F376053

General Info

Members Datasets Scaffolds Average Seq Length
269 156 538 143

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100012919|Ga0070707_1000129196
Length 163
Sequence MIRPFRDVHPQIHETAFIADSAQIIGDVHIGEQASVWYGTVVRGDMFYIRVGNRTNVQDNCVLHTRTGEKPTILEDEVTIGHSVTLHGCYIEQKALIGIGSIVLDDVRVGAQSLMGMPARVKRPLTDEEVAGLDRFWQNYVEYSAMYLEERNPQITQIRKSKT

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
118 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
119 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
120 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 0.74
Rhizosphere 98.14
Stem 0
Stem Tuber 0
Unclassified 18.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100012919 3300005468 Bacteria 7800
2 SwRhRL3b_contig_3058647 2162886006 Bacteria 1142
3 Ga0065712_10358095 3300005290 Bacteria 778
4 Ga0065712_10421366 3300005290 Unclassified 711
5 Ga0065715_10256574 3300005293 Bacteria 1124
6 Ga0065715_10564063 3300005293 Unclassified 732
7 Ga0065707_10013528 3300005295 Bacteria 2710
8 Ga0070690_100016142 3300005330 Bacteria 4468
9 Ga0070690_100041385 3300005330 Bacteria 2917
10 Ga0070690_100649231 3300005330 Bacteria 806
11 Ga0070670_100006066 3300005331 Bacteria 10221
12 Ga0070677_10194771 3300005333 Unclassified 974
13 Ga0068869_100533194 3300005334 Bacteria 984
14 Ga0070682_100000219 3300005337 Bacteria 42148
15 Ga0068868_100238824 3300005338 Bacteria 1526
16 Ga0070689_100093416 3300005340 Bacteria 2374
17 Ga0070689_100148321 3300005340 Bacteria 1890
18 Ga0070687_100060699 3300005343 Bacteria 1996
19 Ga0070668_100000259 3300005347 Bacteria 35153
20 Ga0070669_100041292 3300005353 Bacteria 3355
21 Ga0070669_100820646 3300005353 Bacteria 791
22 Ga0070669_101573967 3300005353 Bacteria 572
23 Ga0070674_100029607 3300005356 Unclassified 3609
24 Ga0070674_100286242 3300005356 Bacteria 1308
25 Ga0070673_100361724 3300005364 Bacteria 1290
26 Ga0070688_100154228 3300005365 Bacteria 1572
27 Ga0070688_100181390 3300005365 Bacteria 1461
28 Ga0070667_101570920 3300005367 Unclassified 618
29 Ga0070703_10004715 3300005406 Plasmid 3813
30 Ga0070703_10064233 3300005406 Bacteria 1209
31 Ga0070701_10012658 3300005438 Bacteria 3811
32 Ga0070711_100108576 3300005439 Bacteria 2033
33 Ga0070700_100507812 3300005441 Bacteria 929
34 Ga0070700_101526576 3300005441 Unclassified 568
35 Ga0070694_100020702 3300005444 Bacteria 4196
36 Ga0070694_100338193 3300005444 Bacteria 1163
37 Ga0070708_100072105 3300005445 Unclassified 3111
38 Ga0070681_10746823 3300005458 Bacteria 895
39 Ga0070685_10409474 3300005466 Bacteria 941
40 Ga0070706_100041136 3300005467 Bacteria 4267
41 Ga0070706_100404466 3300005467 Unclassified 1271
42 Ga0070707_100001118 3300005468 Bacteria 26489
43 Ga0070707_100036071 3300005468 Bacteria 4717
44 Ga0070698_100000008 3300005471 Bacteria 119408
45 Ga0070698_100047780 3300005471 Unclassified 4375
46 Ga0070698_100070356 3300005471 Bacteria 3511
47 Ga0070698_100245933 3300005471 Bacteria 1721
48 Ga0070699_100518337 3300005518 Bacteria 1084
49 Ga0070699_100761121 3300005518 Unclassified 886
50 Ga0070699_100767510 3300005518 Unclassified 882
51 Ga0070699_100787921 3300005518 Bacteria 870
52 Ga0070697_100038160 3300005536 Bacteria 3881
53 Ga0070697_100049233 3300005536 Bacteria 3420
54 Ga0070697_100121086 3300005536 Bacteria 2189
55 Ga0070697_100491821 3300005536 Unclassified 1072
56 Ga0070686_100012607 3300005544 Bacteria 4819
57 Ga0070686_100037665 3300005544 Bacteria 3001
58 Ga0070695_100056166 3300005545 Bacteria 2540
59 Ga0070696_100436192 3300005546 Bacteria 1031
60 Ga0070696_100811481 3300005546 Unclassified 771
61 Ga0070696_100856891 3300005546 Unclassified 751
62 Ga0070693_100068541 3300005547 Bacteria 2082
63 Ga0070693_100470388 3300005547 Bacteria 886
64 Ga0070665_100579465 3300005548 Bacteria 1135
65 Ga0070704_100000153 3300005549 Bacteria 26636
66 Ga0070704_100118413 3300005549 Bacteria 2029
67 Ga0070704_100403451 3300005549 Bacteria 1167
68 Ga0070704_100710839 3300005549 Unclassified 892
69 Ga0068857_100130004 3300005577 Bacteria 2271
70 Ga0070702_100088324 3300005615 Bacteria 1874
71 Ga0070702_100579387 3300005615 Bacteria 838
72 Ga0070702_101121022 3300005615 Unclassified 630
73 Ga0068852_101230654 3300005616 Bacteria 770
74 Ga0068852_102224705 3300005616 Bacteria 570
75 Ga0068859_100016799 3300005617 Bacteria 7349
76 Ga0068864_100020117 3300005618 Bacteria 5582
77 Ga0068861_100123573 3300005719 Bacteria 2091
78 Ga0068861_100206429 3300005719 Bacteria 1652
79 Ga0068861_100813476 3300005719 Bacteria 878
80 Ga0068863_100682707 3300005841 Unclassified 1020
81 Ga0068863_100915978 3300005841 Bacteria 877
82 Ga0068858_100204678 3300005842 Bacteria 1867
83 Ga0068858_100293313 3300005842 Bacteria 1551
84 Ga0068858_100369635 3300005842 Bacteria 1375
85 Ga0068860_100152591 3300005843 Bacteria 2225
86 Ga0068860_100271924 3300005843 Bacteria 1654
87 Ga0068862_100016118 3300005844 Bacteria 6216
88 Ga0068862_100728709 3300005844 Bacteria 963
89 Ga0081539_10000744 3300005985 Bacteria 64979
90 Ga0097621_100611845 3300006237 Unclassified 997
91 Ga0075428_100194523 3300006844 Bacteria 2193
92 Ga0075431_101142366 3300006847 Bacteria 743
93 Ga0075433_11376539 3300006852 Bacteria 611
94 Ga0075434_100279626 3300006871 Bacteria 1688
95 Ga0075434_100325384 3300006871 Bacteria 1558
96 Ga0075434_100624124 3300006871 Bacteria 1097
97 Ga0075434_100967034 3300006871 Unclassified 866
98 Ga0075434_101112709 3300006871 Unclassified 803
99 Ga0075429_100006076 3300006880 Bacteria 10443
100 Ga0075429_100874256 3300006880 Bacteria 787
101 Ga0075429_100924642 3300006880 Bacteria 763
102 Ga0068865_100471090 3300006881 Bacteria 1042
103 Ga0075436_100000042 3300006914 Bacteria 78521
104 Ga0097620_100016799 3300006931 Bacteria 7349
105 Ga0075435_100018399 3300007076 Bacteria 5313
106 Ga0099794_10031876 3300007265 Bacteria 2471
107 Ga0099795_10306978 3300007788 Unclassified 699
108 Ga0105240_11945932 3300009093 Bacteria 611
109 Ga0111539_10010638 3300009094 Bacteria 11585
110 Ga0111539_11223537 3300009094 Unclassified 872
111 Ga0105247_10029215 3300009101 Bacteria 3339
112 Ga0114129_10043616 3300009147 Bacteria 6310
113 Ga0114129_10061463 3300009147 Bacteria 5249
114 Ga0114129_10224757 3300009147 Bacteria 2531
115 Ga0114129_11503124 3300009147 Bacteria 827
116 Ga0105243_10000056 3300009148 Bacteria 133442
117 Ga0105243_10000214 3300009148 Bacteria 67405
118 Ga0105243_10011609 3300009148 Bacteria 6664
119 Ga0105243_10321257 3300009148 Bacteria 1411
120 Ga0105243_10697715 3300009148 Unclassified 989
121 Ga0105243_10851464 3300009148 Bacteria 903
122 Ga0105242_10000015 3300009176 Bacteria 124678
123 Ga0105242_10002969 3300009176 Bacteria 13273
124 Ga0105242_10006197 3300009176 Bacteria 9215
125 Ga0105242_10247425 3300009176 Bacteria 1605
126 Ga0105248_10156099 3300009177 Bacteria 2575
127 Ga0105248_10627887 3300009177 Bacteria 1212
128 Ga0105248_10872667 3300009177 Bacteria 1016
129 Ga0105249_10000044 3300009553 Bacteria 184637
130 Ga0105249_10024075 3300009553 Bacteria 5469
131 Ga0105239_11140575 3300010375 Bacteria 898
132 Ga0105246_10442817 3300011119 Unclassified 1090
133 Ga0105246_11066607 3300011119 Bacteria 736
134 Ga0157378_10000090 3300013297 Bacteria 86085
135 Ga0157378_10012174 3300013297 Bacteria 7532
136 Ga0157378_10030750 3300013297 Bacteria 4741
137 Ga0157378_10098885 3300013297 Bacteria 2661
138 Ga0157378_10177246 3300013297 Bacteria 2003
139 Ga0157378_10744084 3300013297 Bacteria 1003
140 Ga0157378_11041513 3300013297 Bacteria 854
141 Ga0157378_11257382 3300013297 Unclassified 781
142 Ga0163162_10000025 3300013306 Bacteria 184648
143 Ga0163162_10099044 3300013306 Bacteria 3005
144 Ga0163162_11993641 3300013306 Bacteria 665
145 Ga0157375_10104270 3300013308 Bacteria 2924
146 Ga0157375_11283925 3300013308 Bacteria 860
147 Ga0157380_10000349 3300014326 Bacteria 27635
148 Ga0157380_10075044 3300014326 Bacteria 2747
149 Ga0157380_10316740 3300014326 Bacteria 1444
150 Ga0157380_10908590 3300014326 Unclassified 907
151 Ga0157377_10692498 3300014745 Unclassified 739
152 Ga0157377_10754449 3300014745 Bacteria 712
153 Ga0157377_11011692 3300014745 Bacteria 630
154 Ga0157376_12070647 3300014969 Unclassified 607
155 Ga0163161_10243819 3300017792 Bacteria 1398
156 Ga0163161_10399028 3300017792 Bacteria 1102
157 Ga0213876_10000031 3300021384 Bacteria 213087
158 Ga0207653_10000011 3300025885 Bacteria 160949
159 Ga0207688_10253082 3300025901 Bacteria 1067
160 Ga0207645_10359336 3300025907 Bacteria 975
161 Ga0207684_10034812 3300025910 Bacteria 4278
162 Ga0207663_10116170 3300025916 Bacteria 1824
163 Ga0207662_10021373 3300025918 Unclassified 3699
164 Ga0207662_10073176 3300025918 Bacteria 2078
165 Ga0207662_10129259 3300025918 Bacteria 1591
166 Ga0207646_10000576 3300025922 Bacteria 48114
167 Ga0207646_10015763 3300025922 Bacteria 7118
168 Ga0207646_10099641 3300025922 Bacteria 2604
169 Ga0207681_10011083 3300025923 Bacteria 5535
170 Ga0207650_10000330 3300025925 Bacteria 45950
171 Ga0207650_10770497 3300025925 Unclassified 815
172 Ga0207650_11027385 3300025925 Unclassified 701
173 Ga0207644_10167060 3300025931 Unclassified 1715
174 Ga0207686_10000007 3300025934 Bacteria 249199
175 Ga0207686_10000147 3300025934 Bacteria 54404
176 Ga0207686_10002561 3300025934 Bacteria 9885
177 Ga0207709_10000101 3300025935 Bacteria 133425
178 Ga0207709_10588944 3300025935 Unclassified 879
179 Ga0207670_10026576 3300025936 Bacteria 3649
180 Ga0207670_10038189 3300025936 Bacteria 3135
181 Ga0207670_10484229 3300025936 Bacteria 1002
182 Ga0207669_10082897 3300025937 Unclassified 2060
183 Ga0207704_10227822 3300025938 Bacteria 1384
184 Ga0207665_10019540 3300025939 Bacteria 4455
185 Ga0207711_11511266 3300025941 Bacteria 615
186 Ga0207689_10005676 3300025942 Bacteria 11101
187 Ga0207651_10240128 3300025960 Bacteria 1476
188 Ga0207712_10000039 3300025961 Bacteria 182548
189 Ga0207668_10000519 3300025972 Bacteria 24141
190 Ga0207640_10588296 3300025981 Bacteria 940
191 Ga0207703_10031592 3300026035 Bacteria 4188
192 Ga0207703_10067512 3300026035 Bacteria 2943
193 Ga0207703_10151037 3300026035 Bacteria 2026
194 Ga0207703_10165045 3300026035 Bacteria 1942
195 Ga0207703_10975794 3300026035 Bacteria 813
196 Ga0207708_10020391 3300026075 Bacteria 5000
197 Ga0207708_10125985 3300026075 Bacteria 1999
198 Ga0207708_10826397 3300026075 Bacteria 799
199 Ga0207641_10184539 3300026088 Bacteria 1913
200 Ga0207641_10919767 3300026088 Unclassified 869
201 Ga0207648_11333402 3300026089 Unclassified 674
202 Ga0207676_10586203 3300026095 Bacteria 1069
203 Ga0207674_10177689 3300026116 Bacteria 2081
204 Ga0207675_100012107 3300026118 Bacteria 8059
205 Ga0207675_100448871 3300026118 Bacteria 1278
206 Ga0207675_101180580 3300026118 Unclassified 785
207 Ga0207675_101252262 3300026118 Unclassified 762
208 Ga0207428_10012011 3300027907 Bacteria 7622
209 Ga0268266_11355581 3300028379 Bacteria 687
210 Ga0268265_10677008 3300028380 Bacteria 994
211 Ga0268264_10028976 3300028381 Bacteria 4533
212 Ga0268264_10241686 3300028381 Unclassified 1673
213 Ga0268264_10250886 3300028381 Bacteria 1644
214 Ga0307415_101067954 3300032126 Bacteria 754
215 Ga0373959_0034454 3300034820 Bacteria 1037
216 Ga0373941_0018804 3300035115 Bacteria 1914
217 Ga0373931_0093948 3300035691 Bacteria 1676
218 Ga0436365_0882969 3300039437 Bacteria 184313
219 Ga0450920_034887 3300042122 Bacteria 996
220 Ga0450920_067565 3300042122 Bacteria 726
221 Ga0450894_004596 3300042131 Bacteria 1790
222 Ga0450896_003069 3300042133 Bacteria 2197
223 Ga0450918_003017 3300042531 Bacteria 3150
224 Ga0451576_0104641 3300045051 Unclassified 2944
225 Ga0451576_0456061 3300045051 Bacteria 1342
226 Ga0451576_0825501 3300045051 Bacteria 973
227 Ga0495584_0348073 3300046491 Bacteria 753
228 Ga0495610_0101537 3300046512 Bacteria 1288
229 Ga0495618_0379236 3300046514 Bacteria 868
230 Ga0495630_0240408 3300046517 Bacteria 1384
231 Ga0495663_0000152 3300046525 Bacteria 28131
232 Ga0495652_0695156 3300046529 Bacteria 685
233 Ga0495598_0001092 3300046537 Bacteria 5209
234 Ga0495598_0029124 3300046537 Unclassified 1537
235 Ga0495635_0079661 3300046663 Bacteria 2242
236 Ga0495636_0076538 3300047318 Bacteria 1435
237 Ga0495674_0238909 3300047319 Bacteria 1498
238 Ga0496106_0006993 3300048909 Bacteria 8334
239 Ga0496114_0358493 3300048917 Bacteria 1290
240 Ga0501032_0090240 3300049569 Bacteria 2034
241 Ga0501033_0570072 3300049570 Unclassified 778
242 Ga0501036_0451135 3300049572 Unclassified 1071
243 Ga0501038_0380526 3300049574 Unclassified 1095
244 Ga0501040_0073549 3300049576 Bacteria 2362
245 Ga0501042_0883447 3300049578 Bacteria 651
246 Ga0501048_0082785 3300049582 Bacteria 2263
247 Ga0501070_0607113 3300049586 Unclassified 872
248 Ga0501075_0029935 3300049591 Bacteria 4028
249 Ga0501076_0196153 3300049592 Bacteria 1648
250 Ga0501077_0206510 3300049593 Bacteria 1248
251 Ga0501079_0102286 3300049741 Bacteria 2222
252 Ga0501045_0008534 3300049824 Bacteria 7142
253 nmdc:mga05p37_193626_c1 3300050507 Bacteria 2467
254 nmdc:mga05p37_716574_c1 3300050507 Bacteria 1109
255 nmdc:mga05p37_997268_c1 3300050507 Bacteria 890
256 nmdc:mga09592_17778_c1 3300050508 Bacteria 5827
257 nmdc:mga09592_658820_c1 3300050508 Unclassified 893
258 nmdc:mga08y16_87632_c1 3300050511 Bacteria 3244
259 nmdc:mga0n895_1134135_c1 3300050512 Unclassified 758
260 nmdc:mga0n895_159627_c1 3300050512 Bacteria 2286
261 nmdc:mga0n895_619710_c1 3300050512 Bacteria 1083
262 nmdc:mga0n895_765072_c1 3300050512 Unclassified 958
263 nmdc:mga0rr50_151_c1 3300050513 Bacteria 37856
264 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
265 nmdc:mga0a205_164913_c2 3300050515 Bacteria 617
266 nmdc:mga0a205_23276_c1 3300050515 Bacteria 5874
267 Ga0495655_0006264 3300053083 Unclassified 2153
268 Ga0500616_0007168 3300053153 Bacteria 7129
269 Ga0501082_0377877 3300060353 Unclassified 1236
270 Ga0070707_100012919
271 SwRhRL3b_contig_3058647
272 Ga0065712_10358095
273 Ga0065712_10421366
274 Ga0065715_10256574
275 Ga0065715_10564063
276 Ga0065707_10013528
277 Ga0070690_100016142
278 Ga0070690_100041385
279 Ga0070690_100649231
280 Ga0070670_100006066
281 Ga0070677_10194771
282 Ga0068869_100533194
283 Ga0070682_100000219
284 Ga0068868_100238824
285 Ga0070689_100093416
286 Ga0070689_100148321
287 Ga0070687_100060699
288 Ga0070668_100000259
289 Ga0070669_100041292
290 Ga0070669_100820646
291 Ga0070669_101573967
292 Ga0070674_100029607
293 Ga0070674_100286242
294 Ga0070673_100361724
295 Ga0070688_100154228
296 Ga0070688_100181390
297 Ga0070667_101570920
298 Ga0070703_10004715
299 Ga0070703_10064233
300 Ga0070701_10012658
301 Ga0070711_100108576
302 Ga0070700_100507812
303 Ga0070700_101526576
304 Ga0070694_100020702
305 Ga0070694_100338193
306 Ga0070708_100072105
307 Ga0070681_10746823
308 Ga0070685_10409474
309 Ga0070706_100041136
310 Ga0070706_100404466
311 Ga0070707_100001118
312 Ga0070707_100036071
313 Ga0070698_100000008
314 Ga0070698_100047780
315 Ga0070698_100070356
316 Ga0070698_100245933
317 Ga0070699_100518337
318 Ga0070699_100761121
319 Ga0070699_100767510
320 Ga0070699_100787921
321 Ga0070697_100038160
322 Ga0070697_100049233
323 Ga0070697_100121086
324 Ga0070697_100491821
325 Ga0070686_100012607
326 Ga0070686_100037665
327 Ga0070695_100056166
328 Ga0070696_100436192
329 Ga0070696_100811481
330 Ga0070696_100856891
331 Ga0070693_100068541
332 Ga0070693_100470388
333 Ga0070665_100579465
334 Ga0070704_100000153
335 Ga0070704_100118413
336 Ga0070704_100403451
337 Ga0070704_100710839
338 Ga0068857_100130004
339 Ga0070702_100088324
340 Ga0070702_100579387
341 Ga0070702_101121022
342 Ga0068852_101230654
343 Ga0068852_102224705
344 Ga0068859_100016799
345 Ga0068864_100020117
346 Ga0068861_100123573
347 Ga0068861_100206429
348 Ga0068861_100813476
349 Ga0068863_100682707
350 Ga0068863_100915978
351 Ga0068858_100204678
352 Ga0068858_100293313
353 Ga0068858_100369635
354 Ga0068860_100152591
355 Ga0068860_100271924
356 Ga0068862_100016118
357 Ga0068862_100728709
358 Ga0081539_10000744
359 Ga0097621_100611845
360 Ga0075428_100194523
361 Ga0075431_101142366
362 Ga0075433_11376539
363 Ga0075434_100279626
364 Ga0075434_100325384
365 Ga0075434_100624124
366 Ga0075434_100967034
367 Ga0075434_101112709
368 Ga0075429_100006076
369 Ga0075429_100874256
370 Ga0075429_100924642
371 Ga0068865_100471090
372 Ga0075436_100000042
373 Ga0097620_100016799
374 Ga0075435_100018399
375 Ga0099794_10031876
376 Ga0099795_10306978
377 Ga0105240_11945932
378 Ga0111539_10010638
379 Ga0111539_11223537
380 Ga0105247_10029215
381 Ga0114129_10043616
382 Ga0114129_10061463
383 Ga0114129_10224757
384 Ga0114129_11503124
385 Ga0105243_10000056
386 Ga0105243_10000214
387 Ga0105243_10011609
388 Ga0105243_10321257
389 Ga0105243_10697715
390 Ga0105243_10851464
391 Ga0105242_10000015
392 Ga0105242_10002969
393 Ga0105242_10006197
394 Ga0105242_10247425
395 Ga0105248_10156099
396 Ga0105248_10627887
397 Ga0105248_10872667
398 Ga0105249_10000044
399 Ga0105249_10024075
400 Ga0105239_11140575
401 Ga0105246_10442817
402 Ga0105246_11066607
403 Ga0157378_10000090
404 Ga0157378_10012174
405 Ga0157378_10030750
406 Ga0157378_10098885
407 Ga0157378_10177246
408 Ga0157378_10744084
409 Ga0157378_11041513
410 Ga0157378_11257382
411 Ga0163162_10000025
412 Ga0163162_10099044
413 Ga0163162_11993641
414 Ga0157375_10104270
415 Ga0157375_11283925
416 Ga0157380_10000349
417 Ga0157380_10075044
418 Ga0157380_10316740
419 Ga0157380_10908590
420 Ga0157377_10692498
421 Ga0157377_10754449
422 Ga0157377_11011692
423 Ga0157376_12070647
424 Ga0163161_10243819
425 Ga0163161_10399028
426 Ga0213876_10000031
427 Ga0207653_10000011
428 Ga0207688_10253082
429 Ga0207645_10359336
430 Ga0207684_10034812
431 Ga0207663_10116170
432 Ga0207662_10021373
433 Ga0207662_10073176
434 Ga0207662_10129259
435 Ga0207646_10000576
436 Ga0207646_10015763
437 Ga0207646_10099641
438 Ga0207681_10011083
439 Ga0207650_10000330
440 Ga0207650_10770497
441 Ga0207650_11027385
442 Ga0207644_10167060
443 Ga0207686_10000007
444 Ga0207686_10000147
445 Ga0207686_10002561
446 Ga0207709_10000101
447 Ga0207709_10588944
448 Ga0207670_10026576
449 Ga0207670_10038189
450 Ga0207670_10484229
451 Ga0207669_10082897
452 Ga0207704_10227822
453 Ga0207665_10019540
454 Ga0207711_11511266
455 Ga0207689_10005676
456 Ga0207651_10240128
457 Ga0207712_10000039
458 Ga0207668_10000519
459 Ga0207640_10588296
460 Ga0207703_10031592
461 Ga0207703_10067512
462 Ga0207703_10151037
463 Ga0207703_10165045
464 Ga0207703_10975794
465 Ga0207708_10020391
466 Ga0207708_10125985
467 Ga0207708_10826397
468 Ga0207641_10184539
469 Ga0207641_10919767
470 Ga0207648_11333402
471 Ga0207676_10586203
472 Ga0207674_10177689
473 Ga0207675_100012107
474 Ga0207675_100448871
475 Ga0207675_101180580
476 Ga0207675_101252262
477 Ga0207428_10012011
478 Ga0268266_11355581
479 Ga0268265_10677008
480 Ga0268264_10028976
481 Ga0268264_10241686
482 Ga0268264_10250886
483 Ga0307415_101067954
484 Ga0373959_0034454
485 Ga0373941_0018804
486 Ga0373931_0093948
487 Ga0436365_0882969
488 Ga0450920_034887
489 Ga0450920_067565
490 Ga0450894_004596
491 Ga0450896_003069
492 Ga0450918_003017
493 Ga0451576_0104641
494 Ga0451576_0456061
495 Ga0451576_0825501
496 Ga0495584_0348073
497 Ga0495610_0101537
498 Ga0495618_0379236
499 Ga0495630_0240408
500 Ga0495663_0000152
501 Ga0495652_0695156
502 Ga0495598_0001092
503 Ga0495598_0029124
504 Ga0495635_0079661
505 Ga0495636_0076538
506 Ga0495674_0238909
507 Ga0496106_0006993
508 Ga0496114_0358493
509 Ga0501032_0090240
510 Ga0501033_0570072
511 Ga0501036_0451135
512 Ga0501038_0380526
513 Ga0501040_0073549
514 Ga0501042_0883447
515 Ga0501048_0082785
516 Ga0501070_0607113
517 Ga0501075_0029935
518 Ga0501076_0196153
519 Ga0501077_0206510
520 Ga0501079_0102286
521 Ga0501045_0008534
522 nmdc:mga05p37_193626_c1
523 nmdc:mga05p37_716574_c1
524 nmdc:mga05p37_997268_c1
525 nmdc:mga09592_17778_c1
526 nmdc:mga09592_658820_c1
527 nmdc:mga08y16_87632_c1
528 nmdc:mga0n895_1134135_c1
529 nmdc:mga0n895_159627_c1
530 nmdc:mga0n895_619710_c1
531 nmdc:mga0n895_765072_c1
532 nmdc:mga0rr50_151_c1
533 nmdc:mga08x19_61_c1
534 nmdc:mga0a205_164913_c2
535 nmdc:mga0a205_23276_c1
536 Ga0495655_0006264
537 Ga0500616_0007168
538 Ga0501082_0377877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sc4-assembly2.cif.gz_D gamma-carbonic anhydrase from the haloarchaeon halobacterium sp. 0.9362 1 150
4n27-assembly1.cif.gz_C x-ray structure of brucella abortus rica 0.9231 2 148
6sc4-assembly2.cif.gz_D gamma-carbonic anhydrase from the haloarchaeon halobacterium sp. 0.9181 1 150
8e73-assembly1.cif.gz_G2 vigna radiata supercomplex i+iii2 (full bridge) 0.9087 2 150
4mfg-assembly2.cif.gz_D 2.0 angstrom resolution crystal structure of putative carbonic anhydrase from clostridium difficile. 0.9033 8 147
ID Description Score Start End Superfamily
af_P39206_2_173_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.91 1 146 2.160.10.10
4n27D00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9095 2 149 2.160.10.10
4mfgC00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.902 8 147 2.160.10.10
af_Q9SMN1_61_234_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8813 1 149 2.160.10.10
4n27D00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8808 2 149 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A3D4V307-F1-model_v4 Gamma carbonic anhydrase family protein 1.001 1 107
AF-A0A359E2M8-F1-model_v4 Gamma carbonic anhydrase family protein 1.001 1 93
AF-A0A849PYU1-F1-model_v4 Gamma carbonic anhydrase family protein 0.9996 1 89
AF-X1UHF3-F1-model_v4 Gamma carbonic anhydrase family protein 0.9994 1 110
AF-A0A2V9TVE6-F1-model_v4 Gamma carbonic anhydrase family protein 0.9994 1 92

Map