F376131

General Info

Members Datasets Scaffolds Average Seq Length
269 139 538 111

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100004822|Ga0075428_10000482213
Length 108
Sequence VRERSLRRGSSLPDDCLFCALYADGNHVHAADGFVAIHDINPQADVHLLVLPERHVSSFKEIGEFPAEEVKRMLAKRAGLEDYRLAVHVGPRAGQTVFHLHWHILGSR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 5.2
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 18.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100004822 3300006844 Bacteria 14965
2 Ga0070658_10059276 3300005327 Bacteria 3117
3 Ga0070658_10543988 3300005327 Bacteria 1005
4 Ga0070680_100715644 3300005336 Unclassified 862
5 Ga0070682_101431087 3300005337 Bacteria 592
6 Ga0070682_102014905 3300005337 Bacteria 508
7 Ga0070660_100225960 3300005339 Bacteria 1522
8 Ga0070659_101324114 3300005366 Unclassified 639
9 Ga0070709_10070589 3300005434 Bacteria 2252
10 Ga0070714_100170500 3300005435 Bacteria 1975
11 Ga0070714_100184831 3300005435 Bacteria 1899
12 Ga0070714_100194524 3300005435 Bacteria 1853
13 Ga0070714_100607333 3300005435 Bacteria 1051
14 Ga0070714_101724774 3300005435 Bacteria 612
15 Ga0070714_102002650 3300005435 Unclassified 565
16 Ga0070713_100028991 3300005436 Bacteria 4377
17 Ga0070713_100844836 3300005436 Bacteria 879
18 Ga0070713_101449621 3300005436 Bacteria 666
19 Ga0070711_100547333 3300005439 Bacteria 960
20 Ga0070662_100856873 3300005457 Bacteria 774
21 Ga0070681_10125658 3300005458 Bacteria 2497
22 Ga0070681_10442414 3300005458 Unclassified 1212
23 Ga0070681_11325139 3300005458 Unclassified 643
24 Ga0070707_100665368 3300005468 Bacteria 1004
25 Ga0070707_100931123 3300005468 Bacteria 834
26 Ga0070698_100022296 3300005471 Bacteria 6625
27 Ga0070698_100109599 3300005471 Bacteria 2727
28 Ga0070679_100207832 3300005530 Unclassified 1922
29 Ga0070679_101026977 3300005530 Bacteria 769
30 Ga0070697_100300428 3300005536 Bacteria 1380
31 Ga0070697_102030493 3300005536 Unclassified 515
32 Ga0070696_100033883 3300005546 Bacteria 3511
33 Ga0068855_100423084 3300005563 Bacteria 1457
34 Ga0068856_101522611 3300005614 Bacteria 683
35 Ga0070717_10031516 3300006028 Bacteria 4266
36 Ga0070717_10414022 3300006028 Bacteria 1212
37 Ga0070712_100758450 3300006175 Bacteria 831
38 Ga0075431_100222508 3300006847 Unclassified 1925
39 Ga0075433_11163747 3300006852 Bacteria 670
40 Ga0075436_101396386 3300006914 Unclassified 531
41 Ga0075435_101242478 3300007076 Unclassified 652
42 Ga0105240_10482669 3300009093 Unclassified 1381
43 Ga0105240_11877887 3300009093 Bacteria 623
44 Ga0111539_10939250 3300009094 Bacteria 1006
45 Ga0114129_10011806 3300009147 Bacteria 12427
46 Ga0114129_10480338 3300009147 Bacteria 1626
47 Ga0105241_10652292 3300009174 Unclassified 956
48 Ga0105238_10563379 3300009551 Unclassified 1144
49 Ga0105239_12559742 3300010375 Bacteria 595
50 Ga0157373_10965967 3300013100 Bacteria 634
51 Ga0157373_11384350 3300013100 Bacteria 534
52 Ga0157369_10483407 3300013105 Bacteria 1282
53 Ga0157372_10986389 3300013307 Bacteria 976
54 Ga0182008_10008939 3300014497 Bacteria 5434
55 Ga0182008_10038124 3300014497 Bacteria 2404
56 Ga0182008_10319769 3300014497 Bacteria 816
57 Ga0157379_11329744 3300014968 Unclassified 695
58 Ga0182006_1032194 3300015261 Bacteria 2109
59 Ga0182005_1046052 3300015265 Bacteria 1185
60 Ga0213871_10027862 3300021441 Bacteria 1454
61 Ga0224712_10539564 3300022467 Bacteria 566
62 Ga0207697_10110718 3300025315 Unclassified 1176
63 Ga0207699_10103794 3300025906 Bacteria 1809
64 Ga0207705_10362517 3300025909 Bacteria 1118
65 Ga0207654_11237985 3300025911 Unclassified 544
66 Ga0207707_10073471 3300025912 Bacteria 2982
67 Ga0207707_10370804 3300025912 Unclassified 1232
68 Ga0207695_10099234 3300025913 Bacteria 2910
69 Ga0207657_10002821 3300025919 Bacteria 18677
70 Ga0207649_10466647 3300025920 Unclassified 955
71 Ga0207652_10021861 3300025921 Bacteria 5284
72 Ga0207652_10687632 3300025921 Bacteria 913
73 Ga0207652_11692832 3300025921 Bacteria 537
74 Ga0207646_10572777 3300025922 Unclassified 1014
75 Ga0207646_10724699 3300025922 Archaea 888
76 Ga0207700_10489883 3300025928 Bacteria 1087
77 Ga0207700_11322730 3300025928 Bacteria 642
78 Ga0207664_10119651 3300025929 Bacteria 2202
79 Ga0207664_10199930 3300025929 Bacteria 1724
80 Ga0207664_10487425 3300025929 Unclassified 1103
81 Ga0207664_11294591 3300025929 Unclassified 648
82 Ga0207664_11790440 3300025929 Bacteria 537
83 Ga0207644_10173777 3300025931 Bacteria 1684
84 Ga0207665_10319953 3300025939 Bacteria 1164
85 Ga0207665_10706419 3300025939 Bacteria 793
86 Ga0207667_10481717 3300025949 Unclassified 1260
87 Ga0207702_11736083 3300026078 Unclassified 617
88 Ga0265337_1048623 3300028556 Bacteria 1200
89 Ga0265337_1077098 3300028556 Bacteria 913
90 Ga0265326_10009886 3300028558 Bacteria 2847
91 Ga0265319_1000866 3300028563 Bacteria 19240
92 Ga0265319_1003775 3300028563 Bacteria 7765
93 Ga0265319_1044647 3300028563 Bacteria 1484
94 Ga0265319_1087020 3300028563 Bacteria 988
95 Ga0265334_10001611 3300028573 Bacteria 10835
96 Ga0265334_10002082 3300028573 Bacteria 9443
97 Ga0265318_10001206 3300028577 Bacteria 15720
98 Ga0265318_10001325 3300028577 Bacteria 14827
99 Ga0265323_10036011 3300028653 Bacteria 1822
100 Ga0265323_10098435 3300028653 Bacteria 970
101 Ga0265322_10006456 3300028654 Bacteria 3452
102 Ga0265322_10043914 3300028654 Bacteria 1272
103 Ga0265336_10016449 3300028666 Bacteria 2419
104 Ga0265336_10053202 3300028666 Bacteria 1220
105 Ga0265336_10130129 3300028666 Bacteria 749
106 Ga0265338_10007739 3300028800 Bacteria 13226
107 Ga0265338_10021385 3300028800 Bacteria 6748
108 Ga0265338_10025220 3300028800 Bacteria 6044
109 Ga0265338_10041089 3300028800 Bacteria 4331
110 Ga0265338_10050705 3300028800 Bacteria 3747
111 Ga0265338_10227905 3300028800 Bacteria 1387
112 Ga0265324_10020462 3300029957 Bacteria 2377
113 Ga0265330_10011257 3300031235 Bacteria 4200
114 Ga0265330_10199149 3300031235 Bacteria 847
115 Ga0265330_10286108 3300031235 Bacteria 694
116 Ga0265332_10001674 3300031238 Bacteria 12107
117 Ga0265328_10000898 3300031239 Bacteria 13766
118 Ga0265320_10013237 3300031240 Bacteria 4752
119 Ga0265320_10086600 3300031240 Bacteria 1456
120 Ga0265320_10203948 3300031240 Bacteria 882
121 Ga0265325_10004860 3300031241 Bacteria 8398
122 Ga0265325_10420820 3300031241 Bacteria 584
123 Ga0265329_10002795 3300031242 Bacteria 7796
124 Ga0265329_10037600 3300031242 Unclassified 1559
125 Ga0265340_10007370 3300031247 Bacteria 5974
126 Ga0265340_10053920 3300031247 Unclassified 1940
127 Ga0265340_10090266 3300031247 Bacteria 1433
128 Ga0265339_10006923 3300031249 Bacteria 7382
129 Ga0265339_10012410 3300031249 Bacteria 5203
130 Ga0265339_10189513 3300031249 Unclassified 1020
131 Ga0265339_10229357 3300031249 Bacteria 905
132 Ga0265339_10272988 3300031249 Bacteria 812
133 Ga0265331_10006421 3300031250 Bacteria 6949
134 Ga0265327_10024460 3300031251 Bacteria 3548
135 Ga0265327_10127270 3300031251 Bacteria 1201
136 Ga0265327_10251003 3300031251 Bacteria 788
137 Ga0265316_10003979 3300031344 Bacteria 14799
138 Ga0265316_10004339 3300031344 Bacteria 14132
139 Ga0265316_10012197 3300031344 Bacteria 7712
140 Ga0265316_10213025 3300031344 Bacteria 1428
141 Ga0265316_11013500 3300031344 Bacteria 577
142 Ga0265313_10009890 3300031595 Bacteria 6130
143 Ga0265313_10019635 3300031595 Bacteria 3755
144 Ga0265314_10005609 3300031711 Bacteria 11274
145 Ga0265314_10026978 3300031711 Bacteria 4307
146 Ga0265314_10058635 3300031711 Bacteria 2637
147 Ga0265342_10010583 3300031712 Bacteria 6383
148 Ga0265342_10014351 3300031712 Bacteria 5261
149 Ga0265342_10019024 3300031712 Bacteria 4434
150 Ga0316583_10034511 3300032133 Bacteria 1795
151 Ga0373931_0506746 3300035691 Bacteria 779
152 Ga0373935_0302338 3300035692 Bacteria 1131
153 Ga0395899_0038044 3300037312 Bacteria 3605
154 Ga0395899_0049985 3300037312 Bacteria 3106
155 Ga0395900_0056908 3300037418 Bacteria 4025
156 Ga0395900_0083094 3300037418 Bacteria 3290
157 Ga0395900_0260619 3300037418 Bacteria 1732
158 Ga0395900_0337953 3300037418 Bacteria 1482
159 Ga0395900_0646094 3300037418 Bacteria 995
160 Ga0395900_0960218 3300037418 Bacteria 776
161 Ga0395898_0074105 3300037466 Bacteria 3289
162 Ga0395898_0198960 3300037466 Bacteria 1913
163 Ga0395905_0038516 3300037471 Bacteria 4487
164 Ga0395905_0192832 3300037471 Bacteria 1911
165 Ga0395905_0298259 3300037471 Bacteria 1499
166 Ga0395901_0127260 3300038443 Bacteria 2677
167 Ga0395901_0244278 3300038443 Bacteria 1871
168 Ga0395901_0254771 3300038443 Bacteria 1828
169 Ga0395901_0474880 3300038443 Unclassified 1276
170 Ga0395901_0502288 3300038443 Bacteria 1234
171 Ga0395901_1882666 3300038443 Unclassified 546
172 Ga0436360_0623736 3300039438 Bacteria 4724
173 Ga0436360_0693712 3300039438 Unclassified 1710
174 Ga0451798_1073860 3300041458 Bacteria 552
175 Ga0451807_1065819 3300041486 Bacteria 785
176 Ga0451845_0708232 3300041501 Bacteria 736
177 Ga0439448_0384567 3300042005 Bacteria 502
178 Ga0466966_0001789 3300044684 Bacteria 13940
179 Ga0466961_0348064 3300044693 Bacteria 902
180 Ga0466963_0002013 3300044694 Bacteria 11169
181 Ga0466963_0002664 3300044694 Bacteria 10051
182 Ga0466963_0011065 3300044694 Bacteria 5486
183 Ga0466963_0031222 3300044694 Bacteria 3442
184 Ga0466963_0031856 3300044694 Bacteria 3410
185 Ga0466963_0037192 3300044694 Bacteria 3177
186 Ga0466963_0053228 3300044694 Unclassified 2687
187 Ga0466963_0180275 3300044694 Bacteria 1474
188 Ga0466963_0822974 3300044694 Bacteria 655
189 Ga0466963_1287383 3300044694 Bacteria 513
190 Ga0466964_0311099 3300044706 Bacteria 797
191 Ga0466964_0316616 3300044706 Bacteria 791
192 Ga0466964_0335181 3300044706 Bacteria 773
193 Ga0466971_0042372 3300044719 Bacteria 2045
194 Ga0466971_0427067 3300044719 Bacteria 648
195 Ga0466968_0005309 3300044735 Bacteria 4826
196 Ga0466968_0369537 3300044735 Unclassified 699
197 Ga0466970_0833190 3300044765 Unclassified 541
198 Ga0466957_0132361 3300044842 Bacteria 1599
199 Ga0466957_0206158 3300044842 Bacteria 1293
200 Ga0466957_0211685 3300044842 Bacteria 1276
201 Ga0466957_0423951 3300044842 Bacteria 913
202 Ga0466957_0629214 3300044842 Unclassified 753
203 Ga0466960_0887509 3300044901 Bacteria 543
204 Ga0466959_0006359 3300045049 Bacteria 8175
205 Ga0466959_0227551 3300045049 Unclassified 1292
206 Ga0466959_0611909 3300045049 Bacteria 732
207 Ga0466958_0001322 3300045836 Bacteria 11687
208 Ga0466958_0090702 3300045836 Bacteria 1891
209 Ga0466958_0184255 3300045836 Bacteria 1325
210 Ga0466958_0658989 3300045836 Bacteria 681
211 Ga0466967_0008147 3300045976 Bacteria 7649
212 Ga0466967_0011756 3300045976 Bacteria 6655
213 Ga0466967_0026593 3300045976 Bacteria 4795
214 Ga0466967_0043501 3300045976 Bacteria 3889
215 Ga0466967_0045979 3300045976 Bacteria 3797
216 Ga0466967_0046333 3300045976 Bacteria 3785
217 Ga0466967_0101619 3300045976 Bacteria 2628
218 Ga0466967_0171535 3300045976 Bacteria 2041
219 Ga0466967_0179054 3300045976 Bacteria 1998
220 Ga0466967_0283792 3300045976 Bacteria 1589
221 Ga0466967_0311036 3300045976 Bacteria 1517
222 Ga0466967_1741750 3300045976 Unclassified 620
223 Ga0495592_0225443 3300046454 Unclassified 1251
224 Ga0495592_0647667 3300046454 Bacteria 640
225 Ga0495641_0207796 3300046461 Unclassified 878
226 Ga0495651_0484952 3300046462 Unclassified 794
227 Ga0495582_0436361 3300046473 Unclassified 756
228 Ga0495608_0062385 3300046511 Bacteria 2449
229 Ga0495666_0242232 3300046526 Bacteria 823
230 Ga0495652_0238995 3300046529 Bacteria 1353
231 Ga0495652_0826851 3300046529 Bacteria 615
232 Ga0495640_0598826 3300046533 Unclassified 666
233 Ga0495640_0785535 3300046533 Unclassified 568
234 Ga0495586_0613163 3300046535 Unclassified 629
235 Ga0495667_0560006 3300046559 Bacteria 714
236 Ga0495634_0607653 3300046642 Unclassified 634
237 Ga0495635_0607689 3300046663 Unclassified 714
238 Ga0495657_0279204 3300046675 Unclassified 1000
239 Ga0495613_0138936 3300046689 Bacteria 1737
240 Ga0495581_0383495 3300047315 Bacteria 820
241 Ga0495674_1068300 3300047319 Unclassified 616
242 Ga0495676_0418067 3300047321 Bacteria 888
243 Ga0495676_0514960 3300047321 Bacteria 784
244 Ga0496103_0484554 3300048906 Bacteria 792
245 Ga0496104_0559417 3300048907 Bacteria 1054
246 Ga0496104_1155365 3300048907 Bacteria 678
247 Ga0496106_0793050 3300048909 Bacteria 752
248 Ga0496111_0336031 3300048914 Bacteria 1118
249 Ga0496112_0004864 3300048915 Bacteria 11480
250 Ga0496112_0017751 3300048915 Bacteria 6697
251 Ga0496112_0093705 3300048915 Bacteria 2973
252 Ga0496112_0094904 3300048915 Bacteria 2954
253 Ga0496112_0818753 3300048915 Bacteria 855
254 Ga0496113_0104931 3300048916 Bacteria 2194
255 Ga0496113_0597377 3300048916 Unclassified 884
256 Ga0501067_0067466 3300049583 Bacteria 1980
257 Ga0501069_0012526 3300049585 Bacteria 4511
258 nmdc:mga05p37_7745_c1 3300050507 Bacteria 12676
259 nmdc:mga06r32_238089_c1 3300050510 Unclassified 1808
260 nmdc:mga08x19_185512_c1 3300050514 Bacteria 1421
261 Ga0495601_0238634 3300053077 Bacteria 1187
262 Ga0495612_0288834 3300053078 Bacteria 734
263 Ga0500641_0071735 3300053096 Bacteria 1459
264 Ga0587107_071336 3300059652 Unclassified 635
265 Ga0466962_0045034 3300061719 Bacteria 2109
266 Ga0466962_0055589 3300061719 Bacteria 1891
267 Ga0466962_0070762 3300061719 Bacteria 1667
268 Ga0466962_0129548 3300061719 Unclassified 1219
269 Ga0530510_0031830 3300061734 Bacteria 3793
270 Ga0075428_100004822
271 Ga0070658_10059276
272 Ga0070658_10543988
273 Ga0070680_100715644
274 Ga0070682_101431087
275 Ga0070682_102014905
276 Ga0070660_100225960
277 Ga0070659_101324114
278 Ga0070709_10070589
279 Ga0070714_100170500
280 Ga0070714_100184831
281 Ga0070714_100194524
282 Ga0070714_100607333
283 Ga0070714_101724774
284 Ga0070714_102002650
285 Ga0070713_100028991
286 Ga0070713_100844836
287 Ga0070713_101449621
288 Ga0070711_100547333
289 Ga0070662_100856873
290 Ga0070681_10125658
291 Ga0070681_10442414
292 Ga0070681_11325139
293 Ga0070707_100665368
294 Ga0070707_100931123
295 Ga0070698_100022296
296 Ga0070698_100109599
297 Ga0070679_100207832
298 Ga0070679_101026977
299 Ga0070697_100300428
300 Ga0070697_102030493
301 Ga0070696_100033883
302 Ga0068855_100423084
303 Ga0068856_101522611
304 Ga0070717_10031516
305 Ga0070717_10414022
306 Ga0070712_100758450
307 Ga0075431_100222508
308 Ga0075433_11163747
309 Ga0075436_101396386
310 Ga0075435_101242478
311 Ga0105240_10482669
312 Ga0105240_11877887
313 Ga0111539_10939250
314 Ga0114129_10011806
315 Ga0114129_10480338
316 Ga0105241_10652292
317 Ga0105238_10563379
318 Ga0105239_12559742
319 Ga0157373_10965967
320 Ga0157373_11384350
321 Ga0157369_10483407
322 Ga0157372_10986389
323 Ga0182008_10008939
324 Ga0182008_10038124
325 Ga0182008_10319769
326 Ga0157379_11329744
327 Ga0182006_1032194
328 Ga0182005_1046052
329 Ga0213871_10027862
330 Ga0224712_10539564
331 Ga0207697_10110718
332 Ga0207699_10103794
333 Ga0207705_10362517
334 Ga0207654_11237985
335 Ga0207707_10073471
336 Ga0207707_10370804
337 Ga0207695_10099234
338 Ga0207657_10002821
339 Ga0207649_10466647
340 Ga0207652_10021861
341 Ga0207652_10687632
342 Ga0207652_11692832
343 Ga0207646_10572777
344 Ga0207646_10724699
345 Ga0207700_10489883
346 Ga0207700_11322730
347 Ga0207664_10119651
348 Ga0207664_10199930
349 Ga0207664_10487425
350 Ga0207664_11294591
351 Ga0207664_11790440
352 Ga0207644_10173777
353 Ga0207665_10319953
354 Ga0207665_10706419
355 Ga0207667_10481717
356 Ga0207702_11736083
357 Ga0265337_1048623
358 Ga0265337_1077098
359 Ga0265326_10009886
360 Ga0265319_1000866
361 Ga0265319_1003775
362 Ga0265319_1044647
363 Ga0265319_1087020
364 Ga0265334_10001611
365 Ga0265334_10002082
366 Ga0265318_10001206
367 Ga0265318_10001325
368 Ga0265323_10036011
369 Ga0265323_10098435
370 Ga0265322_10006456
371 Ga0265322_10043914
372 Ga0265336_10016449
373 Ga0265336_10053202
374 Ga0265336_10130129
375 Ga0265338_10007739
376 Ga0265338_10021385
377 Ga0265338_10025220
378 Ga0265338_10041089
379 Ga0265338_10050705
380 Ga0265338_10227905
381 Ga0265324_10020462
382 Ga0265330_10011257
383 Ga0265330_10199149
384 Ga0265330_10286108
385 Ga0265332_10001674
386 Ga0265328_10000898
387 Ga0265320_10013237
388 Ga0265320_10086600
389 Ga0265320_10203948
390 Ga0265325_10004860
391 Ga0265325_10420820
392 Ga0265329_10002795
393 Ga0265329_10037600
394 Ga0265340_10007370
395 Ga0265340_10053920
396 Ga0265340_10090266
397 Ga0265339_10006923
398 Ga0265339_10012410
399 Ga0265339_10189513
400 Ga0265339_10229357
401 Ga0265339_10272988
402 Ga0265331_10006421
403 Ga0265327_10024460
404 Ga0265327_10127270
405 Ga0265327_10251003
406 Ga0265316_10003979
407 Ga0265316_10004339
408 Ga0265316_10012197
409 Ga0265316_10213025
410 Ga0265316_11013500
411 Ga0265313_10009890
412 Ga0265313_10019635
413 Ga0265314_10005609
414 Ga0265314_10026978
415 Ga0265314_10058635
416 Ga0265342_10010583
417 Ga0265342_10014351
418 Ga0265342_10019024
419 Ga0316583_10034511
420 Ga0373931_0506746
421 Ga0373935_0302338
422 Ga0395899_0038044
423 Ga0395899_0049985
424 Ga0395900_0056908
425 Ga0395900_0083094
426 Ga0395900_0260619
427 Ga0395900_0337953
428 Ga0395900_0646094
429 Ga0395900_0960218
430 Ga0395898_0074105
431 Ga0395898_0198960
432 Ga0395905_0038516
433 Ga0395905_0192832
434 Ga0395905_0298259
435 Ga0395901_0127260
436 Ga0395901_0244278
437 Ga0395901_0254771
438 Ga0395901_0474880
439 Ga0395901_0502288
440 Ga0395901_1882666
441 Ga0436360_0623736
442 Ga0436360_0693712
443 Ga0451798_1073860
444 Ga0451807_1065819
445 Ga0451845_0708232
446 Ga0439448_0384567
447 Ga0466966_0001789
448 Ga0466961_0348064
449 Ga0466963_0002013
450 Ga0466963_0002664
451 Ga0466963_0011065
452 Ga0466963_0031222
453 Ga0466963_0031856
454 Ga0466963_0037192
455 Ga0466963_0053228
456 Ga0466963_0180275
457 Ga0466963_0822974
458 Ga0466963_1287383
459 Ga0466964_0311099
460 Ga0466964_0316616
461 Ga0466964_0335181
462 Ga0466971_0042372
463 Ga0466971_0427067
464 Ga0466968_0005309
465 Ga0466968_0369537
466 Ga0466970_0833190
467 Ga0466957_0132361
468 Ga0466957_0206158
469 Ga0466957_0211685
470 Ga0466957_0423951
471 Ga0466957_0629214
472 Ga0466960_0887509
473 Ga0466959_0006359
474 Ga0466959_0227551
475 Ga0466959_0611909
476 Ga0466958_0001322
477 Ga0466958_0090702
478 Ga0466958_0184255
479 Ga0466958_0658989
480 Ga0466967_0008147
481 Ga0466967_0011756
482 Ga0466967_0026593
483 Ga0466967_0043501
484 Ga0466967_0045979
485 Ga0466967_0046333
486 Ga0466967_0101619
487 Ga0466967_0171535
488 Ga0466967_0179054
489 Ga0466967_0283792
490 Ga0466967_0311036
491 Ga0466967_1741750
492 Ga0495592_0225443
493 Ga0495592_0647667
494 Ga0495641_0207796
495 Ga0495651_0484952
496 Ga0495582_0436361
497 Ga0495608_0062385
498 Ga0495666_0242232
499 Ga0495652_0238995
500 Ga0495652_0826851
501 Ga0495640_0598826
502 Ga0495640_0785535
503 Ga0495586_0613163
504 Ga0495667_0560006
505 Ga0495634_0607653
506 Ga0495635_0607689
507 Ga0495657_0279204
508 Ga0495613_0138936
509 Ga0495581_0383495
510 Ga0495674_1068300
511 Ga0495676_0418067
512 Ga0495676_0514960
513 Ga0496103_0484554
514 Ga0496104_0559417
515 Ga0496104_1155365
516 Ga0496106_0793050
517 Ga0496111_0336031
518 Ga0496112_0004864
519 Ga0496112_0017751
520 Ga0496112_0093705
521 Ga0496112_0094904
522 Ga0496112_0818753
523 Ga0496113_0104931
524 Ga0496113_0597377
525 Ga0501067_0067466
526 Ga0501069_0012526
527 nmdc:mga05p37_7745_c1
528 nmdc:mga06r32_238089_c1
529 nmdc:mga08x19_185512_c1
530 Ga0495601_0238634
531 Ga0495612_0288834
532 Ga0500641_0071735
533 Ga0587107_071336
534 Ga0466962_0045034
535 Ga0466962_0055589
536 Ga0466962_0070762
537 Ga0466962_0129548
538 Ga0530510_0031830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

15

108

0.86

PF01230

HIT

HIT domain

22

108

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgl-assembly2.cif.gz_D hit like protein 0.8965 16 105
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.8893 7 109
3omf-assembly1.cif.gz_A crystal structure of a histidine triad family protein from entamoeba histolytica, bound to amp 0.8792 7 112
4zgl-assembly3.cif.gz_E hit like protein 0.8733 18 105
3r6f-assembly1.cif.gz_A-2 crystal structure of a zinc-containing hit family protein from encephalitozoon cuniculi 0.8697 7 104
ID Description Score Start End Superfamily
af_I1MGX8_45_178_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8976 16 109 3.30.428.10
3oxkA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8798 7 112 3.30.428.10
4zglE00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8733 18 105 3.30.428.10
3r6fA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8697 7 104 3.30.428.10
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8682 16 104 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7W1N8Q2-F1-model_v4 HIT domain-containing protein 0.9554 7 106 GO:0003824
AF-A0A538GFQ7-F1-model_v4 HIT domain-containing protein 0.9511 2 106 GO:0003824
AF-A0A7W0SUP0-F1-model_v4 HIT domain-containing protein 0.9477 1 107 GO:0003824
AF-A0A7V9I3G3-F1-model_v4 HIT domain-containing protein 0.9456 20 112 GO:0003824
AF-A0A7W0SKG8-F1-model_v4 HIT domain-containing protein 0.9454 6 112 GO:0003824

Map