F376161

General Info

Members Datasets Scaffolds Average Seq Length
269 197 268 128

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001793|Ga0105240_1000179323
Length 150
Sequence MTIMVIFYKCRHARGRMIDIGGFIMFKDSKAYSGFSVDNIEKAKNFYGEVLGLAVSEEHGMLDLHLATGGTVLVYPKENHEPATYTILNFPVDNIDAAADELISKGVSFEIYEGMHQDEKGIARGKAANMGPDIAWFKDPAGNILSILTE

Samples

Sample ID Description Type Environment
1 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
191 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
192 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
193 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
194 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
195 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.74
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0
Rhizoplane 4.46
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10008398 3300001991 Bacteria 1811
2 JGI24735J21928_10072936 3300002067 Bacteria 983
3 JGI25162J39368_1003264 3300002737 Bacteria 4940
4 JGI25164J39214_1001531 3300002772 Bacteria 5113
5 JGI25165J46597_1002917 3300003214 Bacteria 4816
6 rootH2_10066540 3300003320 Bacteria 1941
7 rootH1_10010186 3300003323 Bacteria 30481
8 rootH1_10064102 3300003323 Bacteria 13160
9 JGI25405J52794_10007249 3300003911 Bacteria 2042
10 Ga0070658_10000133 3300005327 Bacteria 65613
11 Ga0070658_10037511 3300005327 Bacteria 3907
12 Ga0070676_10237858 3300005328 Bacteria 1210
13 Ga0070670_100000561 3300005331 Bacteria 29475
14 Ga0070670_100983723 3300005331 Bacteria 767
15 Ga0070682_100008304 3300005337 Bacteria 5853
16 Ga0070682_101387910 3300005337 Bacteria 600
17 Ga0068868_100819944 3300005338 Bacteria 841
18 Ga0070660_100002654 3300005339 Bacteria 12286
19 Ga0070689_100038218 3300005340 Bacteria 3672
20 Ga0070689_100214079 3300005340 Bacteria 1578
21 Ga0070661_100030754 3300005344 Bacteria 3880
22 Ga0070692_10009627 3300005345 Bacteria 4366
23 Ga0070668_100354639 3300005347 Bacteria 1242
24 Ga0070668_100453657 3300005347 Bacteria 1103
25 Ga0070669_100003090 3300005353 Bacteria 11985
26 Ga0070675_100013319 3300005354 Bacteria 6462
27 Ga0070674_100054278 3300005356 Bacteria 2771
28 Ga0070673_100163169 3300005364 Bacteria 1896
29 Ga0070673_100171162 3300005364 Bacteria 1854
30 Ga0070659_100000154 3300005366 Bacteria 52564
31 Ga0070659_100012503 3300005366 Bacteria 6294
32 Ga0070667_100046637 3300005367 Bacteria 3646
33 Ga0070701_10087584 3300005438 Bacteria 1699
34 Ga0070700_100315763 3300005441 Bacteria 1146
35 Ga0070694_100139487 3300005444 Bacteria 1759
36 Ga0070708_100236174 3300005445 Bacteria 1716
37 Ga0070708_100990187 3300005445 Bacteria 788
38 Ga0070708_102114825 3300005445 Bacteria 520
39 Ga0070663_100038626 3300005455 Bacteria 3331
40 Ga0070662_100031044 3300005457 Bacteria 3746
41 Ga0070681_11163650 3300005458 Bacteria 693
42 Ga0070685_10021541 3300005466 Bacteria 3504
43 Ga0070685_10125866 3300005466 Bacteria 1596
44 Ga0070706_100020489 3300005467 Bacteria 6094
45 Ga0070706_101690325 3300005467 Bacteria 576
46 Ga0070707_100005771 3300005468 Archaea 11544
47 Ga0070707_102265756 3300005468 Bacteria 511
48 Ga0070698_100253185 3300005471 Unclassified 1693
49 Ga0070698_101191525 3300005471 Bacteria 711
50 Ga0070699_100019573 3300005518 Bacteria 5832
51 Ga0070699_100650776 3300005518 Bacteria 962
52 Ga0070679_100067786 3300005530 Bacteria 3559
53 Ga0070679_100874486 3300005530 Unclassified 842
54 Ga0070684_100007158 3300005535 Bacteria 8669
55 Ga0070684_100260828 3300005535 Bacteria 1585
56 Ga0070684_100485562 3300005535 Bacteria 1144
57 Ga0070684_101021385 3300005535 Bacteria 776
58 Ga0070684_101805894 3300005535 Bacteria 577
59 Ga0070697_100044178 3300005536 Bacteria 3608
60 Ga0070697_100827091 3300005536 Bacteria 820
61 Ga0070697_101108503 3300005536 Bacteria 704
62 Ga0068853_100013645 3300005539 Bacteria 6639
63 Ga0070672_100030751 3300005543 Bacteria 4037
64 Ga0070686_100104363 3300005544 Bacteria 1920
65 Ga0070695_100388029 3300005545 Bacteria 1055
66 Ga0070696_100015186 3300005546 Bacteria 5169
67 Ga0070696_100923496 3300005546 Bacteria 725
68 Ga0070665_100200700 3300005548 Bacteria 1995
69 Ga0070704_100092631 3300005549 Bacteria 2256
70 Ga0068855_100001288 3300005563 Bacteria 31095
71 Ga0070664_100013100 3300005564 Bacteria 6748
72 Ga0068857_100084632 3300005577 Unclassified 2834
73 Ga0068854_100022037 3300005578 Bacteria 4332
74 Ga0068854_101038877 3300005578 Bacteria 727
75 Ga0068856_100590227 3300005614 Unclassified 1132
76 Ga0068856_102075325 3300005614 Unclassified 578
77 Ga0070702_100143011 3300005615 Bacteria 1526
78 Ga0068852_100037693 3300005616 Unclassified 4056
79 Ga0068852_100509982 3300005616 Bacteria 1199
80 Ga0068859_101324275 3300005617 Bacteria 794
81 Ga0068864_100052331 3300005618 Bacteria 3519
82 Ga0068861_100351359 3300005719 Bacteria 1293
83 Ga0068858_100469740 3300005842 Unclassified 1213
84 Ga0068858_101424543 3300005842 Bacteria 683
85 Ga0068860_100097276 3300005843 Bacteria 2806
86 Ga0081455_10007938 3300005937 Bacteria 11106
87 Ga0081455_10483004 3300005937 Bacteria 837
88 Ga0081539_10003435 3300005985 Bacteria 19473
89 Ga0075365_10055598 3300006038 Bacteria 2628
90 Ga0075365_10153378 3300006038 Unclassified 1603
91 Ga0075365_10280207 3300006038 Bacteria 1173
92 Ga0075364_10162367 3300006051 Bacteria 1508
93 Ga0075367_10187605 3300006178 Bacteria 1290
94 Ga0075366_10041806 3300006195 Bacteria 2714
95 Ga0075430_100349991 3300006846 Bacteria 1220
96 Ga0075433_10024772 3300006852 Bacteria 5068
97 Ga0075434_100138285 3300006871 Bacteria 2455
98 Ga0097620_101324120 3300006931 Bacteria 794
99 Ga0075435_100143533 3300007076 Bacteria 2004
100 Ga0099794_10077201 3300007265 Bacteria 1638
101 Ga0099794_10264601 3300007265 Unclassified 888
102 Ga0105240_10001793 3300009093 Bacteria 36153
103 Ga0111539_10707909 3300009094 Bacteria 1172
104 Ga0105245_10017038 3300009098 Bacteria 6343
105 Ga0105245_10961495 3300009098 Bacteria 897
106 Ga0105245_12156295 3300009098 Bacteria 611
107 Ga0114129_10020817 3300009147 Bacteria 9317
108 Ga0114129_10188103 3300009147 Bacteria 2805
109 Ga0114129_11545931 3300009147 Bacteria 814
110 Ga0105243_12554591 3300009148 Bacteria 550
111 Ga0105243_12725532 3300009148 Bacteria 535
112 Ga0105241_10047104 3300009174 Bacteria 3277
113 Ga0105242_11981682 3300009176 Bacteria 624
114 Ga0105242_13032812 3300009176 Unclassified 520
115 Ga0105238_12329179 3300009551 Bacteria 571
116 Ga0105249_10194992 3300009553 Bacteria 1979
117 Ga0105249_10436821 3300009553 Bacteria 1345
118 Ga0105239_10275216 3300010375 Bacteria 1894
119 Ga0105239_11634151 3300010375 Bacteria 745
120 Ga0105246_10492484 3300011119 Bacteria 1039
121 Ga0157373_10008892 3300013100 Bacteria 7433
122 Ga0157369_10000063 3300013105 Bacteria 147327
123 Ga0157369_10573840 3300013105 Bacteria 1165
124 Ga0157369_10940478 3300013105 Bacteria 886
125 Ga0157374_10616003 3300013296 Bacteria 1096
126 Ga0157374_11167915 3300013296 Unclassified 791
127 Ga0157374_12028349 3300013296 Bacteria 602
128 Ga0157378_10124198 3300013297 Bacteria 2383
129 Ga0157378_10455970 3300013297 Bacteria 1270
130 Ga0157378_11336497 3300013297 Bacteria 758
131 Ga0157378_11338223 3300013297 Bacteria 758
132 Ga0157378_11525906 3300013297 Bacteria 713
133 Ga0163162_10164782 3300013306 Bacteria 2340
134 Ga0157372_10098117 3300013307 Bacteria 3342
135 Ga0157375_10264878 3300013308 Bacteria 1880
136 Ga0163163_10436095 3300014325 Bacteria 1369
137 Ga0157380_10228019 3300014326 Bacteria 1671
138 Ga0182008_10228324 3300014497 Bacteria 954
139 Ga0157377_10134515 3300014745 Bacteria 1513
140 Ga0182007_10354646 3300015262 Bacteria 551
141 Ga0163161_11373738 3300017792 Bacteria 616
142 Ga0197907_11251192 3300020069 Bacteria 598
143 Ga0206353_10105443 3300020082 Bacteria 1448
144 Ga0209563_115748 3300025230 Unclassified 943
145 Ga0207427_100076 3300025231 Bacteria 149885
146 Ga0209437_100008 3300025233 Bacteria 921142
147 Ga0209233_1000024 3300025261 Bacteria 695418
148 Ga0207656_10021466 3300025321 Bacteria 2581
149 Ga0207688_10004778 3300025901 Bacteria 7382
150 Ga0207645_10295523 3300025907 Bacteria 1078
151 Ga0207705_10000011 3300025909 Bacteria 517768
152 Ga0207705_11288761 3300025909 Bacteria 558
153 Ga0207684_10000108 3300025910 Bacteria 156641
154 Ga0207695_10002102 3300025913 Bacteria 30254
155 Ga0207657_10002420 3300025919 Bacteria 20165
156 Ga0207657_10385589 3300025919 Bacteria 1103
157 Ga0207652_10320344 3300025921 Bacteria 1400
158 Ga0207646_10000487 3300025922 Bacteria 53200
159 Ga0207646_10008002 3300025922 Archaea 10658
160 Ga0207646_11655597 3300025922 Unclassified 551
161 Ga0207681_10008541 3300025923 Bacteria 6254
162 Ga0207694_10799307 3300025924 Bacteria 797
163 Ga0207650_10000484 3300025925 Bacteria 33197
164 Ga0207650_10702619 3300025925 Bacteria 854
165 Ga0207687_10129608 3300025927 Bacteria 1899
166 Ga0207687_11873551 3300025927 Bacteria 513
167 Ga0207690_10000518 3300025932 Bacteria 25073
168 Ga0207690_10155949 3300025932 Bacteria 1697
169 Ga0207706_10005581 3300025933 Bacteria 11723
170 Ga0207670_10078504 3300025936 Bacteria 2302
171 Ga0207670_10665671 3300025936 Bacteria 859
172 Ga0207669_10122802 3300025937 Bacteria 1767
173 Ga0207704_10105357 3300025938 Bacteria 1891
174 Ga0207691_10015477 3300025940 Bacteria 7252
175 Ga0207661_10032950 3300025944 Bacteria 4019
176 Ga0207661_10260696 3300025944 Unclassified 1544
177 Ga0207679_10035180 3300025945 Bacteria 3541
178 Ga0207667_10170535 3300025949 Unclassified 2237
179 Ga0207667_10445917 3300025949 Bacteria 1316
180 Ga0207712_11982868 3300025961 Bacteria 521
181 Ga0207668_10332571 3300025972 Bacteria 1264
182 Ga0207668_11091304 3300025972 Bacteria 715
183 Ga0207640_10052216 3300025981 Bacteria 2662
184 Ga0207640_10809277 3300025981 Bacteria 812
185 Ga0207658_10108712 3300025986 Bacteria 2188
186 Ga0207677_10511688 3300026023 Bacteria 1040
187 Ga0207703_10420138 3300026035 Unclassified 1244
188 Ga0207639_10018612 3300026041 Bacteria 4939
189 Ga0207678_10055243 3300026067 Bacteria 3420
190 Ga0207708_10003445 3300026075 Bacteria 11656
191 Ga0207702_10287368 3300026078 Unclassified 1557
192 Ga0207641_10011830 3300026088 Bacteria 7161
193 Ga0207676_10165453 3300026095 Bacteria 1921
194 Ga0207674_10190521 3300026116 Bacteria 2000
195 Ga0207675_100095691 3300026118 Bacteria 2795
196 Ga0207698_10054426 3300026142 Bacteria 3079
197 Ga0207698_10085974 3300026142 Unclassified 2556
198 Ga0209588_1060941 3300027671 Bacteria 1219
199 Ga0209998_10024045 3300027717 Bacteria 1320
200 Ga0268264_10406516 3300028381 Bacteria 1309
201 Ga0316182_1064039 3300030745 Bacteria 5802
202 Ga0307513_10502355 3300031456 Bacteria 930
203 Ga0307408_100230659 3300031548 Bacteria 1516
204 Ga0307408_100699053 3300031548 Bacteria 911
205 Ga0307408_100810956 3300031548 Bacteria 850
206 Ga0307413_10109691 3300031824 Bacteria 1845
207 Ga0307410_11242802 3300031852 Bacteria 650
208 Ga0307406_10134505 3300031901 Bacteria 1740
209 Ga0307409_100096642 3300031995 Bacteria 2438
210 Ga0307416_100133199 3300032002 Bacteria 2242
211 Ga0307414_11264733 3300032004 Bacteria 684
212 Ga0307415_100231115 3300032126 Bacteria 1489
213 Ga0307415_100796910 3300032126 Bacteria 862
214 Ga0373930_0040907 3300034816 Bacteria 987
215 Ga0373931_0081761 3300035691 Unclassified 1784
216 Ga0395899_0825129 3300037312 Bacteria 571
217 Ga0395900_0003457 3300037418 Bacteria 17070
218 Ga0395900_0858152 3300037418 Bacteria 833
219 Ga0395898_0044424 3300037466 Bacteria 4373
220 Ga0395898_1143895 3300037466 Bacteria 711
221 Ga0395898_1805796 3300037466 Bacteria 532
222 Ga0395905_0003554 3300037471 Bacteria 16603
223 Ga0395901_0114008 3300038443 Bacteria 2839
224 Ga0451802_0310731 3300041460 Bacteria 1279
225 Ga0450906_030661 3300042145 Bacteria 951
226 Ga0466961_0195310 3300044693 Bacteria 1253
227 Ga0495596_0104238 3300046500 Bacteria 1102
228 Ga0495609_0271657 3300046538 Bacteria 695
229 Ga0495658_0394202 3300046683 Bacteria 882
230 Ga0496100_0424993 3300048903 Bacteria 1015
231 Ga0496101_0082929 3300048904 Bacteria 2373
232 Ga0496102_0975060 3300048905 Bacteria 768
233 Ga0496107_0016039 3300048910 Bacteria 5257
234 Ga0496107_0163008 3300048910 Bacteria 1653
235 Ga0496109_0035981 3300048912 Bacteria 4469
236 Ga0496110_1507819 3300048913 Bacteria 582
237 Ga0496111_0536970 3300048914 Bacteria 859
238 Ga0496111_0562170 3300048914 Bacteria 837
239 Ga0496112_0003198 3300048915 Bacteria 13478
240 Ga0496113_0072506 3300048916 Bacteria 2621
241 nmdc:mga03n38_45494_c1 3300050490 Bacteria 1933
242 nmdc:mga00v17_352689_c1 3300050491 Bacteria 956
243 nmdc:mga0yw44_10219_c1 3300050492 Bacteria 4785
244 nmdc:mga0yw44_134037_c1 3300050492 Unclassified 1605
245 nmdc:mga0yw44_251057_c1 3300050492 Bacteria 1177
246 nmdc:mga0k408_8542_c1 3300050493 Bacteria 2731
247 nmdc:mga06z11_654071_c1 3300050494 Bacteria 640
248 nmdc:mga05p37_132284_c1 3300050507 Bacteria 3061
249 nmdc:mga05p37_19741_c1 3300050507 Bacteria 8153
250 nmdc:mga0qj67_308741_c1 3300050509 Bacteria 1281
251 nmdc:mga06r32_367416_c1 3300050510 Bacteria 1422
252 nmdc:mga0n895_50838_c1 3300050512 Bacteria 4065
253 nmdc:mga08x19_166579_c1 3300050514 Bacteria 1499
254 nmdc:mga0a205_19707_c1 3300050515 Bacteria 3719
255 Ga0500643_000022 3300053087 Bacteria 277519
256 Ga0500646_0001410 3300053090 Bacteria 6378
257 Ga0500583_0017696 3300053092 Bacteria 2879
258 Ga0500650_0000001 3300053098 Bacteria 818797
259 Ga0500562_000009 3300053108 Bacteria 187538
260 Ga0500562_001747 3300053108 Bacteria 5419
261 Ga0500594_0000001 3300053118 Bacteria 1178472
262 Ga0500655_000233 3300053133 Bacteria 13340
263 Ga0500577_0003350 3300053142 Bacteria 4157
264 Ga0500579_000849 3300053143 Bacteria 17560
265 Ga0500620_238013 3300053155 Bacteria 609
266 Ga0500633_0011613 3300053160 Bacteria 2402
267 Ga0501084_1293844 3300054114 Bacteria 611
268 Ga0590075_040187 3300059424 Bacteria 1194

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_102075325 Ga0068856_1020753252 116
2 iso_pu_bacteria 2852646457 2852648492 119
3 3300005719 Ga0068861_100351359 Ga0068861_1003513592 121
4 3300005937 Ga0081455_10483004 Ga0081455_104830042 121
5 3300006038 Ga0075365_10153378 Ga0075365_101533781 121
6 3300009148 Ga0105243_12554591 Ga0105243_125545912 121
7 3300026118 Ga0207675_100095691 Ga0207675_1000956913 121
8 3300027717 Ga0209998_10024045 Ga0209998_100240452 121
9 3300031456 Ga0307513_10502355 Ga0307513_105023552 121
10 3300046500 Ga0495596_0104238 Ga0495596_0104238_554_973 121
11 3300050492 nmdc:mga0yw44_134037_c1 nmdc:mga0yw44_134037_c1_1081_1458 121
12 3300003911 JGI25405J52794_10007249 JGI25405J52794_100072492 122
13 3300005327 Ga0070658_10000133 Ga0070658_1000013348 122
14 3300005347 Ga0070668_100354639 Ga0070668_1003546392 122
15 3300005530 Ga0070679_100874486 Ga0070679_1008744861 122
16 3300005563 Ga0068855_100001288 Ga0068855_1000012884 122
17 3300005578 Ga0068854_101038877 Ga0068854_1010388771 122
18 3300005614 Ga0068856_100590227 Ga0068856_1005902271 122
19 3300005616 Ga0068852_100037693 Ga0068852_1000376934 122
20 3300005937 Ga0081455_10007938 Ga0081455_100079387 122
21 3300009093 Ga0105240_10001793 Ga0105240_1000179323 122
22 3300009174 Ga0105241_10047104 Ga0105241_100471041 122
23 3300013105 Ga0157369_10000063 Ga0157369_1000006368 122
24 3300013296 Ga0157374_10616003 Ga0157374_106160032 122
25 3300013296 Ga0157374_11167915 Ga0157374_111679151 122
26 3300013297 Ga0157378_11336497 Ga0157378_113364971 122
27 3300013297 Ga0157378_11525906 Ga0157378_115259062 122
28 3300025909 Ga0207705_10000011 Ga0207705_10000011387 122
29 3300025913 Ga0207695_10002102 Ga0207695_1000210227 122
30 3300025949 Ga0207667_10170535 Ga0207667_101705353 122
31 3300025949 Ga0207667_10445917 Ga0207667_104459172 122
32 3300025972 Ga0207668_10332571 Ga0207668_103325712 122
33 3300025981 Ga0207640_10809277 Ga0207640_108092772 122
34 3300026078 Ga0207702_10287368 Ga0207702_102873683 122
35 3300026142 Ga0207698_10085974 Ga0207698_100859743 122
36 3300031824 Ga0307413_10109691 Ga0307413_101096914 122
37 3300037418 Ga0395900_0003457 Ga0395900_0003457_6343_6723 122
38 3300037466 Ga0395898_0044424 Ga0395898_0044424_3656_4036 122
39 3300037471 Ga0395905_0003554 Ga0395905_0003554_48_428 122
40 3300053090 Ga0500646_0001410 Ga0500646_0001410_2694_3074 122
41 3300053092 Ga0500583_0017696 Ga0500583_0017696_419_799 122
42 3300053098 Ga0500650_0000001 Ga0500650_0000001_117126_117506 122
43 3300053108 Ga0500562_000009 Ga0500562_000009_111676_112059 122
44 3300053108 Ga0500562_001747 Ga0500562_001747_669_1049 122
45 3300053118 Ga0500594_0000001 Ga0500594_0000001_781924_782304 122
46 3300053133 Ga0500655_000233 Ga0500655_000233_11365_11745 122
47 3300053142 Ga0500577_0003350 Ga0500577_0003350_1251_1631 122
48 3300053143 Ga0500579_000849 Ga0500579_000849_13018_13398 122
49 3300053160 Ga0500633_0011613 Ga0500633_0011613_437_817 122
50 3300005445 Ga0070708_100236174 Ga0070708_1002361743 123
51 3300005466 Ga0070685_10125866 Ga0070685_101258663 123
52 3300005471 Ga0070698_101191525 Ga0070698_1011915252 123
53 3300005518 Ga0070699_100650776 Ga0070699_1006507762 123
54 3300005535 Ga0070684_100260828 Ga0070684_1002608282 123
55 3300005546 Ga0070696_100923496 Ga0070696_1009234962 123
56 3300005577 Ga0068857_100084632 Ga0068857_1000846322 123
57 3300005842 Ga0068858_100469740 Ga0068858_1004697402 123
58 3300005985 Ga0081539_10003435 Ga0081539_100034358 123
59 3300013105 Ga0157369_10573840 Ga0157369_105738402 123
60 3300014497 Ga0182008_10228324 Ga0182008_102283243 123
61 3300020069 Ga0197907_11251192 Ga0197907_112511921 123
62 3300020082 Ga0206353_10105443 Ga0206353_101054432 123
63 3300025944 Ga0207661_10260696 Ga0207661_102606962 123
64 3300026035 Ga0207703_10420138 Ga0207703_104201382 123
65 3300030745 Ga0316182_1064039 Ga0316182_10640394 123
66 3300032126 Ga0307415_100796910 Ga0307415_1007969102 123
67 3300037312 Ga0395899_0825129 Ga0395899_0825129_150_536 123
68 3300037418 Ga0395900_0858152 Ga0395900_0858152_299_685 123
69 3300037466 Ga0395898_1143895 Ga0395898_1143895_302_688 123
70 3300038443 Ga0395901_0114008 Ga0395901_0114008_2162_2548 123
71 3300041460 Ga0451802_0310731 Ga0451802_0310731_834_1211 123
72 3300044693 Ga0466961_0195310 Ga0466961_0195310_795_1181 123
73 3300048910 Ga0496107_0163008 Ga0496107_0163008_436_807 123
74 3300048913 Ga0496110_1507819 Ga0496110_1507819_88_459 123
75 3300048914 Ga0496111_0562170 Ga0496111_0562170_448_819 123
76 3300048915 Ga0496112_0003198 Ga0496112_0003198_5452_5823 123
77 3300053087 Ga0500643_000022 Ga0500643_000022_71375_71758 123
78 3300054114 Ga0501084_1293844 Ga0501084_1293844_185_556 123
79 3300059424 Ga0590075_040187 Ga0590075_040187_476_853 123
80 3300005339 Ga0070660_100002654 Ga0070660_1000026546 124
81 3300005366 Ga0070659_100000154 Ga0070659_10000015412 124
82 3300005445 Ga0070708_100990187 Ga0070708_1009901872 124
83 3300005445 Ga0070708_102114825 Ga0070708_1021148251 124
84 3300005467 Ga0070706_100020489 Ga0070706_1000204896 124
85 3300005467 Ga0070706_101690325 Ga0070706_1016903251 124
86 3300005468 Ga0070707_100005771 Ga0070707_10000577111 124
87 3300005468 Ga0070707_102265756 Ga0070707_1022657562 124
88 3300005471 Ga0070698_100253185 Ga0070698_1002531852 124
89 3300005518 Ga0070699_100019573 Ga0070699_1000195733 124
90 3300005536 Ga0070697_100044178 Ga0070697_1000441782 124
91 3300005536 Ga0070697_100827091 Ga0070697_1008270912 124
92 3300005536 Ga0070697_101108503 Ga0070697_1011085032 124
93 3300006852 Ga0075433_10024772 Ga0075433_100247725 124
94 3300006871 Ga0075434_100138285 Ga0075434_1001382855 124
95 3300007076 Ga0075435_100143533 Ga0075435_1001435332 124
96 3300007265 Ga0099794_10077201 Ga0099794_100772012 124
97 3300007265 Ga0099794_10264601 Ga0099794_102646012 124
98 3300009147 Ga0114129_10020817 Ga0114129_100208178 124
99 3300009147 Ga0114129_10188103 Ga0114129_101881034 124
100 3300013297 Ga0157378_10455970 Ga0157378_104559703 124
101 3300025910 Ga0207684_10000108 Ga0207684_1000010821 124
102 3300025919 Ga0207657_10385589 Ga0207657_103855892 124
103 3300025922 Ga0207646_10000487 Ga0207646_1000048726 124
104 3300025922 Ga0207646_10008002 Ga0207646_100080029 124
105 3300025932 Ga0207690_10000518 Ga0207690_1000051817 124
106 3300026116 Ga0207674_10190521 Ga0207674_101905212 124
107 3300027671 Ga0209588_1060941 Ga0209588_10609413 124
108 3300032002 Ga0307416_100133199 Ga0307416_1001331993 124
109 3300032126 Ga0307415_100231115 Ga0307415_1002311152 124
110 3300037466 Ga0395898_1805796 Ga0395898_1805796_28_402 124
111 3300050507 nmdc:mga05p37_132284_c1 nmdc:mga05p37_132284_c1_1510_1884 124
112 3300050507 nmdc:mga05p37_19741_c1 nmdc:mga05p37_19741_c1_2569_2946 124
113 3300050512 nmdc:mga0n895_50838_c1 nmdc:mga0n895_50838_c1_1007_1381 124
114 3300050514 nmdc:mga08x19_166579_c1 nmdc:mga08x19_166579_c1_1002_1376 124
115 3300050515 nmdc:mga0a205_19707_c1 nmdc:mga0a205_19707_c1_2464_2838 124
116 3300005545 Ga0070695_100388029 Ga0070695_1003880292 125
117 3300005617 Ga0068859_101324275 Ga0068859_1013242752 125
118 3300006931 Ga0097620_101324120 Ga0097620_1013241202 125
119 3300009094 Ga0111539_10707909 Ga0111539_107079092 125
120 3300009148 Ga0105243_12725532 Ga0105243_127255321 125
121 3300009553 Ga0105249_10194992 Ga0105249_101949923 125
122 3300013105 Ga0157369_10940478 Ga0157369_109404783 125
123 3300013297 Ga0157378_11338223 Ga0157378_113382232 125
124 3300013306 Ga0163162_10164782 Ga0163162_101647823 125
125 3300015262 Ga0182007_10354646 Ga0182007_103546461 125
126 3300025922 Ga0207646_11655597 Ga0207646_116555972 125
127 3300025961 Ga0207712_11982868 Ga0207712_119828682 125
128 3300034816 Ga0373930_0040907 Ga0373930_0040907_509_901 125
129 3300035691 Ga0373931_0081761 Ga0373931_0081761_194_586 125
130 3300046538 Ga0495609_0271657 Ga0495609_0271657_216_596 125
131 3300046683 Ga0495658_0394202 Ga0495658_0394202_268_648 125
132 3300053155 Ga0500620_238013 Ga0500620_238013_114_491 125
133 3300002737 JGI25162J39368_1003264 JGI25162J39368_10032644 126
134 3300002772 JGI25164J39214_1001531 JGI25164J39214_10015314 126
135 3300003214 JGI25165J46597_1002917 JGI25165J46597_10029176 126
136 3300003320 rootH2_10066540 rootH2_100665403 126
137 3300003323 rootH1_10010186 rootH1_100101862 126
138 3300003323 rootH1_10064102 rootH1_100641029 126
139 3300005331 Ga0070670_100000561 Ga0070670_10000056119 126
140 3300005337 Ga0070682_101387910 Ga0070682_1013879102 126
141 3300005340 Ga0070689_100038218 Ga0070689_1000382182 126
142 3300005353 Ga0070669_100003090 Ga0070669_1000030902 126
143 3300005364 Ga0070673_100171162 Ga0070673_1001711621 126
144 3300005535 Ga0070684_101021385 Ga0070684_1010213851 126
145 3300005535 Ga0070684_101805894 Ga0070684_1018058941 126
146 3300005546 Ga0070696_100015186 Ga0070696_1000151862 126
147 3300006195 Ga0075366_10041806 Ga0075366_100418061 126
148 3300006846 Ga0075430_100349991 Ga0075430_1003499913 126
149 3300009098 Ga0105245_10961495 Ga0105245_109614952 126
150 3300009098 Ga0105245_12156295 Ga0105245_121562951 126
151 3300009147 Ga0114129_11545931 Ga0114129_115459312 126
152 3300009176 Ga0105242_13032812 Ga0105242_130328121 126
153 3300010375 Ga0105239_11634151 Ga0105239_116341512 126
154 3300013100 Ga0157373_10008892 Ga0157373_100088925 126
155 3300013297 Ga0157378_10124198 Ga0157378_101241983 126
156 3300025230 Ga0209563_115748 Ga0209563_1157482 126
157 3300025231 Ga0207427_100076 Ga0207427_10007695 126
158 3300025233 Ga0209437_100008 Ga0209437_10000852 126
159 3300025261 Ga0209233_1000024 Ga0209233_1000024607 126
160 3300025923 Ga0207681_10008541 Ga0207681_100085412 126
161 3300025925 Ga0207650_10000484 Ga0207650_100004847 126
162 3300025927 Ga0207687_11873551 Ga0207687_118735511 126
163 3300025936 Ga0207670_10078504 Ga0207670_100785043 126
164 3300026088 Ga0207641_10011830 Ga0207641_100118302 126
165 3300031548 Ga0307408_100230659 Ga0307408_1002306591 126
166 3300031548 Ga0307408_100699053 Ga0307408_1006990532 126
167 3300031548 Ga0307408_100810956 Ga0307408_1008109562 126
168 3300031852 Ga0307410_11242802 Ga0307410_112428021 126
169 3300031901 Ga0307406_10134505 Ga0307406_101345052 126
170 3300031995 Ga0307409_100096642 Ga0307409_1000966423 126
171 3300032004 Ga0307414_11264733 Ga0307414_112647332 126
172 3300042145 Ga0450906_030661 Ga0450906_030661_38_418 126
173 3300050491 nmdc:mga00v17_352689_c1 nmdc:mga00v17_352689_c1_142_531 126
174 3300050493 nmdc:mga0k408_8542_c1 nmdc:mga0k408_8542_c1_56_448 126
175 3300050509 nmdc:mga0qj67_308741_c1 nmdc:mga0qj67_308741_c1_759_1139 126
176 3300050510 nmdc:mga06r32_367416_c1 nmdc:mga06r32_367416_c1_934_1320 126
177 3300001991 JGI24743J22301_10008398 JGI24743J22301_100083982 127
178 3300002067 JGI24735J21928_10072936 JGI24735J21928_100729362 127
179 3300005327 Ga0070658_10037511 Ga0070658_100375112 127
180 3300005328 Ga0070676_10237858 Ga0070676_102378582 127
181 3300005331 Ga0070670_100983723 Ga0070670_1009837231 127
182 3300005337 Ga0070682_100008304 Ga0070682_1000083042 127
183 3300005338 Ga0068868_100819944 Ga0068868_1008199441 127
184 3300005340 Ga0070689_100214079 Ga0070689_1002140792 127
185 3300005344 Ga0070661_100030754 Ga0070661_1000307542 127
186 3300005345 Ga0070692_10009627 Ga0070692_100096272 127
187 3300005347 Ga0070668_100453657 Ga0070668_1004536572 127
188 3300005354 Ga0070675_100013319 Ga0070675_1000133192 127
189 3300005356 Ga0070674_100054278 Ga0070674_1000542781 127
190 3300005364 Ga0070673_100163169 Ga0070673_1001631692 127
191 3300005366 Ga0070659_100012503 Ga0070659_1000125032 127
192 3300005367 Ga0070667_100046637 Ga0070667_1000466372 127
193 3300005438 Ga0070701_10087584 Ga0070701_100875842 127
194 3300005441 Ga0070700_100315763 Ga0070700_1003157632 127
195 3300005444 Ga0070694_100139487 Ga0070694_1001394872 127
196 3300005455 Ga0070663_100038626 Ga0070663_1000386262 127
197 3300005457 Ga0070662_100031044 Ga0070662_1000310442 127
198 3300005458 Ga0070681_11163650 Ga0070681_111636502 127
199 3300005466 Ga0070685_10021541 Ga0070685_100215412 127
200 3300005530 Ga0070679_100067786 Ga0070679_1000677862 127
201 3300005535 Ga0070684_100007158 Ga0070684_1000071583 127
202 3300005535 Ga0070684_100485562 Ga0070684_1004855622 127
203 3300005539 Ga0068853_100013645 Ga0068853_1000136453 127
204 3300005543 Ga0070672_100030751 Ga0070672_1000307514 127
205 3300005544 Ga0070686_100104363 Ga0070686_1001043633 127
206 3300005548 Ga0070665_100200700 Ga0070665_1002007002 127
207 3300005549 Ga0070704_100092631 Ga0070704_1000926313 127
208 3300005564 Ga0070664_100013100 Ga0070664_1000131005 127
209 3300005578 Ga0068854_100022037 Ga0068854_1000220373 127
210 3300005615 Ga0070702_100143011 Ga0070702_1001430112 127
211 3300005616 Ga0068852_100509982 Ga0068852_1005099822 127
212 3300005618 Ga0068864_100052331 Ga0068864_1000523312 127
213 3300005842 Ga0068858_101424543 Ga0068858_1014245432 127
214 3300005843 Ga0068860_100097276 Ga0068860_1000972762 127
215 3300006038 Ga0075365_10055598 Ga0075365_100555982 127
216 3300006038 Ga0075365_10280207 Ga0075365_102802072 127
217 3300006051 Ga0075364_10162367 Ga0075364_101623672 127
218 3300006178 Ga0075367_10187605 Ga0075367_101876052 127
219 3300009098 Ga0105245_10017038 Ga0105245_100170382 127
220 3300009176 Ga0105242_11981682 Ga0105242_119816822 127
221 3300009551 Ga0105238_12329179 Ga0105238_123291791 127
222 3300009553 Ga0105249_10436821 Ga0105249_104368212 127
223 3300010375 Ga0105239_10275216 Ga0105239_102752162 127
224 3300011119 Ga0105246_10492484 Ga0105246_104924842 127
225 3300013296 Ga0157374_12028349 Ga0157374_120283492 127
226 3300013307 Ga0157372_10098117 Ga0157372_100981172 127
227 3300013308 Ga0157375_10264878 Ga0157375_102648782 127
228 3300014325 Ga0163163_10436095 Ga0163163_104360952 127
229 3300014326 Ga0157380_10228019 Ga0157380_102280192 127
230 3300014745 Ga0157377_10134515 Ga0157377_101345152 127
231 3300017792 Ga0163161_11373738 Ga0163161_113737381 127
232 3300025321 Ga0207656_10021466 Ga0207656_100214662 127
233 3300025901 Ga0207688_10004778 Ga0207688_100047783 127
234 3300025907 Ga0207645_10295523 Ga0207645_102955232 127
235 3300025909 Ga0207705_11288761 Ga0207705_112887611 127
236 3300025919 Ga0207657_10002420 Ga0207657_100024203 127
237 3300025921 Ga0207652_10320344 Ga0207652_103203442 127
238 3300025924 Ga0207694_10799307 Ga0207694_107993071 127
239 3300025925 Ga0207650_10702619 Ga0207650_107026192 127
240 3300025927 Ga0207687_10129608 Ga0207687_101296081 127
241 3300025932 Ga0207690_10155949 Ga0207690_101559493 127
242 3300025933 Ga0207706_10005581 Ga0207706_100055813 127
243 3300025936 Ga0207670_10665671 Ga0207670_106656712 127
244 3300025937 Ga0207669_10122802 Ga0207669_101228022 127
245 3300025938 Ga0207704_10105357 Ga0207704_101053572 127
246 3300025940 Ga0207691_10015477 Ga0207691_100154777 127
247 3300025944 Ga0207661_10032950 Ga0207661_100329502 127
248 3300025945 Ga0207679_10035180 Ga0207679_100351802 127
249 3300025972 Ga0207668_11091304 Ga0207668_110913042 127
250 3300025981 Ga0207640_10052216 Ga0207640_100522162 127
251 3300025986 Ga0207658_10108712 Ga0207658_101087122 127
252 3300026023 Ga0207677_10511688 Ga0207677_105116882 127
253 3300026041 Ga0207639_10018612 Ga0207639_100186125 127
254 3300026067 Ga0207678_10055243 Ga0207678_100552433 127
255 3300026075 Ga0207708_10003445 Ga0207708_1000344510 127
256 3300026095 Ga0207676_10165453 Ga0207676_101654532 127
257 3300026142 Ga0207698_10054426 Ga0207698_100544262 127
258 3300028381 Ga0268264_10406516 Ga0268264_104065162 127
259 3300048903 Ga0496100_0424993 Ga0496100_0424993_426_833 127
260 3300048904 Ga0496101_0082929 Ga0496101_0082929_1510_1917 127
261 3300048905 Ga0496102_0975060 Ga0496102_0975060_61_468 127
262 3300048910 Ga0496107_0016039 Ga0496107_0016039_1203_1610 127
263 3300048912 Ga0496109_0035981 Ga0496109_0035981_1020_1427 127
264 3300048914 Ga0496111_0536970 Ga0496111_0536970_197_604 127
265 3300048916 Ga0496113_0072506 Ga0496113_0072506_2224_2607 127
266 3300050490 nmdc:mga03n38_45494_c1 nmdc:mga03n38_45494_c1_358_765 127
267 3300050492 nmdc:mga0yw44_10219_c1 nmdc:mga0yw44_10219_c1_1487_1894 127
268 3300050492 nmdc:mga0yw44_251057_c1 nmdc:mga0yw44_251057_c1_497_886 127
269 3300050494 nmdc:mga06z11_654071_c1 nmdc:mga06z11_654071_c1_178_585 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

147

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7746 6 127
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7701 3 126
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7682 1 127
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7673 2 124
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.764 3 126
ID Description Score Start End Superfamily
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7768 10 61 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7713 9 127 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7709 9 127 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7674 6 126 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.762 64 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7W1D3C4-F1-model_v4 VOC family protein 0.9809 4 127
AF-A0A2N7T1R3-F1-model_v4 deleted 0.9728 6 126
AF-A0A4R7EJ75-F1-model_v4 deleted 0.9721 7 127
AF-A0A1E5MHP9-F1-model_v4 Glyoxalase 0.9713 1 126
AF-A0A2W1W6Q0-F1-model_v4 deleted 0.9712 1 126

Feature Viewer

pLDDT pTM Quality
93.05 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map