F375746

General Info

Members Datasets Scaffolds Average Seq Length
268 186 260 392

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0035043|Ga0495625_0035043_1870_3201
Length 443
Sequence MTYCVSAHWRVPLRTERLAKQLINKPVAFLAALSEGANRCASHGRRAVVYIPGEETMATLDTSDIDQYLGKPVDSSSLREPIATNDIRRWVHAMHYPNLLHYDPDFAAASRWGKIIAPQSICIATDDGHGAAPACVGNIPDSHLLFGGDEHWFYGPRVQAGDVISNERVPFDYVVKETKFAGPTCFQRGDNNFTNQNGELILKQRSTSIRYNKEAGSETVNTDDFEEVTWTDEEEAELIERRFQWVQMMHDLGHKERWWDDVQVGDDLPERVFGPHSIASFTTEWRAYIVNNWGTMNLRKQDLAGVGFDPAMGVLENDPDMMKIDPFQTDGAYYGPSRGHLFPGWARRIGMPRGYGYGASMGAWGIDYLAGWAGEHGMVVHCISNYRGPALTGDITIQTAEVIDKSIDDEGRHLVHVKHKMANQKGTIMATGSAEIALPKKPA

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
97 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
177 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.37
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.31
Nodule 1.87
Rhizoplane 1.49
Rhizosphere 76.49
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001882 3300001976 Bacteria 2799
2 JGI25165J46597_1000156 3300003214 Bacteria 109696
3 Ga0070670_100000340 3300005331 Bacteria 39096
4 Ga0070666_10000380 3300005335 Bacteria 27930
5 Ga0070680_100000921 3300005336 Bacteria 20818
6 Ga0070668_100015620 3300005347 Bacteria 5675
7 Ga0070669_100000013 3300005353 Bacteria 210577
8 Ga0070671_100000009 3300005355 Bacteria 206508
9 Ga0070667_100053586 3300005367 Bacteria 3404
10 Ga0070708_100002274 3300005445 Bacteria 14864
11 Ga0070708_100002339 3300005445 Bacteria 14669
12 Ga0070708_100008453 3300005445 Bacteria 8265
13 Ga0070708_100009230 3300005445 Bacteria 7953
14 Ga0070708_100027684 3300005445 Bacteria 4866
15 Ga0070708_100064787 3300005445 Bacteria 3275
16 Ga0070681_10000022 3300005458 Bacteria 116402
17 Ga0070681_10349233 3300005458 Bacteria 1389
18 Ga0070706_100003198 3300005467 Bacteria 16163
19 Ga0070706_100118541 3300005467 Bacteria 2466
20 Ga0070707_100051627 3300005468 Bacteria 3941
21 Ga0070707_100196442 3300005468 Bacteria 1967
22 Ga0070698_100042650 3300005471 Bacteria 4654
23 Ga0070699_100026881 3300005518 Bacteria 4964
24 Ga0070699_100092565 3300005518 Bacteria 2644
25 Ga0070679_100000004 3300005530 Bacteria 263662
26 Ga0068859_100000390 3300005617 Bacteria 43803
27 Ga0068864_100001666 3300005618 Bacteria 18296
28 Ga0068861_100000026 3300005719 Bacteria 69553
29 Ga0068863_100014840 3300005841 Bacteria 7489
30 Ga0068858_100029592 3300005842 Bacteria 5086
31 Ga0068860_100003383 3300005843 Bacteria 16406
32 Ga0068862_100000560 3300005844 Bacteria 38687
33 Ga0081455_10032792 3300005937 Bacteria 4676
34 Ga0081539_10017960 3300005985 Bacteria 4935
35 Ga0075365_10019742 3300006038 Bacteria 4166
36 Ga0075368_10000259 3300006042 Bacteria 15192
37 Ga0075368_10000716 3300006042 Bacteria 10141
38 Ga0075363_100019654 3300006048 Bacteria 3379
39 Ga0075367_10000044 3300006178 Bacteria 28305
40 Ga0075367_10054452 3300006178 Bacteria 2372
41 Ga0075370_10069871 3300006353 Bacteria 2008
42 Ga0075428_100000531 3300006844 Bacteria 38848
43 Ga0075430_100000093 3300006846 Bacteria 52222
44 Ga0075430_100028664 3300006846 Bacteria 4728
45 Ga0075431_100000230 3300006847 Bacteria 41872
46 Ga0075431_100168215 3300006847 Bacteria 2253
47 Ga0075429_100000020 3300006880 Bacteria 69154
48 Ga0075429_100084983 3300006880 Bacteria 2758
49 Ga0097620_100000390 3300006931 Bacteria 43803
50 Ga0079104_1005556 3300006946 Bacteria 5008
51 Ga0079104_1007540 3300006946 Bacteria 3922
52 Ga0079104_1013303 3300006946 Bacteria 2542
53 Ga0075435_100018598 3300007076 Bacteria 5290
54 Ga0105251_10018067 3300009011 Bacteria 3760
55 Ga0105247_10002789 3300009101 Bacteria 11697
56 Ga0114129_10000294 3300009147 Bacteria 57728
57 Ga0114129_10410279 3300009147 Bacteria 1784
58 Ga0105248_10018095 3300009177 Bacteria 7779
59 Ga0105248_10260714 3300009177 Bacteria 1951
60 Ga0105249_10000355 3300009553 Bacteria 45955
61 Ga0105239_10124634 3300010375 Bacteria 2863
62 Ga0157373_10054848 3300013100 Bacteria 2832
63 Ga0163163_10011716 3300014325 Bacteria 7965
64 Ga0157379_10034857 3300014968 Bacteria 4487
65 Ga0157379_10073441 3300014968 Bacteria 3062
66 Ga0224712_10037230 3300022467 Unclassified 1809
67 Ga0209233_1000213 3300025261 Bacteria 109881
68 Ga0207697_10001744 3300025315 Bacteria 11683
69 Ga0207713_1036781 3300025735 Bacteria 2095
70 Ga0207710_10004989 3300025900 Bacteria 5750
71 Ga0207680_10000480 3300025903 Bacteria 18917
72 Ga0207684_10044791 3300025910 Bacteria 3753
73 Ga0207684_10073152 3300025910 Bacteria 2911
74 Ga0207684_10147529 3300025910 Bacteria 2023
75 Ga0207707_10000129 3300025912 Bacteria 78093
76 Ga0207660_10000089 3300025917 Bacteria 49452
77 Ga0207652_10000056 3300025921 Bacteria 114479
78 Ga0207646_10038228 3300025922 Bacteria 4324
79 Ga0207646_10046055 3300025922 Bacteria 3914
80 Ga0207646_10104107 3300025922 Bacteria 2545
81 Ga0207681_10000008 3300025923 Bacteria 414329
82 Ga0207650_10006484 3300025925 Bacteria 7975
83 Ga0207644_10000006 3300025931 Bacteria 408793
84 Ga0207712_10006146 3300025961 Bacteria 7571
85 Ga0207668_10002074 3300025972 Bacteria 11682
86 Ga0207658_10008690 3300025986 Bacteria 6899
87 Ga0207703_10078932 3300026035 Bacteria 2737
88 Ga0207641_10010226 3300026088 Bacteria 7716
89 Ga0207676_10001343 3300026095 Bacteria 18286
90 Ga0207675_100000219 3300026118 Bacteria 53753
91 Ga0207675_100145469 3300026118 Bacteria 2254
92 Ga0209281_1009480 3300027111 Bacteria 2286
93 Ga0209281_1013274 3300027111 Bacteria 1783
94 Ga0209813_10000034 3300027866 Bacteria 61259
95 Ga0268265_10000171 3300028380 Bacteria 77721
96 Ga0268264_10000221 3300028381 Bacteria 111397
97 Ga0265334_10000193 3300028573 Bacteria 35275
98 Ga0307517_10095353 3300028786 Bacteria 2395
99 Ga0307511_10002326 3300030521 Bacteria 19866
100 Ga0307511_10008106 3300030521 Bacteria 10519
101 Ga0265327_10000005 3300031251 Bacteria 790146
102 Ga0265327_10058294 3300031251 Bacteria 1982
103 Ga0307513_10084890 3300031456 Bacteria 3251
104 Ga0307513_10085357 3300031456 Bacteria 3240
105 Ga0307513_10172559 3300031456 Bacteria 2038
106 Ga0307508_10000103 3300031616 Bacteria 100310
107 Ga0307508_10045310 3300031616 Bacteria 3930
108 Ga0316576_10009917 3300031727 Bacteria 6165
109 Ga0316576_10056313 3300031727 Bacteria 2871
110 Ga0316578_10004507 3300031728 Bacteria 6588
111 Ga0307405_10117194 3300031731 Bacteria 1815
112 Ga0316577_10021069 3300031733 Bacteria 3615
113 Ga0307413_10036048 3300031824 Bacteria 2844
114 Ga0307410_10001010 3300031852 Bacteria 12189
115 Ga0307409_100003895 3300031995 Bacteria 8254
116 Ga0307510_10001251 3300033180 Bacteria 27621
117 Ga0373936_0003997 3300035113 Bacteria 5556
118 Ga0373957_0054957 3300035120 Bacteria 1530
119 Ga0316574_0007532 3300035398 Bacteria 5973
120 Ga0316574_0028615 3300035398 Bacteria 3362
121 Ga0373933_0196703 3300035724 Bacteria 1289
122 Ga0373937_0010059 3300036401 Bacteria 8248
123 Ga0316582_0010473 3300036647 Bacteria 5081
124 Ga0316584_0007648 3300036712 Bacteria 7415
125 Ga0436365_1273402 3300039437 Bacteria 1332
126 Ga0451833_0298308 3300041491 Bacteria 2218
127 Ga0451849_0076498 3300041505 Unclassified 1730
128 Ga0451849_0320126 3300041505 Bacteria 1441
129 Ga0451849_0670122 3300041505 Bacteria 2101
130 Ga0451853_1734969 3300041512 Bacteria 2132
131 Ga0466966_0034250 3300044684 Bacteria 3284
132 Ga0495629_0103783 3300046459 Bacteria 1983
133 Ga0495638_0001219 3300046460 Bacteria 24403
134 Ga0495638_0002406 3300046460 Bacteria 15305
135 Ga0495638_0058132 3300046460 Bacteria 2397
136 Ga0495638_0130296 3300046460 Bacteria 1478
137 Ga0495651_0027399 3300046462 Bacteria 4438
138 Ga0495650_0000163 3300046471 Bacteria 148569
139 Ga0495596_0000443 3300046500 Bacteria 26412
140 Ga0495607_0010425 3300046501 Bacteria 6250
141 Ga0495583_0000333 3300046506 Bacteria 74698
142 Ga0495583_0000570 3300046506 Bacteria 50687
143 Ga0495583_0001513 3300046506 Bacteria 23120
144 Ga0495606_0036762 3300046507 Bacteria 3332
145 Ga0495608_0009405 3300046511 Bacteria 6832
146 Ga0495610_0000213 3300046512 Bacteria 62796
147 Ga0495610_0004777 3300046512 Bacteria 9886
148 Ga0495632_0000307 3300046519 Bacteria 47308
149 Ga0495632_0012149 3300046519 Bacteria 4978
150 Ga0495643_0000054 3300046522 Bacteria 198757
151 Ga0495648_0025621 3300046524 Bacteria 3989
152 Ga0495587_0010668 3300046536 Bacteria 5836
153 Ga0495587_0011549 3300046536 Bacteria 5592
154 Ga0495622_0001107 3300046557 Bacteria 14102
155 Ga0495633_0022756 3300046558 Bacteria 3112
156 Ga0495667_0008664 3300046559 Bacteria 6905
157 Ga0495625_0002045 3300046660 Bacteria 22685
158 Ga0495625_0002827 3300046660 Bacteria 18279
159 Ga0495625_0011761 3300046660 Bacteria 7112
160 Ga0495625_0018785 3300046660 Bacteria 5384
161 Ga0495625_0026365 3300046660 Bacteria 4393
162 Ga0495625_0035043 3300046660 Bacteria 3702
163 Ga0495657_0006036 3300046675 Bacteria 9512
164 Ga0495623_0016954 3300046679 Bacteria 4705
165 Ga0495671_0000030 3300046692 Bacteria 219127
166 Ga0495671_0029274 3300046692 Bacteria 2829
167 Ga0495600_0000175 3300046809 Bacteria 37583
168 Ga0495600_0013817 3300046809 Bacteria 5085
169 Ga0495687_050218 3300047443 Bacteria 1779
170 Ga0495675_0075735 3300047444 Bacteria 2121
171 Ga0495677_0005856 3300047445 Bacteria 4654
172 Ga0495673_0000068 3300047469 Bacteria 219127
173 Ga0495686_0034528 3300047472 Bacteria 3256
174 Ga0495686_0079265 3300047472 Bacteria 2009
175 Ga0495615_0000097 3300048090 Bacteria 25034
176 Ga0496102_0297837 3300048905 Bacteria 1520
177 Ga0496102_0371839 3300048905 Unclassified 1345
178 Ga0496110_0036183 3300048913 Bacteria 4286
179 Ga0496110_0433041 3300048913 Bacteria 1199
180 Ga0496117_0002262 3300048920 Bacteria 24865
181 Ga0496118_0001744 3300048921 Bacteria 31587
182 Ga0496121_0000009 3300048924 Bacteria 836971
183 Ga0496122_0004978 3300048925 Bacteria 16069
184 Ga0496123_0001959 3300048926 Bacteria 26743
185 Ga0496126_0045062 3300048929 Bacteria 4057
186 Ga0501031_0032541 3300049568 Bacteria 3400
187 Ga0501033_0005811 3300049570 Bacteria 9709
188 Ga0501034_0000146 3300049571 Bacteria 132818
189 Ga0501034_0003188 3300049571 Bacteria 18862
190 Ga0501036_0047468 3300049572 Bacteria 3636
191 Ga0501039_0041104 3300049575 Bacteria 3570
192 Ga0501041_0010943 3300049577 Bacteria 5355
193 Ga0501042_0040070 3300049578 Bacteria 3330
194 Ga0501043_0019709 3300049579 Bacteria 5298
195 Ga0501047_0043950 3300049581 Bacteria 4315
196 Ga0501047_0083106 3300049581 Bacteria 3078
197 Ga0501047_0158217 3300049581 Bacteria 2138
198 Ga0501048_0011094 3300049582 Bacteria 6718
199 Ga0501068_0000332 3300049584 Bacteria 23682
200 Ga0501068_0002531 3300049584 Bacteria 9703
201 Ga0501068_0073819 3300049584 Bacteria 2084
202 Ga0501069_0000712 3300049585 Bacteria 15526
203 Ga0501070_0076010 3300049586 Bacteria 2780
204 Ga0501070_0097348 3300049586 Bacteria 2434
205 Ga0501071_0002573 3300049587 Bacteria 11072
206 Ga0501072_0016638 3300049588 Bacteria 5648
207 Ga0501073_0005369 3300049589 Bacteria 9601
208 Ga0501073_0008799 3300049589 Bacteria 7468
209 Ga0501074_0005408 3300049590 Bacteria 9193
210 Ga0501074_0055057 3300049590 Bacteria 2868
211 Ga0501075_0029736 3300049591 Bacteria 4041
212 Ga0501076_0017554 3300049592 Bacteria 5440
213 Ga0501077_0006403 3300049593 Bacteria 7222
214 Ga0501080_0001188 3300049742 Bacteria 21582
215 Ga0501080_0003656 3300049742 Bacteria 13569
216 Ga0501080_0126296 3300049742 Bacteria 2369
217 Ga0501081_0006870 3300049743 Bacteria 7401
218 Ga0501083_0017068 3300049744 Bacteria 5067
219 Ga0501035_0044009 3300049822 Bacteria 4022
220 Ga0501035_0065360 3300049822 Bacteria 3231
221 Ga0501044_0002311 3300049823 Bacteria 21722
222 Ga0501044_0003315 3300049823 Bacteria 18140
223 Ga0501045_0006963 3300049824 Bacteria 7837
224 nmdc:mga0yw44_12102_c1 3300050492 Bacteria 4483
225 nmdc:mga0k408_58722_c1 3300050493 Bacteria 2234
226 nmdc:mga06z11_4_c1 3300050494 Bacteria 131352
227 nmdc:mga04h51_7_c1 3300050495 Bacteria 109425
228 nmdc:mga07m45_62987_c1 3300050496 Bacteria 2103
229 nmdc:mga07m45_853_c1 3300050496 Bacteria 13250
230 nmdc:mga05p37_690_c1 3300050507 Bacteria 37459
231 nmdc:mga05p37_80774_c1 3300050507 Bacteria 4005
232 nmdc:mga09592_468_c1 3300050508 Bacteria 30213
233 nmdc:mga09592_61464_c1 3300050508 Bacteria 3177
234 nmdc:mga0qj67_158295_c1 3300050509 Bacteria 1839
235 nmdc:mga0qj67_23441_c1 3300050509 Bacteria 4749
236 nmdc:mga0qj67_466_c1 3300050509 Bacteria 27648
237 nmdc:mga06r32_26263_c1 3300050510 Bacteria 5428
238 nmdc:mga06r32_2924_c1 3300050510 Bacteria 15318
239 nmdc:mga08y16_42979_c1 3300050511 Bacteria 4734
240 Ga0495595_0017186 3300053084 Bacteria 3110
241 Ga0495619_0028691 3300053085 Bacteria 3591
242 Ga0500643_001137 3300053087 Bacteria 15867
243 Ga0500643_011645 3300053087 Bacteria 3194
244 Ga0500566_0000405 3300053094 Bacteria 24016
245 Ga0500594_0010639 3300053118 Bacteria 2139
246 Ga0500595_000404 3300053119 Bacteria 27627
247 Ga0500559_0006666 3300053136 Bacteria 5193
248 Ga0500559_0018473 3300053136 Bacteria 2947
249 Ga0500619_002015 3300053154 Bacteria 3795
250 Ga0500622_0000842 3300053156 Bacteria 26262
251 Ga0500624_000021 3300053157 Bacteria 117511
252 Ga0500624_000036 3300053157 Bacteria 94678
253 Ga0500636_0025397 3300053177 Bacteria 3500
254 Ga0500637_0021817 3300053178 Bacteria 3481
255 Ga0501084_0000675 3300054114 Bacteria 26009
256 Ga0501084_0018796 3300054114 Bacteria 5753
257 Ga0501084_0109422 3300054114 Bacteria 2322
258 Ga0501082_0066345 3300060353 Bacteria 3108
259 Ga0530510_0004169 3300061734 Bacteria 9978
260 Ga0530510_0012486 3300061734 Bacteria 5966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0002531 Ga0501068_0002531_8609_9679 349
2 3300047472 Ga0495686_0034528 Ga0495686_0034528_2189_3244 351
3 3300053087 Ga0500643_011645 Ga0500643_011645_102_1283 363
4 3300035724 Ga0373933_0196703 Ga0373933_0196703_12_1124 368
5 3300048913 Ga0496110_0433041 Ga0496110_0433041_52_1176 372
6 3300049823 Ga0501044_0002311 Ga0501044_0002311_7564_8733 376
7 3300053154 Ga0500619_002015 Ga0500619_002015_2626_3756 376
8 3300006880 Ga0075429_100084983 Ga0075429_1000849832 377
9 3300050508 nmdc:mga09592_61464_c1 nmdc:mga09592_61464_c1_1276_2421 377
10 3300048905 Ga0496102_0371839 Ga0496102_0371839_157_1320 380
11 3300049581 Ga0501047_0043950 Ga0501047_0043950_1592_2758 380
12 3300049822 Ga0501035_0044009 Ga0501035_0044009_432_1598 380
13 3300005458 Ga0070681_10349233 Ga0070681_103492331 381
14 3300030521 Ga0307511_10008106 Ga0307511_1000810611 381
15 3300005445 Ga0070708_100009230 Ga0070708_1000092303 382
16 3300022467 Ga0224712_10037230 Ga0224712_100372302 382
17 3300031852 Ga0307410_10001010 Ga0307410_1000101010 382
18 3300031995 Ga0307409_100003895 Ga0307409_1000038952 382
19 3300054114 Ga0501084_0109422 Ga0501084_0109422_412_1581 382
20 3300061734 Ga0530510_0012486 Ga0530510_0012486_2385_3554 382
21 3300005336 Ga0070680_100000921 Ga0070680_1000009212 383
22 3300005445 Ga0070708_100002274 Ga0070708_1000022743 383
23 3300005445 Ga0070708_100002339 Ga0070708_1000023392 383
24 3300005445 Ga0070708_100008453 Ga0070708_1000084538 383
25 3300005445 Ga0070708_100027684 Ga0070708_1000276842 383
26 3300005458 Ga0070681_10000022 Ga0070681_1000002213 383
27 3300005467 Ga0070706_100003198 Ga0070706_10000319810 383
28 3300005467 Ga0070706_100118541 Ga0070706_1001185412 383
29 3300005468 Ga0070707_100196442 Ga0070707_1001964422 383
30 3300005530 Ga0070679_100000004 Ga0070679_10000000456 383
31 3300006178 Ga0075367_10054452 Ga0075367_100544521 383
32 3300007076 Ga0075435_100018598 Ga0075435_1000185982 383
33 3300013100 Ga0157373_10054848 Ga0157373_100548483 383
34 3300025910 Ga0207684_10073152 Ga0207684_100731522 383
35 3300025910 Ga0207684_10147529 Ga0207684_101475292 383
36 3300025912 Ga0207707_10000129 Ga0207707_1000012955 383
37 3300025917 Ga0207660_10000089 Ga0207660_1000008929 383
38 3300025921 Ga0207652_10000056 Ga0207652_1000005658 383
39 3300025922 Ga0207646_10038228 Ga0207646_100382281 383
40 3300025922 Ga0207646_10104107 Ga0207646_101041073 383
41 3300031727 Ga0316576_10056313 Ga0316576_100563132 383
42 3300035120 Ga0373957_0054957 Ga0373957_0054957_104_1273 383
43 3300036401 Ga0373937_0010059 Ga0373937_0010059_4201_5370 383
44 3300046462 Ga0495651_0027399 Ga0495651_0027399_1995_3164 383
45 3300046511 Ga0495608_0009405 Ga0495608_0009405_25_1194 383
46 3300046536 Ga0495587_0010668 Ga0495587_0010668_4187_5356 383
47 3300046559 Ga0495667_0008664 Ga0495667_0008664_2754_3923 383
48 3300046675 Ga0495657_0006036 Ga0495657_0006036_3652_4821 383
49 3300046679 Ga0495623_0016954 Ga0495623_0016954_1900_3069 383
50 3300046809 Ga0495600_0013817 Ga0495600_0013817_698_1867 383
51 3300047444 Ga0495675_0075735 Ga0495675_0075735_285_1454 383
52 3300053084 Ga0495595_0017186 Ga0495595_0017186_1088_2257 383
53 3300053085 Ga0495619_0028691 Ga0495619_0028691_276_1445 383
54 3300053094 Ga0500566_0000405 Ga0500566_0000405_17131_18297 383
55 iso_pu_bacteria 2510917021 2511128197 383
56 3300006946 Ga0079104_1005556 Ga0079104_10055564 384
57 3300027111 Ga0209281_1013274 Ga0209281_10132742 384
58 3300031251 Ga0265327_10000005 Ga0265327_10000005702 384
59 iso_pu_bacteria 2512564014 2512642218 384
60 3300006038 Ga0075365_10019742 Ga0075365_100197422 385
61 3300031824 Ga0307413_10036048 Ga0307413_100360482 385
62 3300046558 Ga0495633_0022756 Ga0495633_0022756_467_1624 385
63 3300048905 Ga0496102_0297837 Ga0496102_0297837_298_1476 385
64 3300049581 Ga0501047_0083106 Ga0501047_0083106_1140_2303 385
65 3300049585 Ga0501069_0000712 Ga0501069_0000712_5330_6520 385
66 3300049587 Ga0501071_0002573 Ga0501071_0002573_260_1450 385
67 3300049589 Ga0501073_0008799 Ga0501073_0008799_1154_2344 385
68 3300049590 Ga0501074_0055057 Ga0501074_0055057_1302_2519 385
69 3300049742 Ga0501080_0003656 Ga0501080_0003656_11661_12851 385
70 3300049823 Ga0501044_0003315 Ga0501044_0003315_13632_14795 385
71 3300050492 nmdc:mga0yw44_12102_c1 nmdc:mga0yw44_12102_c1_1892_3067 385
72 3300053157 Ga0500624_000036 Ga0500624_000036_32783_33940 385
73 3300054114 Ga0501084_0000675 Ga0501084_0000675_1726_2916 385
74 iso_pu_bacteria 2512564014 2512644845 385
75 3300049568 Ga0501031_0032541 Ga0501031_0032541_845_2050 386
76 3300049570 Ga0501033_0005811 Ga0501033_0005811_5255_6460 386
77 3300049572 Ga0501036_0047468 Ga0501036_0047468_1166_2368 386
78 3300049575 Ga0501039_0041104 Ga0501039_0041104_1663_2868 386
79 3300049577 Ga0501041_0010943 Ga0501041_0010943_2915_4120 386
80 3300049578 Ga0501042_0040070 Ga0501042_0040070_767_1969 386
81 3300049582 Ga0501048_0011094 Ga0501048_0011094_3086_4291 386
82 3300049584 Ga0501068_0073819 Ga0501068_0073819_656_1858 386
83 3300049586 Ga0501070_0076010 Ga0501070_0076010_177_1358 386
84 3300049586 Ga0501070_0097348 Ga0501070_0097348_1066_2271 386
85 3300049591 Ga0501075_0029736 Ga0501075_0029736_2119_3321 386
86 3300049592 Ga0501076_0017554 Ga0501076_0017554_1153_2358 386
87 3300049593 Ga0501077_0006403 Ga0501077_0006403_1862_3067 386
88 3300049742 Ga0501080_0126296 Ga0501080_0126296_172_1377 386
89 3300049743 Ga0501081_0006870 Ga0501081_0006870_3335_4537 386
90 3300049744 Ga0501083_0017068 Ga0501083_0017068_1530_2723 386
91 3300049822 Ga0501035_0065360 Ga0501035_0065360_1767_2969 386
92 3300049824 Ga0501045_0006963 Ga0501045_0006963_2259_3464 386
93 3300054114 Ga0501084_0018796 Ga0501084_0018796_1797_2999 386
94 3300060353 Ga0501082_0066345 Ga0501082_0066345_727_1932 386
95 3300061734 Ga0530510_0004169 Ga0530510_0004169_5842_7047 386
96 iso_pu_bacteria 2512564014 2512642650 386
97 3300005985 Ga0081539_10017960 Ga0081539_100179604 387
98 3300006846 Ga0075430_100028664 Ga0075430_1000286645 387
99 3300006946 Ga0079104_1007540 Ga0079104_10075403 387
100 3300009011 Ga0105251_10018067 Ga0105251_100180672 387
101 3300009101 Ga0105247_10002789 Ga0105247_100027894 387
102 3300009147 Ga0114129_10410279 Ga0114129_104102791 387
103 3300009177 Ga0105248_10260714 Ga0105248_102607142 387
104 3300009553 Ga0105249_10000355 Ga0105249_1000035545 387
105 3300014325 Ga0163163_10011716 Ga0163163_100117166 387
106 3300014968 Ga0157379_10034857 Ga0157379_100348574 387
107 3300026118 Ga0207675_100145469 Ga0207675_1001454692 387
108 3300035113 Ga0373936_0003997 Ga0373936_0003997_1374_2537 387
109 3300035398 Ga0316574_0028615 Ga0316574_0028615_1754_2917 387
110 3300044684 Ga0466966_0034250 Ga0466966_0034250_2057_3274 387
111 3300046460 Ga0495638_0130296 Ga0495638_0130296_60_1292 387
112 3300046500 Ga0495596_0000443 Ga0495596_0000443_5513_6676 387
113 3300046501 Ga0495607_0010425 Ga0495607_0010425_3462_4625 387
114 3300046507 Ga0495606_0036762 Ga0495606_0036762_1681_2844 387
115 3300046519 Ga0495632_0012149 Ga0495632_0012149_1353_2516 387
116 3300046660 Ga0495625_0011761 Ga0495625_0011761_5927_7090 387
117 3300046660 Ga0495625_0035043 Ga0495625_0035043_1870_3201 387
118 3300048090 Ga0495615_0000097 Ga0495615_0000097_5403_6566 387
119 3300048925 Ga0496122_0004978 Ga0496122_0004978_14802_15965 387
120 3300048926 Ga0496123_0001959 Ga0496123_0001959_830_1993 387
121 3300050493 nmdc:mga0k408_58722_c1 nmdc:mga0k408_58722_c1_335_1498 387
122 3300050496 nmdc:mga07m45_62987_c1 nmdc:mga07m45_62987_c1_171_1334 387
123 3300050496 nmdc:mga07m45_853_c1 nmdc:mga07m45_853_c1_4959_6122 387
124 3300050507 nmdc:mga05p37_80774_c1 nmdc:mga05p37_80774_c1_511_1707 387
125 3300050509 nmdc:mga0qj67_23441_c1 nmdc:mga0qj67_23441_c1_1158_2339 387
126 3300053156 Ga0500622_0000842 Ga0500622_0000842_10982_12145 387
127 3300006042 Ga0075368_10000259 Ga0075368_100002593 388
128 3300006048 Ga0075363_100019654 Ga0075363_1000196543 388
129 3300006178 Ga0075367_10000044 Ga0075367_1000004426 388
130 3300006844 Ga0075428_100000531 Ga0075428_10000053111 388
131 3300006846 Ga0075430_100000093 Ga0075430_1000000937 388
132 3300006847 Ga0075431_100000230 Ga0075431_10000023032 388
133 3300006880 Ga0075429_100000020 Ga0075429_10000002033 388
134 3300006946 Ga0079104_1013303 Ga0079104_10133032 388
135 3300009147 Ga0114129_10000294 Ga0114129_1000029422 388
136 3300027111 Ga0209281_1009480 Ga0209281_10094802 388
137 3300027866 Ga0209813_10000034 Ga0209813_100000346 388
138 3300028573 Ga0265334_10000193 Ga0265334_1000019312 388
139 3300028786 Ga0307517_10095353 Ga0307517_100953532 388
140 3300030521 Ga0307511_10002326 Ga0307511_100023264 388
141 3300031456 Ga0307513_10085357 Ga0307513_100853573 388
142 3300039437 Ga0436365_1273402 Ga0436365_1273402_73_1239 388
143 3300041491 Ga0451833_0298308 Ga0451833_0298308_959_2125 388
144 3300041505 Ga0451849_0076498 Ga0451849_0076498_78_1253 388
145 3300041505 Ga0451849_0320126 Ga0451849_0320126_232_1398 388
146 3300041512 Ga0451853_1734969 Ga0451853_1734969_633_1808 388
147 3300046512 Ga0495610_0000213 Ga0495610_0000213_44746_45912 388
148 3300046512 Ga0495610_0004777 Ga0495610_0004777_5044_6231 388
149 3300046522 Ga0495643_0000054 Ga0495643_0000054_24775_25941 388
150 3300046660 Ga0495625_0002827 Ga0495625_0002827_6798_7964 388
151 3300047443 Ga0495687_050218 Ga0495687_050218_181_1347 388
152 3300050494 nmdc:mga06z11_4_c1 nmdc:mga06z11_4_c1_2271_3443 388
153 3300050495 nmdc:mga04h51_7_c1 nmdc:mga04h51_7_c1_104550_105722 388
154 3300050507 nmdc:mga05p37_690_c1 nmdc:mga05p37_690_c1_11247_12452 388
155 3300050508 nmdc:mga09592_468_c1 nmdc:mga09592_468_c1_19802_21007 388
156 3300050509 nmdc:mga0qj67_466_c1 nmdc:mga0qj67_466_c1_23711_24916 388
157 3300050510 nmdc:mga06r32_2924_c1 nmdc:mga06r32_2924_c1_12201_13406 388
158 3300053178 Ga0500637_0021817 Ga0500637_0021817_1874_3043 388
159 3300005468 Ga0070707_100051627 Ga0070707_1000516273 389
160 3300005471 Ga0070698_100042650 Ga0070698_1000426502 389
161 3300005518 Ga0070699_100026881 Ga0070699_1000268814 389
162 3300005518 Ga0070699_100092565 Ga0070699_1000925652 389
163 3300005937 Ga0081455_10032792 Ga0081455_100327923 389
164 3300006847 Ga0075431_100168215 Ga0075431_1001682152 389
165 3300009177 Ga0105248_10018095 Ga0105248_100180958 389
166 3300010375 Ga0105239_10124634 Ga0105239_101246343 389
167 3300014968 Ga0157379_10073441 Ga0157379_100734412 389
168 3300025910 Ga0207684_10044791 Ga0207684_100447912 389
169 3300025922 Ga0207646_10046055 Ga0207646_100460554 389
170 3300031251 Ga0265327_10058294 Ga0265327_100582942 389
171 3300031456 Ga0307513_10084890 Ga0307513_100848903 389
172 3300031616 Ga0307508_10045310 Ga0307508_100453103 389
173 3300031727 Ga0316576_10009917 Ga0316576_100099173 389
174 3300031728 Ga0316578_10004507 Ga0316578_100045075 389
175 3300031731 Ga0307405_10117194 Ga0307405_101171942 389
176 3300031733 Ga0316577_10021069 Ga0316577_100210693 389
177 3300035398 Ga0316574_0007532 Ga0316574_0007532_1968_3173 389
178 3300036647 Ga0316582_0010473 Ga0316582_0010473_308_1513 389
179 3300036712 Ga0316584_0007648 Ga0316584_0007648_2148_3353 389
180 3300041505 Ga0451849_0670122 Ga0451849_0670122_10_1185 389
181 3300046460 Ga0495638_0001219 Ga0495638_0001219_2577_3746 389
182 3300046460 Ga0495638_0002406 Ga0495638_0002406_2662_3831 389
183 3300046660 Ga0495625_0002045 Ga0495625_0002045_9886_11055 389
184 3300046660 Ga0495625_0018785 Ga0495625_0018785_2975_4144 389
185 3300048913 Ga0496110_0036183 Ga0496110_0036183_679_1890 389
186 3300048920 Ga0496117_0002262 Ga0496117_0002262_15008_16177 389
187 3300048921 Ga0496118_0001744 Ga0496118_0001744_14495_15664 389
188 3300048924 Ga0496121_0000009 Ga0496121_0000009_202549_203718 389
189 3300048929 Ga0496126_0045062 Ga0496126_0045062_2536_3747 389
190 3300049571 Ga0501034_0000146 Ga0501034_0000146_30981_32183 389
191 3300049571 Ga0501034_0003188 Ga0501034_0003188_14576_15814 389
192 3300049579 Ga0501043_0019709 Ga0501043_0019709_3673_4887 389
193 3300049584 Ga0501068_0000332 Ga0501068_0000332_4299_5501 389
194 3300049588 Ga0501072_0016638 Ga0501072_0016638_3742_4944 389
195 3300049589 Ga0501073_0005369 Ga0501073_0005369_1474_2676 389
196 3300049590 Ga0501074_0005408 Ga0501074_0005408_3882_5084 389
197 3300049742 Ga0501080_0001188 Ga0501080_0001188_3608_4810 389
198 3300050509 nmdc:mga0qj67_158295_c1 nmdc:mga0qj67_158295_c1_49_1260 389
199 3300050510 nmdc:mga06r32_26263_c1 nmdc:mga06r32_26263_c1_1087_2298 389
200 3300050511 nmdc:mga08y16_42979_c1 nmdc:mga08y16_42979_c1_1957_3168 389
201 3300053136 Ga0500559_0018473 Ga0500559_0018473_473_1642 389
202 3300001976 JGI24752J21851_1001882 JGI24752J21851_10018822 390
203 3300003214 JGI25165J46597_1000156 JGI25165J46597_100015651 390
204 3300005331 Ga0070670_100000340 Ga0070670_1000003408 390
205 3300005335 Ga0070666_10000380 Ga0070666_1000038011 390
206 3300005347 Ga0070668_100015620 Ga0070668_1000156206 390
207 3300005353 Ga0070669_100000013 Ga0070669_10000001388 390
208 3300005355 Ga0070671_100000009 Ga0070671_100000009135 390
209 3300005367 Ga0070667_100053586 Ga0070667_1000535865 390
210 3300005445 Ga0070708_100064787 Ga0070708_1000647872 390
211 3300005617 Ga0068859_100000390 Ga0068859_10000039020 390
212 3300005618 Ga0068864_100001666 Ga0068864_10000166621 390
213 3300005719 Ga0068861_100000026 Ga0068861_10000002617 390
214 3300005841 Ga0068863_100014840 Ga0068863_1000148409 390
215 3300005842 Ga0068858_100029592 Ga0068858_1000295927 390
216 3300005843 Ga0068860_100003383 Ga0068860_10000338316 390
217 3300005844 Ga0068862_100000560 Ga0068862_10000056030 390
218 3300006042 Ga0075368_10000716 Ga0075368_100007167 390
219 3300006178 Ga0075367_10000044 Ga0075367_1000004410 390
220 3300006353 Ga0075370_10069871 Ga0075370_100698713 390
221 3300006931 Ga0097620_100000390 Ga0097620_10000039029 390
222 3300025261 Ga0209233_1000213 Ga0209233_100021359 390
223 3300025315 Ga0207697_10001744 Ga0207697_100017443 390
224 3300025735 Ga0207713_1036781 Ga0207713_10367812 390
225 3300025900 Ga0207710_10004989 Ga0207710_100049894 390
226 3300025903 Ga0207680_10000480 Ga0207680_100004809 390
227 3300025923 Ga0207681_10000008 Ga0207681_10000008142 390
228 3300025925 Ga0207650_10006484 Ga0207650_100064843 390
229 3300025931 Ga0207644_10000006 Ga0207644_10000006132 390
230 3300025961 Ga0207712_10006146 Ga0207712_100061463 390
231 3300025972 Ga0207668_10002074 Ga0207668_1000207412 390
232 3300025986 Ga0207658_10008690 Ga0207658_100086907 390
233 3300026035 Ga0207703_10078932 Ga0207703_100789322 390
234 3300026088 Ga0207641_10010226 Ga0207641_100102266 390
235 3300026095 Ga0207676_10001343 Ga0207676_1000134321 390
236 3300026118 Ga0207675_100000219 Ga0207675_10000021928 390
237 3300027866 Ga0209813_10000034 Ga0209813_1000003421 390
238 3300028380 Ga0268265_10000171 Ga0268265_1000017148 390
239 3300028381 Ga0268264_10000221 Ga0268264_1000022150 390
240 3300031456 Ga0307513_10172559 Ga0307513_101725591 390
241 3300031616 Ga0307508_10000103 Ga0307508_1000010381 390
242 3300033180 Ga0307510_10001251 Ga0307510_1000125122 390
243 3300046459 Ga0495629_0103783 Ga0495629_0103783_287_1459 390
244 3300046460 Ga0495638_0058132 Ga0495638_0058132_786_1958 390
245 3300046471 Ga0495650_0000163 Ga0495650_0000163_77183_78355 390
246 3300046506 Ga0495583_0000333 Ga0495583_0000333_34539_35711 390
247 3300046506 Ga0495583_0000570 Ga0495583_0000570_36081_37253 390
248 3300046506 Ga0495583_0001513 Ga0495583_0001513_11824_12996 390
249 3300046519 Ga0495632_0000307 Ga0495632_0000307_42976_44148 390
250 3300046524 Ga0495648_0025621 Ga0495648_0025621_836_2008 390
251 3300046536 Ga0495587_0011549 Ga0495587_0011549_4051_5223 390
252 3300046557 Ga0495622_0001107 Ga0495622_0001107_7166_8338 390
253 3300046660 Ga0495625_0026365 Ga0495625_0026365_43_1215 390
254 3300046692 Ga0495671_0000030 Ga0495671_0000030_204521_205693 390
255 3300046692 Ga0495671_0029274 Ga0495671_0029274_560_1732 390
256 3300046809 Ga0495600_0000175 Ga0495600_0000175_10751_11923 390
257 3300047445 Ga0495677_0005856 Ga0495677_0005856_198_1370 390
258 3300047469 Ga0495673_0000068 Ga0495673_0000068_204521_205693 390
259 3300047472 Ga0495686_0079265 Ga0495686_0079265_20_1192 390
260 3300049581 Ga0501047_0158217 Ga0501047_0158217_164_1411 390
261 3300050494 nmdc:mga06z11_4_c1 nmdc:mga06z11_4_c1_20388_21560 390
262 3300050495 nmdc:mga04h51_7_c1 nmdc:mga04h51_7_c1_86433_87605 390
263 3300053087 Ga0500643_001137 Ga0500643_001137_5411_6583 390
264 3300053118 Ga0500594_0010639 Ga0500594_0010639_928_2100 390
265 3300053119 Ga0500595_000404 Ga0500595_000404_8487_9659 390
266 3300053136 Ga0500559_0006666 Ga0500559_0006666_2001_3173 390
267 3300053157 Ga0500624_000021 Ga0500624_000021_4876_6048 390
268 3300053177 Ga0500636_0025397 Ga0500636_0025397_984_2156 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

69

204

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9312 324 384
4xy5-assembly1.cif.gz_A crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 0.904 324 388
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.9039 324 386
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9026 324 386
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9018 324 386
ID Description Score Start End Superfamily
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9211 324 386 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.904 324 388 3.10.129.10
5eo2C01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9019 324 384 3.10.129.10
af_P0ADP2_3_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9017 323 385 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8999 324 386 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A0S6WYT9-F1-model_v4 Hypothetical conserved protein 0.9878 41 390
AF-A0A346MW00-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9859 1 388
AF-A0A346MW00-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9834 1 388
AF-A0A356ISF5-F1-model_v4 MaoC-like domain-containing protein 0.9805 279 388
AF-A0A356ISF5-F1-model_v4 MaoC-like domain-containing protein 0.9718 279 388

Feature Viewer

pLDDT pTM Quality
92.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map