc:mga05p37_132284_c1_1510_1884 | 124 |
| 112 | 3300050507 | nmdc:mga05p37_19741_c1 | nmdc:mga05p37_19741_c1_2569_2946 | 124 |
| 113 | 3300050512 | nmdc:mga0n895_50838_c1 | nmdc:mga0n895_50838_c1_1007_1381 | 124 |
| 114 | 3300050514 | nmdc:mga08x19_166579_c1 | nmdc:mga08x19_166579_c1_1002_1376 | 124 |
| 115 | 3300050515 | nmdc:mga0a205_19707_c1 | nmdc:mga0a205_19707_c1_2464_2838 | 124 |
| 116 | 3300005545 | Ga0070695_100388029 | Ga0070695_1003880292 | 125 |
| 117 | 3300005617 | Ga0068859_101324275 | Ga0068859_1013242752 | 125 |
| 118 | 3300006931 | Ga0097620_101324120 | Ga0097620_1013241202 | 125 |
| 119 | 3300009094 | Ga0111539_10707909 | Ga0111539_107079092 | 125 |
| 120 | 3300009148 | Ga0105243_12725532 | Ga0105243_127255321 | 125 |
| 121 | 3300009553 | Ga0105249_10194992 | Ga0105249_101949923 | 125 |
| 122 | 3300013105 | Ga0157369_10940478 | Ga0157369_109404783 | 125 |
| 123 | 3300013297 | Ga0157378_11338223 | Ga0157378_113382232 | 125 |
| 124 | 3300013306 | Ga0163162_10164782 | Ga0163162_101647823 | 125 |
| 125 | 3300015262 | Ga0182007_10354646 | Ga0182007_103546461 | 125 |
| 126 | 3300025922 | Ga0207646_11655597 | Ga0207646_116555972 | 125 |
| 127 | 3300025961 | Ga0207712_11982868 | Ga0207712_119828682 | 125 |
| 128 | 3300034816 | Ga0373930_0040907 | Ga0373930_0040907_509_901 | 125 |
| 129 | 3300035691 | Ga0373931_0081761 | Ga0373931_0081761_194_586 | 125 |
| 130 | 3300046538 | Ga0495609_0271657 | Ga0495609_0271657_216_596 | 125 |
| 131 | 3300046683 | Ga0495658_0394202 | Ga0495658_0394202_268_648 | 125 |
| 132 | 3300053155 | Ga0500620_238013 | Ga0500620_238013_114_491 | 125 |
| 133 | 3300002737 | JGI25162J39368_1003264 | JGI25162J39368_10032644 | 126 |
| 134 | 3300002772 | JGI25164J39214_1001531 | JGI25164J39214_10015314 | 126 |
| 135 | 3300003214 | JGI25165J46597_1002917 | JGI25165J46597_10029176 | 126 |
| 136 | 3300003320 | rootH2_10066540 | rootH2_100665403 | 126 |
| 137 | 3300003323 | rootH1_10010186 | rootH1_100101862 | 126 |
| 138 | 3300003323 | rootH1_10064102 | rootH1_100641029 | 126 |
| 139 | 3300005331 | Ga0070670_100000561 | Ga0070670_10000056119 | 126 |
| 140 | 3300005337 | Ga0070682_101387910 | Ga0070682_1013879102 | 126 |
| 141 | 3300005340 | Ga0070689_100038218 | Ga0070689_1000382182 | 126 |
| 142 | 3300005353 | Ga0070669_100003090 | Ga0070669_1000030902 | 126 |
| 143 | 3300005364 | Ga0070673_100171162 | Ga0070673_1001711621 | 126 |
| 144 | 3300005535 | Ga0070684_101021385 | Ga0070684_1010213851 | 126 |
| 145 | 3300005535 | Ga0070684_101805894 | Ga0070684_1018058941 | 126 |
| 146 | 3300005546 | Ga0070696_100015186 | Ga0070696_1000151862 | 126 |
| 147 | 3300006195 | Ga0075366_10041806 | Ga0075366_100418061 | 126 |
| 148 | 3300006846 | Ga0075430_100349991 | Ga0075430_1003499913 | 126 |
| 149 | 3300009098 | Ga0105245_10961495 | Ga0105245_109614952 | 126 |
| 150 | 3300009098 | Ga0105245_12156295 | Ga0105245_121562951 | 126 |
| 151 | 3300009147 | Ga0114129_11545931 | Ga0114129_115459312 | 126 |
| 152 | 3300009176 | Ga0105242_13032812 | Ga0105242_130328121 | 126 |
| 153 | 3300010375 | Ga0105239_11634151 | Ga0105239_116341512 | 126 |
| 154 | 3300013100 | Ga0157373_10008892 | Ga0157373_100088925 | 126 |
| 155 | 3300013297 | Ga0157378_10124198 | Ga0157378_101241983 | 126 |
| 156 | 3300025230 | Ga0209563_115748 | Ga0209563_1157482 | 126 |
| 157 | 3300025231 | Ga0207427_100076 | Ga0207427_10007695 | 126 |
| 158 | 3300025233 | Ga0209437_100008 | Ga0209437_10000852 | 126 |
| 159 | 3300025261 | Ga0209233_1000024 | Ga0209233_1000024607 | 126 |
| 160 | 3300025923 | Ga0207681_10008541 | Ga0207681_100085412 | 126 |
| 161 | 3300025925 | Ga0207650_10000484 | Ga0207650_100004847 | 126 |
| 162 | 3300025927 | Ga0207687_11873551 | Ga0207687_118735511 | 126 |
| 163 | 3300025936 | Ga0207670_10078504 | Ga0207670_100785043 | 126 |
| 164 | 3300026088 | Ga0207641_10011830 | Ga0207641_100118302 | 126 |
| 165 | 3300031548 | Ga0307408_100230659 | Ga0307408_1002306591 | 126 |
| 166 | 3300031548 | Ga0307408_100699053 | Ga0307408_1006990532 | 126 |
| 167 | 3300031548 | Ga0307408_100810956 | Ga0307408_1008109562 | 126 |
| 168 | 3300031852 | Ga0307410_11242802 | Ga0307410_112428021 | 126 |
| 169 | 3300031901 | Ga0307406_10134505 | Ga0307406_101345052 | 126 |
| 170 | 3300031995 | Ga0307409_100096642 | Ga0307409_1000966423 | 126 |
| 171 | 3300032004 | Ga0307414_11264733 | Ga0307414_112647332 | 126 |
| 172 | 3300042145 | Ga0450906_030661 | Ga0450906_030661_38_418 | 126 |
| 173 | 3300050491 | nmdc:mga00v17_352689_c1 | nmdc:mga00v17_352689_c1_142_531 | 126 |
| 174 | 3300050493 | nmdc:mga0k408_8542_c1 | nmdc:mga0k408_8542_c1_56_448 | 126 |
| 175 | 3300050509 | nmdc:mga0qj67_308741_c1 | nmdc:mga0qj67_308741_c1_759_1139 | 126 |
| 176 | 3300050510 | nmdc:mga06r32_367416_c1 | nmdc:mga06r32_367416_c1_934_1320 | 126 |
| 177 | 3300001991 | JGI24743J22301_10008398 | JGI24743J22301_100083982 | 127 |
| 178 | 3300002067 | JGI24735J21928_10072936 | JGI24735J21928_100729362 | 127 |
| 179 | 3300005327 | Ga0070658_10037511 | Ga0070658_100375112 | 127 |
| 180 | 3300005328 | Ga0070676_10237858 | Ga0070676_102378582 | 127 |
| 181 | 3300005331 | Ga0070670_100983723 | Ga0070670_1009837231 | 127 |
| 182 | 3300005337 | Ga0070682_100008304 | Ga0070682_1000083042 | 127 |
| 183 | 3300005338 | Ga0068868_100819944 | Ga0068868_1008199441 | 127 |
| 184 | 3300005340 | Ga0070689_100214079 | Ga0070689_1002140792 | 127 |
| 185 | 3300005344 | Ga0070661_100030754 | Ga0070661_1000307542 | 127 |
| 186 | 3300005345 | Ga0070692_10009627 | Ga0070692_100096272 | 127 |
| 187 | 3300005347 | Ga0070668_100453657 | Ga0070668_1004536572 | 127 |
| 188 | 3300005354 | Ga0070675_100013319 | Ga0070675_1000133192 | 127 |
| 189 | 3300005356 | Ga0070674_100054278 | Ga0070674_1000542781 | 127 |
| 190 | 3300005364 | Ga0070673_100163169 | Ga0070673_1001631692 | 127 |
| 191 | 3300005366 | Ga0070659_100012503 | Ga0070659_1000125032 | 127 |
| 192 | 3300005367 | Ga0070667_100046637 | Ga0070667_1000466372 | 127 |
| 193 | 3300005438 | Ga0070701_10087584 | Ga0070701_100875842 | 127 |
| 194 | 3300005441 | Ga0070700_100315763 | Ga0070700_1003157632 | 127 |
| 195 | 3300005444 | Ga0070694_100139487 | Ga0070694_1001394872 | 127 |
| 196 | 3300005455 | Ga0070663_100038626 | Ga0070663_1000386262 | 127 |
| 197 | 3300005457 | Ga0070662_100031044 | Ga0070662_1000310442 | 127 |
| 198 | 3300005458 | Ga0070681_11163650 | Ga0070681_111636502 | 127 |
| 199 | 3300005466 | Ga0070685_10021541 | Ga0070685_100215412 | 127 |
| 200 | 3300005530 | Ga0070679_100067786 | Ga0070679_1000677862 | 127 |
| 201 | 3300005535 | Ga0070684_100007158 | Ga0070684_1000071583 | 127 |
| 202 | 3300005535 | Ga0070684_100485562 | Ga0070684_1004855622 | 127 |
| 203 | 3300005539 | Ga0068853_100013645 | Ga0068853_1000136453 | 127 |
| 204 | 3300005543 | Ga0070672_100030751 | Ga0070672_1000307514 | 127 |
| 205 | 3300005544 | Ga0070686_100104363 | Ga0070686_1001043633 | 127 |
| 206 | 3300005548 | Ga0070665_100200700 | Ga0070665_1002007002 | 127 |
| 207 | 3300005549 | Ga0070704_100092631 | Ga0070704_1000926313 | 127 |
| 208 | 3300005564 | Ga0070664_100013100 | Ga0070664_1000131005 | 127 |
| 209 | 3300005578 | Ga0068854_100022037 | Ga0068854_1000220373 | 127 |
| 210 | 3300005615 | Ga0070702_100143011 | Ga0070702_1001430112 | 127 |
| 211 | 3300005616 | Ga0068852_100509982 | Ga0068852_1005099822 | 127 |
| 212 | 3300005618 | Ga0068864_100052331 | Ga0068864_1000523312 | 127 |
| 213 | 3300005842 | Ga0068858_101424543 | Ga0068858_1014245432 | 127 |
| 214 | 3300005843 | Ga0068860_100097276 | Ga0068860_1000972762 | 127 |
| 215 | 3300006038 | Ga0075365_10055598 | Ga0075365_100555982 | 127 |
| 216 | 3300006038 | Ga0075365_10280207 | Ga0075365_102802072 | 127 |
| 217 | 3300006051 | Ga0075364_10162367 | Ga0075364_101623672 | 127 |
| 218 | 3300006178 | Ga0075367_10187605 | Ga0075367_101876052 | 127 |
| 219 | 3300009098 | Ga0105245_10017038 | Ga0105245_100170382 | 127 |
| 220 | 3300009176 | Ga0105242_11981682 | Ga0105242_119816822 | 127 |
| 221 | 3300009551 | Ga0105238_12329179 | Ga0105238_123291791 | 127 |
| 222 | 3300009553 | Ga0105249_10436821 | Ga0105249_104368212 | 127 |
| 223 | 3300010375 | Ga0105239_10275216 | Ga0105239_102752162 | 127 |
| 224 | 3300011119 | Ga0105246_10492484 | Ga0105246_104924842 | 127 |
| 225 | 3300013296 | Ga0157374_12028349 | Ga0157374_120283492 | 127 |
| 226 | 3300013307 | Ga0157372_10098117 | Ga0157372_100981172 | 127 |
| 227 | 3300013308 | Ga0157375_10264878 | Ga0157375_102648782 | 127 |
| 228 | 3300014325 | Ga0163163_10436095 | Ga0163163_104360952 | 127 |
| 229 | 3300014326 | Ga0157380_10228019 | Ga0157380_102280192 | 127 |
| 230 | 3300014745 | Ga0157377_10134515 | Ga0157377_101345152 | 127 |
| 231 | 3300017792 | Ga0163161_11373738 | Ga0163161_113737381 | 127 |
| 232 | 3300025321 | Ga0207656_10021466 | Ga0207656_100214662 | 127 |
| 233 | 3300025901 | Ga0207688_10004778 | Ga0207688_100047783 | 127 |
| 234 | 3300025907 | Ga0207645_10295523 | Ga0207645_102955232 | 127 |
| 235 | 3300025909 | Ga0207705_11288761 | Ga0207705_112887611 | 127 |
| 236 | 3300025919 | Ga0207657_10002420 | Ga0207657_100024203 | 127 |
| 237 | 3300025921 | Ga0207652_10320344 | Ga0207652_103203442 | 127 |
| 238 | 3300025924 | Ga0207694_10799307 | Ga0207694_107993071 | 127 |
| 239 | 3300025925 | Ga0207650_10702619 | Ga0207650_107026192 | 127 |
| 240 | 3300025927 | Ga0207687_10129608 | Ga0207687_101296081 | 127 |
| 241 | 3300025932 | Ga0207690_10155949 | Ga0207690_101559493 | 127 |
| 242 | 3300025933 | Ga0207706_10005581 | Ga0207706_100055813 | 127 |
| 243 | 3300025936 | Ga0207670_10665671 | Ga0207670_106656712 | 127 |
| 244 | 3300025937 | Ga0207669_10122802 | Ga0207669_101228022 | 127 |
| 245 | 3300025938 | Ga0207704_10105357 | Ga0207704_101053572 | 127 |
| 246 | 3300025940 | Ga0207691_10015477 | Ga0207691_100154777 | 127 |
| 247 | 3300025944 | Ga0207661_10032950 | Ga0207661_100329502 | 127 |
| 248 | 3300025945 | Ga0207679_10035180 | Ga0207679_100351802 | 127 |
| 249 | 3300025972 | Ga0207668_11091304 | Ga0207668_110913042 | 127 |
| 250 | 3300025981 | Ga0207640_10052216 | Ga0207640_100522162 | 127 |
| 251 | 3300025986 | Ga0207658_10108712 | Ga0207658_101087122 | 127 |
| 252 | 3300026023 | Ga0207677_10511688 | Ga0207677_105116882 | 127 |
| 253 | 3300026041 | Ga0207639_10018612 | Ga0207639_100186125 | 127 |
| 254 | 3300026067 | Ga0207678_10055243 | Ga0207678_100552433 | 127 |
| 255 | 3300026075 | Ga0207708_10003445 | Ga0207708_1000344510 | 127 |
| 256 | 3300026095 | Ga0207676_10165453 | Ga0207676_101654532 | 127 |
| 257 | 3300026142 | Ga0207698_10054426 | Ga0207698_100544262 | 127 |
| 258 | 3300028381 | Ga0268264_10406516 | Ga0268264_104065162 | 127 |
| 259 | 3300048903 | Ga0496100_0424993 | Ga0496100_0424993_426_833 | 127 |
| 260 | 3300048904 | Ga0496101_0082929 | Ga0496101_0082929_1510_1917 | 127 |
| 261 | 3300048905 | Ga0496102_0975060 | Ga0496102_0975060_61_468 | 127 |
| 262 | 3300048910 | Ga0496107_0016039 | Ga0496107_0016039_1203_1610 | 127 |
| 263 | 3300048912 | Ga0496109_0035981 | Ga0496109_0035981_1020_1427 | 127 |
| 264 | 3300048914 | Ga0496111_0536970 | Ga0496111_0536970_197_604 | 127 |
| 265 | 3300048916 | Ga0496113_0072506 | Ga0496113_0072506_2224_2607 | 127 |
| 266 | 3300050490 | nmdc:mga03n38_45494_c1 | nmdc:mga03n38_45494_c1_358_765 | 127 |
| 267 | 3300050492 | nmdc:mga0yw44_10219_c1 | nmdc:mga0yw44_10219_c1_1487_1894 | 127 |
| 268 | 3300050492 | nmdc:mga0yw44_251057_c1 | nmdc:mga0yw44_251057_c1_497_886 | 127 |
| 269 | 3300050494 | nmdc:mga06z11_654071_c1 | nmdc:mga06z11_654071_c1_178_585 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.7746 | 6 | 127 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.7701 | 3 | 126 |
| 4nb2-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.7682 | 1 | 127 |
| 2p7m-assembly4.cif.gz_A | crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 | 0.7673 | 2 | 124 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.764 | 3 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYM3_1_61_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7768 | 10 | 61 | 3.10.180.10 |
| af_O06412_6_120_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7713 | 9 | 127 | 3.10.180.10 |
| 2qqzB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7709 | 9 | 127 | 3.10.180.10 |
| 4pavD00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7674 | 6 | 126 | 3.10.180.10 |
| 3bt3B02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.762 | 64 | 127 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1D3C4-F1-model_v4 | VOC family protein | 0.9809 | 4 | 127 |
|
| AF-A0A2N7T1R3-F1-model_v4 | deleted | 0.9728 | 6 | 126 |
|
| AF-A0A4R7EJ75-F1-model_v4 | deleted | 0.9721 | 7 | 127 |
|
| AF-A0A1E5MHP9-F1-model_v4 | Glyoxalase | 0.9713 | 1 | 126 |
|
| AF-A0A2W1W6Q0-F1-model_v4 | deleted | 0.9712 | 1 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar