F375820

General Info

Members Datasets Scaffolds Average Seq Length
268 154 536 381

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_55482_c1|nmdc:mga05p37_55482_c1_1162_2454
Length 430
Sequence MRQDRHRHWIAHGLKIYAIGVSWSTSADRSGRARDRPVTWIEYHRRVRETGSTAEASLGEVAALFLKLGCVAFGGPAAHIALMRDEVVRRRRWVTEQQFLDLLGASNLIPGPTSTELAIYLGYARAGWRGLILAGALFILPAALISLALAWAYVRYGSTPEATWLLYGIKPVIIAVVVQAIWALSRTAVQGRLSAAIGALVLVLYALGFNEIVLLLGAGVVVTLVRAAWRGRSRPRVLGVVPLLAAPALPAAAGAVDPIGLFLVFLKIGAVLYGSGYVLLAFLRNDLVLRLGWLTDRQLIDAVAVGQLTPGPVFTTATFIGYVLGGVGGAALSTLGIFLPSFLFVAVVYPLVPRLRGSPWTSGFLDGVNVAALGLMLAVTWQLGRSAVVDWLTAALALGAAAVLVMLRVNSVWLIAGGAVVGLVARWLGR

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2831426010 Nostoc sp. 106C Isolate Unclassified
152 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
153 2849660919 Nostoc sp. T09 Isolate Unclassified
154 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 1.12
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 1.87
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_55482_c1 3300050507 Bacteria 4876
2 rootH2_10210870 3300003320 Bacteria 5423
3 JGI25407J50210_10003847 3300003373 Bacteria 3633
4 Ga0070683_100001196 3300005329 Bacteria 19741
5 Ga0070666_10011043 3300005335 Bacteria 5660
6 Ga0070680_100022151 3300005336 Bacteria 5055
7 Ga0070660_100051050 3300005339 Bacteria 3184
8 Ga0070669_100108500 3300005353 Bacteria 2104
9 Ga0070709_10000534 3300005434 Bacteria 22268
10 Ga0070714_100130793 3300005435 Unclassified 2243
11 Ga0070713_100000087 3300005436 Bacteria 58314
12 Ga0070713_100000425 3300005436 Bacteria 26954
13 Ga0070710_10012413 3300005437 Bacteria 4231
14 Ga0070710_10020561 3300005437 Bacteria 3427
15 Ga0070711_100001138 3300005439 Bacteria 14245
16 Ga0070711_100004234 3300005439 Bacteria 8434
17 Ga0070700_100215497 3300005441 Bacteria 1357
18 Ga0070694_100027280 3300005444 Bacteria 3707
19 Ga0070708_100001788 3300005445 Bacteria 16502
20 Ga0070708_100026281 3300005445 Bacteria 4981
21 Ga0070708_100253757 3300005445 Unclassified 1652
22 Ga0070662_100127692 3300005457 Bacteria 1956
23 Ga0070706_100000220 3300005467 Bacteria 69811
24 Ga0070706_100003650 3300005467 Bacteria 15062
25 Ga0070706_100008780 3300005467 Bacteria 9417
26 Ga0070706_100024642 3300005467 Bacteria 5540
27 Ga0070706_100026414 3300005467 Bacteria 5343
28 Ga0070706_100046763 3300005467 Bacteria 3995
29 Ga0070706_100055383 3300005467 Bacteria 3661
30 Ga0070707_100005857 3300005468 Bacteria 11459
31 Ga0070707_100007092 3300005468 Bacteria 10389
32 Ga0070698_100006281 3300005471 Bacteria 12911
33 Ga0070698_100013527 3300005471 Bacteria 8640
34 Ga0070698_100019288 3300005471 Bacteria 7163
35 Ga0070698_100236670 3300005471 Unclassified 1759
36 Ga0070679_100077519 3300005530 Bacteria 3312
37 Ga0070684_100129088 3300005535 Bacteria 2279
38 Ga0070697_100002333 3300005536 Bacteria 14593
39 Ga0070697_100040546 3300005536 Bacteria 3769
40 Ga0070697_100139923 3300005536 Unclassified 2035
41 Ga0070697_100184624 3300005536 Unclassified 1768
42 Ga0070672_100125545 3300005543 Bacteria 2104
43 Ga0070704_100026322 3300005549 Bacteria 3842
44 Ga0070704_100232132 3300005549 Bacteria 1506
45 Ga0068857_100024192 3300005577 Bacteria 5346
46 Ga0068864_100213622 3300005618 Unclassified 1777
47 Ga0068860_100153731 3300005843 Bacteria 2217
48 Ga0068862_100158615 3300005844 Bacteria 2018
49 Ga0081455_10029297 3300005937 Bacteria 5019
50 Ga0081538_10002724 3300005981 Bacteria 16981
51 Ga0081538_10014484 3300005981 Bacteria 6171
52 Ga0081538_10043055 3300005981 Bacteria 2841
53 Ga0081539_10000845 3300005985 Bacteria 58627
54 Ga0081539_10005411 3300005985 Bacteria 13057
55 Ga0070717_10246734 3300006028 Bacteria 1576
56 Ga0075364_10018426 3300006051 Bacteria 4370
57 Ga0070716_100000984 3300006173 Bacteria 12417
58 Ga0070716_100024251 3300006173 Bacteria 3227
59 Ga0070712_100000258 3300006175 Bacteria 29603
60 Ga0070712_100002338 3300006175 Bacteria 11683
61 Ga0075366_10048807 3300006195 Bacteria 2511
62 Ga0075428_100002904 3300006844 Bacteria 18646
63 Ga0075428_100141109 3300006844 Bacteria 2620
64 Ga0075428_100426169 3300006844 Bacteria 1421
65 Ga0075430_100006556 3300006846 Bacteria 9817
66 Ga0075431_100001857 3300006847 Bacteria 20009
67 Ga0075431_100002704 3300006847 Bacteria 17191
68 Ga0075431_100044584 3300006847 Bacteria 4574
69 Ga0075431_100048514 3300006847 Bacteria 4380
70 Ga0075431_100060292 3300006847 Bacteria 3915
71 Ga0075433_10000596 3300006852 Bacteria 23999
72 Ga0075433_10001573 3300006852 Bacteria 16892
73 Ga0075433_10081271 3300006852 Bacteria 2857
74 Ga0075433_10235299 3300006852 Bacteria 1626
75 Ga0075434_100001070 3300006871 Bacteria 22396
76 Ga0075434_100007518 3300006871 Bacteria 10087
77 Ga0075434_100027006 3300006871 Bacteria 5633
78 Ga0075434_100060469 3300006871 Bacteria 3768
79 Ga0075434_100085847 3300006871 Bacteria 3147
80 Ga0075429_100031052 3300006880 Bacteria 4643
81 Ga0075429_100044067 3300006880 Bacteria 3880
82 Ga0075429_100067201 3300006880 Bacteria 3120
83 Ga0075429_100130858 3300006880 Bacteria 2195
84 Ga0075429_100223860 3300006880 Bacteria 1648
85 Ga0075436_100000793 3300006914 Bacteria 20935
86 Ga0075436_100005335 3300006914 Bacteria 8842
87 Ga0075436_100010684 3300006914 Bacteria 6298
88 Ga0075435_100008629 3300007076 Bacteria 7326
89 Ga0075435_100010572 3300007076 Bacteria 6754
90 Ga0075435_100012918 3300007076 Bacteria 6195
91 Ga0075435_100127505 3300007076 Bacteria 2128
92 Ga0099794_10017458 3300007265 Bacteria 3199
93 Ga0111539_10331040 3300009094 Bacteria 1773
94 Ga0114129_10000146 3300009147 Bacteria 74508
95 Ga0114129_10000722 3300009147 Bacteria 41913
96 Ga0114129_10022368 3300009147 Bacteria 8976
97 Ga0114129_10032888 3300009147 Bacteria 7328
98 Ga0114129_10041614 3300009147 Bacteria 6473
99 Ga0114129_10085818 3300009147 Bacteria 4367
100 Ga0157378_10061342 3300013297 Bacteria 3355
101 Ga0163163_10035037 3300014325 Bacteria 4866
102 Ga0224570_100578 3300022730 Bacteria 2906
103 Ga0224572_1005959 3300024225 Bacteria 2194
104 Ga0228598_1000861 3300024227 Bacteria 6564
105 Ga0207692_10007673 3300025898 Bacteria 4429
106 Ga0207692_10009678 3300025898 Bacteria 4036
107 Ga0207699_10048187 3300025906 Bacteria 2502
108 Ga0207684_10000176 3300025910 Bacteria 104968
109 Ga0207684_10000399 3300025910 Bacteria 57986
110 Ga0207684_10006210 3300025910 Bacteria 10909
111 Ga0207684_10012521 3300025910 Bacteria 7376
112 Ga0207684_10027251 3300025910 Bacteria 4870
113 Ga0207684_10168376 3300025910 Bacteria 1888
114 Ga0207707_10143166 3300025912 Bacteria 2090
115 Ga0207695_10115562 3300025913 Bacteria 2658
116 Ga0207693_10000202 3300025915 Bacteria 54429
117 Ga0207693_10000728 3300025915 Bacteria 29655
118 Ga0207663_10000392 3300025916 Bacteria 18994
119 Ga0207663_10064885 3300025916 Bacteria 2332
120 Ga0207660_10172414 3300025917 Bacteria 1675
121 Ga0207657_10039392 3300025919 Bacteria 4201
122 Ga0207652_10058276 3300025921 Bacteria 3328
123 Ga0207646_10001337 3300025922 Bacteria 30623
124 Ga0207646_10010175 3300025922 Bacteria 9215
125 Ga0207646_10039107 3300025922 Bacteria 4268
126 Ga0207646_10180785 3300025922 Unclassified 1905
127 Ga0207681_10046645 3300025923 Bacteria 2915
128 Ga0207700_10001159 3300025928 Bacteria 15133
129 Ga0207700_10002031 3300025928 Bacteria 11563
130 Ga0207664_10114433 3300025929 Unclassified 2248
131 Ga0207644_10052365 3300025931 Bacteria 2933
132 Ga0207706_10140855 3300025933 Bacteria 2122
133 Ga0207669_10236691 3300025937 Bacteria 1351
134 Ga0207665_10012471 3300025939 Bacteria 5581
135 Ga0207667_10284464 3300025949 Bacteria 1690
136 Ga0207674_10006379 3300026116 Bacteria 13883
137 Ga0207428_10169476 3300027907 Bacteria 1654
138 Ga0268265_10114349 3300028380 Bacteria 2210
139 Ga0265338_10022846 3300028800 Bacteria 6454
140 Ga0265762_1000121 3300030760 Bacteria 11650
141 Ga0265760_10002303 3300031090 Bacteria 5573
142 Ga0265760_10011231 3300031090 Bacteria 2560
143 Ga0265339_10045164 3300031249 Bacteria 2426
144 Ga0265316_10048441 3300031344 Bacteria 3354
145 Ga0307405_10064225 3300031731 Bacteria 2332
146 Ga0307413_10074451 3300031824 Bacteria 2151
147 Ga0307406_10024924 3300031901 Bacteria 3577
148 Ga0307409_100039555 3300031995 Bacteria 3501
149 Ga0307409_100079516 3300031995 Bacteria 2643
150 Ga0307409_100125630 3300031995 Bacteria 2181
151 Ga0307416_100004372 3300032002 Bacteria 8508
152 Ga0307416_100064166 3300032002 Bacteria 3012
153 Ga0307416_100077558 3300032002 Bacteria 2791
154 Ga0307414_10062317 3300032004 Unclassified 2646
155 Ga0307411_10003296 3300032005 Bacteria 7460
156 Ga0307415_100002397 3300032126 Bacteria 9345
157 Ga0307415_100102381 3300032126 Bacteria 2104
158 Ga0373936_0018070 3300035113 Unclassified 2720
159 Ga0373945_0045221 3300035116 Unclassified 1603
160 Ga0373943_0067881 3300035170 Bacteria 1799
161 Ga0373946_0053150 3300035171 Unclassified 1701
162 Ga0373924_0117670 3300035410 Unclassified 1152
163 Ga0373931_0117660 3300035691 Bacteria 1515
164 Ga0373927_0008739 3300035695 Bacteria 6804
165 Ga0373927_0174131 3300035695 Unclassified 1411
166 Ga0373947_0007813 3300035725 Bacteria 6178
167 Ga0373937_0147132 3300036401 Unclassified 2206
168 Ga0373937_0202104 3300036401 Unclassified 1868
169 Ga0373925_0008351 3300037068 Bacteria 7540
170 Ga0373925_0031987 3300037068 Bacteria 3870
171 Ga0373925_0173958 3300037068 Bacteria 1701
172 Ga0395901_0237670 3300038443 Bacteria 1901
173 Ga0436365_1302334 3300039437 Bacteria 1539
174 Ga0451577_0185367 3300042876 Bacteria 1877
175 Ga0451577_0224376 3300042876 Bacteria 1699
176 Ga0451577_0385410 3300042876 Unclassified 1272
177 Ga0466969_0000115 3300044656 Bacteria 42292
178 Ga0453683_0002200 3300044673 Bacteria 15491
179 Ga0466966_0045348 3300044684 Bacteria 2811
180 Ga0466966_0112757 3300044684 Bacteria 1675
181 Ga0466961_0031461 3300044693 Bacteria 3411
182 Ga0466961_0137583 3300044693 Bacteria 1530
183 Ga0466963_0070264 3300044694 Bacteria 2355
184 Ga0453684_0072768 3300044712 Bacteria 4337
185 Ga0453684_0294880 3300044712 Unclassified 1845
186 Ga0466957_0066464 3300044842 Bacteria 2223
187 Ga0466958_0107474 3300045836 Bacteria 1740
188 Ga0495629_0035949 3300046459 Bacteria 3499
189 Ga0495580_0004128 3300046472 Bacteria 12243
190 Ga0495582_0010448 3300046473 Bacteria 5107
191 Ga0495642_0056358 3300046528 Bacteria 1623
192 Ga0495645_0212596 3300046543 Unclassified 1305
193 Ga0495669_0012044 3300046684 Bacteria 3678
194 Ga0495604_0148924 3300047317 Bacteria 1665
195 Ga0495674_0002411 3300047319 Bacteria 18293
196 Ga0495674_0080570 3300047319 Unclassified 2794
197 Ga0496102_0014808 3300048905 Bacteria 6783
198 Ga0496103_0110348 3300048906 Bacteria 1747
199 Ga0496106_0263229 3300048909 Bacteria 1380
200 Ga0496109_0376896 3300048912 Bacteria 1340
201 Ga0496115_0009397 3300048918 Bacteria 7266
202 Ga0501031_0057987 3300049568 Bacteria 2523
203 Ga0501036_0011204 3300049572 Bacteria 7419
204 Ga0501041_0011819 3300049577 Bacteria 5166
205 Ga0501042_0088818 3300049578 Bacteria 2217
206 Ga0501043_0046758 3300049579 Bacteria 3404
207 Ga0501047_0095663 3300049581 Bacteria 2849
208 Ga0501070_0393440 3300049586 Bacteria 1122
209 Ga0501072_0142017 3300049588 Bacteria 1915
210 Ga0501075_0130934 3300049591 Bacteria 1911
211 Ga0501076_0018088 3300049592 Bacteria 5366
212 Ga0501076_0046815 3300049592 Bacteria 3418
213 Ga0501076_0225305 3300049592 Bacteria 1532
214 Ga0501077_0012371 3300049593 Bacteria 5345
215 Ga0501080_0111983 3300049742 Bacteria 2530
216 Ga0501081_0009755 3300049743 Bacteria 6258
217 Ga0501045_0036607 3300049824 Bacteria 3564
218 Ga0501045_0232899 3300049824 Bacteria 1371
219 nmdc:mga00v17_71471_c1 3300050491 Bacteria 2151
220 nmdc:mga0k408_42835_c1 3300050493 Bacteria 2075
221 nmdc:mga05p37_16816_c1 3300050507 Bacteria 8819
222 nmdc:mga05p37_199529_c1 3300050507 Bacteria 2424
223 nmdc:mga05p37_281049_c1 3300050507 Bacteria 1985
224 nmdc:mga05p37_3321_c1 3300050507 Bacteria 18762
225 nmdc:mga05p37_444477_c1 3300050507 Bacteria 1502
226 nmdc:mga05p37_60279_c1 3300050507 Bacteria 4673
227 nmdc:mga09592_179330_c1 3300050508 Bacteria 1832
228 nmdc:mga09592_17990_c1 3300050508 Bacteria 5791
229 nmdc:mga09592_45329_c1 3300050508 Bacteria 3704
230 nmdc:mga0qj67_106693_c1 3300050509 Bacteria 2260
231 nmdc:mga0qj67_119069_c1 3300050509 Bacteria 2135
232 nmdc:mga0qj67_14985_c1 3300050509 Bacteria 5865
233 nmdc:mga06r32_14134_c1 3300050510 Bacteria 7240
234 nmdc:mga06r32_1576_c1 3300050510 Bacteria 20552
235 nmdc:mga06r32_40999_c1 3300050510 Bacteria 4397
236 nmdc:mga06r32_52606_c1 3300050510 Bacteria 3900
237 nmdc:mga06r32_67251_c1 3300050510 Bacteria 3459
238 nmdc:mga08y16_414212_c1 3300050511 Bacteria 1378
239 nmdc:mga0n895_154396_c1 3300050512 Bacteria 2326
240 nmdc:mga0n895_27978_c1 3300050512 Bacteria 5359
241 nmdc:mga0n895_3803_c1 3300050512 Bacteria 12227
242 nmdc:mga0n895_419_c1 3300050512 Bacteria 28472
243 nmdc:mga0n895_559_c1 3300050512 Bacteria 25528
244 nmdc:mga0n895_56156_c1 3300050512 Bacteria 3878
245 nmdc:mga0rr50_130473_c1 3300050513 Bacteria 2012
246 nmdc:mga0rr50_21132_c1 3300050513 Bacteria 4437
247 nmdc:mga0rr50_7019_c1 3300050513 Bacteria 6913
248 nmdc:mga0rr50_84934_c1 3300050513 Bacteria 2452
249 nmdc:mga0rr50_88495_c1 3300050513 Bacteria 2406
250 nmdc:mga08x19_1502_c1 3300050514 Bacteria 14451
251 nmdc:mga08x19_205211_c1 3300050514 Bacteria 1352
252 nmdc:mga0a205_11365_c1 3300050515 Bacteria 8195
253 nmdc:mga0a205_275_c1 3300050515 Bacteria 37421
254 nmdc:mga0a205_396094_c1 3300050515 Bacteria 1245
255 nmdc:mga0a205_40830_c1 3300050515 Bacteria 4467
256 nmdc:mga0a205_886_c1 3300050515 Bacteria 24571
257 Ga0500555_014495 3300053103 Unclassified 2273
258 Ga0501084_0040571 3300054114 Bacteria 3894
259 Ga0501084_0081471 3300054114 Bacteria 2715
260 Ga0501084_0148723 3300054114 Unclassified 1973
261 Ga0501082_0009243 3300060353 Bacteria 8496
262 Ga0501082_0053632 3300060353 Bacteria 3475
263 Ga0530510_0003495 3300061734 Bacteria 10800
264 Ga0530510_0244907 3300061734 Bacteria 1335
265 2831431704 2831426010 Bacteria 8662725
266 2848702774 2848694841 Bacteria 9205737
267 2849665934 2849660919 Bacteria 8251853
268 2913913475 2913912277 Bacteria 9037797
269 nmdc:mga05p37_55482_c1
270 rootH2_10210870
271 JGI25407J50210_10003847
272 Ga0070683_100001196
273 Ga0070666_10011043
274 Ga0070680_100022151
275 Ga0070660_100051050
276 Ga0070669_100108500
277 Ga0070709_10000534
278 Ga0070714_100130793
279 Ga0070713_100000087
280 Ga0070713_100000425
281 Ga0070710_10012413
282 Ga0070710_10020561
283 Ga0070711_100001138
284 Ga0070711_100004234
285 Ga0070700_100215497
286 Ga0070694_100027280
287 Ga0070708_100001788
288 Ga0070708_100026281
289 Ga0070708_100253757
290 Ga0070662_100127692
291 Ga0070706_100000220
292 Ga0070706_100003650
293 Ga0070706_100008780
294 Ga0070706_100024642
295 Ga0070706_100026414
296 Ga0070706_100046763
297 Ga0070706_100055383
298 Ga0070707_100005857
299 Ga0070707_100007092
300 Ga0070698_100006281
301 Ga0070698_100013527
302 Ga0070698_100019288
303 Ga0070698_100236670
304 Ga0070679_100077519
305 Ga0070684_100129088
306 Ga0070697_100002333
307 Ga0070697_100040546
308 Ga0070697_100139923
309 Ga0070697_100184624
310 Ga0070672_100125545
311 Ga0070704_100026322
312 Ga0070704_100232132
313 Ga0068857_100024192
314 Ga0068864_100213622
315 Ga0068860_100153731
316 Ga0068862_100158615
317 Ga0081455_10029297
318 Ga0081538_10002724
319 Ga0081538_10014484
320 Ga0081538_10043055
321 Ga0081539_10000845
322 Ga0081539_10005411
323 Ga0070717_10246734
324 Ga0075364_10018426
325 Ga0070716_100000984
326 Ga0070716_100024251
327 Ga0070712_100000258
328 Ga0070712_100002338
329 Ga0075366_10048807
330 Ga0075428_100002904
331 Ga0075428_100141109
332 Ga0075428_100426169
333 Ga0075430_100006556
334 Ga0075431_100001857
335 Ga0075431_100002704
336 Ga0075431_100044584
337 Ga0075431_100048514
338 Ga0075431_100060292
339 Ga0075433_10000596
340 Ga0075433_10001573
341 Ga0075433_10081271
342 Ga0075433_10235299
343 Ga0075434_100001070
344 Ga0075434_100007518
345 Ga0075434_100027006
346 Ga0075434_100060469
347 Ga0075434_100085847
348 Ga0075429_100031052
349 Ga0075429_100044067
350 Ga0075429_100067201
351 Ga0075429_100130858
352 Ga0075429_100223860
353 Ga0075436_100000793
354 Ga0075436_100005335
355 Ga0075436_100010684
356 Ga0075435_100008629
357 Ga0075435_100010572
358 Ga0075435_100012918
359 Ga0075435_100127505
360 Ga0099794_10017458
361 Ga0111539_10331040
362 Ga0114129_10000146
363 Ga0114129_10000722
364 Ga0114129_10022368
365 Ga0114129_10032888
366 Ga0114129_10041614
367 Ga0114129_10085818
368 Ga0157378_10061342
369 Ga0163163_10035037
370 Ga0224570_100578
371 Ga0224572_1005959
372 Ga0228598_1000861
373 Ga0207692_10007673
374 Ga0207692_10009678
375 Ga0207699_10048187
376 Ga0207684_10000176
377 Ga0207684_10000399
378 Ga0207684_10006210
379 Ga0207684_10012521
380 Ga0207684_10027251
381 Ga0207684_10168376
382 Ga0207707_10143166
383 Ga0207695_10115562
384 Ga0207693_10000202
385 Ga0207693_10000728
386 Ga0207663_10000392
387 Ga0207663_10064885
388 Ga0207660_10172414
389 Ga0207657_10039392
390 Ga0207652_10058276
391 Ga0207646_10001337
392 Ga0207646_10010175
393 Ga0207646_10039107
394 Ga0207646_10180785
395 Ga0207681_10046645
396 Ga0207700_10001159
397 Ga0207700_10002031
398 Ga0207664_10114433
399 Ga0207644_10052365
400 Ga0207706_10140855
401 Ga0207669_10236691
402 Ga0207665_10012471
403 Ga0207667_10284464
404 Ga0207674_10006379
405 Ga0207428_10169476
406 Ga0268265_10114349
407 Ga0265338_10022846
408 Ga0265762_1000121
409 Ga0265760_10002303
410 Ga0265760_10011231
411 Ga0265339_10045164
412 Ga0265316_10048441
413 Ga0307405_10064225
414 Ga0307413_10074451
415 Ga0307406_10024924
416 Ga0307409_100039555
417 Ga0307409_100079516
418 Ga0307409_100125630
419 Ga0307416_100004372
420 Ga0307416_100064166
421 Ga0307416_100077558
422 Ga0307414_10062317
423 Ga0307411_10003296
424 Ga0307415_100002397
425 Ga0307415_100102381
426 Ga0373936_0018070
427 Ga0373945_0045221
428 Ga0373943_0067881
429 Ga0373946_0053150
430 Ga0373924_0117670
431 Ga0373931_0117660
432 Ga0373927_0008739
433 Ga0373927_0174131
434 Ga0373947_0007813
435 Ga0373937_0147132
436 Ga0373937_0202104
437 Ga0373925_0008351
438 Ga0373925_0031987
439 Ga0373925_0173958
440 Ga0395901_0237670
441 Ga0436365_1302334
442 Ga0451577_0185367
443 Ga0451577_0224376
444 Ga0451577_0385410
445 Ga0466969_0000115
446 Ga0453683_0002200
447 Ga0466966_0045348
448 Ga0466966_0112757
449 Ga0466961_0031461
450 Ga0466961_0137583
451 Ga0466963_0070264
452 Ga0453684_0072768
453 Ga0453684_0294880
454 Ga0466957_0066464
455 Ga0466958_0107474
456 Ga0495629_0035949
457 Ga0495580_0004128
458 Ga0495582_0010448
459 Ga0495642_0056358
460 Ga0495645_0212596
461 Ga0495669_0012044
462 Ga0495604_0148924
463 Ga0495674_0002411
464 Ga0495674_0080570
465 Ga0496102_0014808
466 Ga0496103_0110348
467 Ga0496106_0263229
468 Ga0496109_0376896
469 Ga0496115_0009397
470 Ga0501031_0057987
471 Ga0501036_0011204
472 Ga0501041_0011819
473 Ga0501042_0088818
474 Ga0501043_0046758
475 Ga0501047_0095663
476 Ga0501070_0393440
477 Ga0501072_0142017
478 Ga0501075_0130934
479 Ga0501076_0018088
480 Ga0501076_0046815
481 Ga0501076_0225305
482 Ga0501077_0012371
483 Ga0501080_0111983
484 Ga0501081_0009755
485 Ga0501045_0036607
486 Ga0501045_0232899
487 nmdc:mga00v17_71471_c1
488 nmdc:mga0k408_42835_c1
489 nmdc:mga05p37_16816_c1
490 nmdc:mga05p37_199529_c1
491 nmdc:mga05p37_281049_c1
492 nmdc:mga05p37_3321_c1
493 nmdc:mga05p37_444477_c1
494 nmdc:mga05p37_60279_c1
495 nmdc:mga09592_179330_c1
496 nmdc:mga09592_17990_c1
497 nmdc:mga09592_45329_c1
498 nmdc:mga0qj67_106693_c1
499 nmdc:mga0qj67_119069_c1
500 nmdc:mga0qj67_14985_c1
501 nmdc:mga06r32_14134_c1
502 nmdc:mga06r32_1576_c1
503 nmdc:mga06r32_40999_c1
504 nmdc:mga06r32_52606_c1
505 nmdc:mga06r32_67251_c1
506 nmdc:mga08y16_414212_c1
507 nmdc:mga0n895_154396_c1
508 nmdc:mga0n895_27978_c1
509 nmdc:mga0n895_3803_c1
510 nmdc:mga0n895_419_c1
511 nmdc:mga0n895_559_c1
512 nmdc:mga0n895_56156_c1
513 nmdc:mga0rr50_130473_c1
514 nmdc:mga0rr50_21132_c1
515 nmdc:mga0rr50_7019_c1
516 nmdc:mga0rr50_84934_c1
517 nmdc:mga0rr50_88495_c1
518 nmdc:mga08x19_1502_c1
519 nmdc:mga08x19_205211_c1
520 nmdc:mga0a205_11365_c1
521 nmdc:mga0a205_275_c1
522 nmdc:mga0a205_396094_c1
523 nmdc:mga0a205_40830_c1
524 nmdc:mga0a205_886_c1
525 Ga0500555_014495
526 Ga0501084_0040571
527 Ga0501084_0081471
528 Ga0501084_0148723
529 Ga0501082_0009243
530 Ga0501082_0053632
531 Ga0530510_0003495
532 Ga0530510_0244907
533 2831431704
534 2848702774
535 2849665934
536 2913913475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

259

423

0.97

PF02417

Chromate_transp

Chromate transporter

59

223

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z6n-assembly1.cif.gz_B crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.3737 17 352
7z6n-assembly1.cif.gz_B crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.3691 17 352
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.328 17 364
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.3233 17 364
8e34-assembly1.cif.gz_B cryoem structures of bae1 captured in multiple states 0.2913 8 367
ID Description Score Start End Superfamily
af_A0A1D6KWS6_515_629_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3338 10 86 1.25.40.10
af_Q6Z8Z5_190_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.32 9 115 1.25.40.10
af_B4F8Z1_389_502_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3141 9 91 1.25.40.10
af_Q6Z8Z5_190_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3 9 115 1.25.40.10
af_Q54E82_13_176_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2964 159 347 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V6RGZ9-F1-model_v4 Chromate transporter 0.9911 8 97 GO:0005886
GO:0015109
AF-A0A537J2Z7-F1-model_v4 Chromate transporter 0.9745 9 94 GO:0005886
GO:0015109
AF-A0A3C0R026-F1-model_v4 Chromate transporter 0.9703 5 90 GO:0005886
GO:0015109
AF-A0A7X6U0G7-F1-model_v4 Chromate transporter 0.9679 8 97 GO:0005886
GO:0015109
AF-A0A838IBH7-F1-model_v4 Chromate transporter 0.9657 4 90 GO:0005886
GO:0015109

Map