F375690

General Info

Members Datasets Scaffolds Average Seq Length
268 108 534 229

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0251678|Ga0453683_0251678_106_843
Length 245
Sequence MQAQTKKFNNSKKKAMENRIVRILLAEDDENLGVLLKEYLQAKDYEVDLYKDGEKAYKGFQNKYYDICVLDVMMPLKDGFTLARDIRMSDSTMPILFLTAKSMKEDVIEGFSLGADDYMTKPFSIEELLMRLEAILRRTRKDSVTTAQSIFQVGKYTFDAMKQTLQLGDEVRKLTTKESELLKYLTVNKNAILDRNFALKTIWVDDSYFNARSMDVYITKLRKYLKEDPSIEIINVRGKGFKLIF

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
52 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
66 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
67 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
78 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
81 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
82 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
101 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
102 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
103 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
104 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
105 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
106 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
107 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
108 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 3.73
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 0
Rhizoplane 0.75
Rhizosphere 80.6
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0251678 3300044673 Bacteria 1126
2 JGI25162J39368_1000008 3300002737 Bacteria 397212
3 JGI25162J39368_1000097 3300002737 Bacteria 96520
4 JGI25162J39368_1000316 3300002737 Bacteria 42808
5 JGI25164J39214_1001071 3300002772 Bacteria 8106
6 JGI25165J46597_1000305 3300003214 Bacteria 61229
7 rootH2_10301277 3300003320 Bacteria 2684
8 rootH1_10006108 3300003323 Bacteria 45232
9 rootH1_10034610 3300003323 Bacteria 5825
10 rootH1_10091970 3300003323 Bacteria 3033
11 Ga0055536_1004560 3300003781 Bacteria 7036
12 Ga0065165_1000097 3300005262 Bacteria 144227
13 Ga0065704_10072443 3300005289 Bacteria 8520
14 Ga0065704_10134677 3300005289 Bacteria 1585
15 Ga0068869_100423856 3300005334 Bacteria 1098
16 Ga0068868_100021896 3300005338 Bacteria 4819
17 Ga0070674_100133682 3300005356 Bacteria 1853
18 Ga0070679_100448362 3300005530 Unclassified 1235
19 Ga0068853_100074445 3300005539 Bacteria 2963
20 Ga0068855_100292117 3300005563 Bacteria 1807
21 Ga0068856_100023318 3300005614 Bacteria 6016
22 Ga0068859_101006233 3300005617 Bacteria 915
23 Ga0070716_100070351 3300006173 Bacteria 2054
24 Ga0075366_10000325 3300006195 Bacteria 21814
25 Ga0075366_10003988 3300006195 Bacteria 7884
26 Ga0097620_101006278 3300006931 Bacteria 915
27 Ga0105240_10012083 3300009093 Bacteria 11965
28 Ga0105240_10036721 3300009093 Bacteria 6301
29 Ga0105240_10421455 3300009093 Bacteria 1500
30 Ga0105241_10010394 3300009174 Bacteria 6830
31 Ga0105241_10107374 3300009174 Unclassified 2229
32 Ga0105237_10008869 3300009545 Bacteria 10839
33 Ga0105237_10015239 3300009545 Bacteria 8009
34 Ga0105237_10026198 3300009545 Bacteria 5959
35 Ga0105238_10076317 3300009551 Bacteria 3343
36 Ga0105239_10000522 3300010375 Bacteria 55530
37 Ga0105239_10000821 3300010375 Bacteria 44186
38 Ga0105239_10005049 3300010375 Bacteria 15589
39 Ga0157371_10149280 3300013102 Bacteria 1667
40 Ga0157371_10673462 3300013102 Bacteria 773
41 Ga0157370_10026477 3300013104 Bacteria 5726
42 Ga0157370_10059941 3300013104 Bacteria 3615
43 Ga0157370_10106495 3300013104 Bacteria 2624
44 Ga0157374_10240391 3300013296 Bacteria 1781
45 Ga0157378_10007182 3300013297 Bacteria 9727
46 Ga0163162_11033460 3300013306 Bacteria 930
47 Ga0157375_10110653 3300013308 Bacteria 2844
48 Ga0163161_10076939 3300017792 Bacteria 2450
49 Ga0207427_101238 3300025231 Bacteria 9791
50 Ga0209437_100026 3300025233 Bacteria 542698
51 Ga0209437_100030 3300025233 Bacteria 532466
52 Ga0209233_1000206 3300025261 Bacteria 117820
53 Ga0209455_1000779 3300025272 Bacteria 17830
54 Ga0209676_1000191 3300025292 Bacteria 139979
55 Ga0209050_1029133 3300025298 Bacteria 1774
56 Ga0207647_10314827 3300025904 Bacteria 889
57 Ga0207654_10546440 3300025911 Bacteria 822
58 Ga0207695_10010661 3300025913 Bacteria 11226
59 Ga0207671_10006327 3300025914 Bacteria 10569
60 Ga0207671_10421960 3300025914 Bacteria 1061
61 Ga0207652_10535998 3300025921 Unclassified 1053
62 Ga0207665_10096461 3300025939 Bacteria 2057
63 Ga0207667_10257976 3300025949 Bacteria 1783
64 Ga0207667_10544346 3300025949 Bacteria 1174
65 Ga0265334_10007244 3300028573 Bacteria 4758
66 Ga0265323_10000668 3300028653 Bacteria 18669
67 Ga0307517_10248099 3300028786 Bacteria 1048
68 Ga0307515_10000427 3300028794 Bacteria 101325
69 Ga0307515_10001800 3300028794 Bacteria 47827
70 Ga0265338_10001369 3300028800 Bacteria 39627
71 Ga0265338_10010120 3300028800 Bacteria 11134
72 Ga0265338_10192569 3300028800 Bacteria 1544
73 Ga0265338_10257044 3300028800 Bacteria 1286
74 Ga0316177_1175435 3300030731 Bacteria 14034
75 Ga0316176_1083896 3300030732 Bacteria 6412
76 Ga0265330_10064791 3300031235 Bacteria 1587
77 Ga0265327_10000031 3300031251 Bacteria 325718
78 Ga0265327_10001618 3300031251 Bacteria 27247
79 Ga0265327_10010995 3300031251 Bacteria 6296
80 Ga0265316_10001134 3300031344 Bacteria 28899
81 Ga0265316_10003506 3300031344 Bacteria 15837
82 Ga0265316_10021454 3300031344 Bacteria 5470
83 Ga0265316_10129068 3300031344 Bacteria 1905
84 Ga0265316_10133326 3300031344 Bacteria 1870
85 Ga0265316_10428804 3300031344 Bacteria 950
86 Ga0307509_10025130 3300031507 Bacteria 6657
87 Ga0316579_10078092 3300031691 Bacteria 1574
88 Ga0265342_10060614 3300031712 Bacteria 2231
89 Ga0316576_10088216 3300031727 Bacteria 2309
90 Ga0316576_10106403 3300031727 Bacteria 2100
91 Ga0316576_10160137 3300031727 Bacteria 1697
92 Ga0316576_10163325 3300031727 Bacteria 1680
93 Ga0316576_10506739 3300031727 Bacteria 887
94 Ga0316578_10020583 3300031728 Bacteria 3648
95 Ga0316578_10047292 3300031728 Unclassified 2510
96 Ga0316578_10050918 3300031728 Bacteria 2424
97 Ga0316578_10072186 3300031728 Bacteria 2044
98 Ga0307405_10000002 3300031731 Bacteria 575196
99 Ga0316577_10035297 3300031733 Bacteria 2794
100 Ga0307412_10042048 3300031911 Bacteria 2966
101 Ga0307414_10048291 3300032004 Bacteria 2935
102 Ga0307414_10502595 3300032004 Bacteria 1073
103 Ga0316585_10128528 3300032137 Bacteria 835
104 Ga0316580_10046303 3300032139 Bacteria 1341
105 Ga0316593_10156943 3300032168 Bacteria 830
106 Ga0307510_10179459 3300033180 Bacteria 1683
107 Ga0316588_1005394 3300033528 Bacteria 2487
108 Ga0316574_0071199 3300035398 Bacteria 2196
109 Ga0316574_0102024 3300035398 Bacteria 1837
110 Ga0316582_0045722 3300036647 Bacteria 2757
111 Ga0316582_0143137 3300036647 Bacteria 1613
112 Ga0316584_0001670 3300036712 Bacteria 13552
113 Ga0316584_0041208 3300036712 Bacteria 3442
114 Ga0316584_0048063 3300036712 Bacteria 3188
115 Ga0316584_0091765 3300036712 Bacteria 2274
116 Ga0395899_0000025 3300037312 Bacteria 350927
117 Ga0395899_0128447 3300037312 Bacteria 1811
118 Ga0395899_0172597 3300037312 Bacteria 1522
119 Ga0395900_0009856 3300037418 Bacteria 9787
120 Ga0395900_0112411 3300037418 Bacteria 2797
121 Ga0395905_0000516 3300037471 Bacteria 52868
122 Ga0395901_0010588 3300038443 Bacteria 9342
123 Ga0400483_084047 3300039062 Bacteria 1502
124 Ga0400483_142260 3300039062 Bacteria 33614
125 Ga0400489_32566 3300039093 Bacteria 1148
126 Ga0451795_0152631 3300041456 Bacteria 1055
127 Ga0451795_0227479 3300041456 Bacteria 820
128 Ga0451852_03773 3300041508 Bacteria 957
129 Ga0451852_11136 3300041508 Bacteria 823
130 Ga0451852_19816 3300041508 Bacteria 826
131 Ga0451852_27508 3300041508 Bacteria 738
132 Ga0451852_28164 3300041508 Bacteria 1755
133 Ga0451852_38027 3300041508 Bacteria 721
134 Ga0451852_44550 3300041508 Bacteria 1547
135 Ga0451855_0081525 3300041511 Bacteria 1007
136 Ga0451855_0133183 3300041511 Bacteria 1345
137 Ga0451855_1156345 3300041511 Bacteria 1712
138 Ga0439457_023147 3300042014 Bacteria 1375
139 Ga0451577_0000043 3300042876 Bacteria 329533
140 Ga0451577_0000048 3300042876 Bacteria 309377
141 Ga0451577_0000617 3300042876 Bacteria 57184
142 Ga0451577_0007702 3300042876 Bacteria 10557
143 Ga0451577_0008957 3300042876 Bacteria 9681
144 Ga0451577_0009069 3300042876 Bacteria 9602
145 Ga0451577_0013270 3300042876 Bacteria 7721
146 Ga0451577_0014587 3300042876 Bacteria 7322
147 Ga0451577_0017144 3300042876 Bacteria 6695
148 Ga0451577_0028837 3300042876 Bacteria 5020
149 Ga0451577_0039639 3300042876 Bacteria 4233
150 Ga0451577_0050151 3300042876 Bacteria 3727
151 Ga0451577_0068209 3300042876 Bacteria 3172
152 Ga0451577_0069595 3300042876 Bacteria 3138
153 Ga0451577_0075478 3300042876 Bacteria 3006
154 Ga0451577_0094689 3300042876 Bacteria 2667
155 Ga0451577_0109423 3300042876 Unclassified 2471
156 Ga0451577_0118296 3300042876 Bacteria 2373
157 Ga0451577_0146124 3300042876 Bacteria 2126
158 Ga0451577_0148973 3300042876 Bacteria 2105
159 Ga0451577_0247580 3300042876 Bacteria 1613
160 Ga0451577_0500109 3300042876 Bacteria 1104
161 Ga0451577_0739692 3300042876 Bacteria 890
162 Ga0451577_0857500 3300042876 Bacteria 819
163 Ga0453683_0000078 3300044673 Bacteria 147056
164 Ga0453683_0000120 3300044673 Bacteria 116884
165 Ga0453683_0000126 3300044673 Bacteria 113390
166 Ga0453683_0000728 3300044673 Bacteria 33721
167 Ga0453683_0003444 3300044673 Bacteria 11654
168 Ga0453683_0004138 3300044673 Bacteria 10405
169 Ga0453683_0008690 3300044673 Bacteria 6809
170 Ga0453683_0010738 3300044673 Bacteria 6064
171 Ga0453683_0011567 3300044673 Bacteria 5813
172 Ga0453683_0068590 3300044673 Bacteria 2217
173 Ga0453683_0080323 3300044673 Bacteria 2042
174 Ga0453683_0095097 3300044673 Bacteria 1869
175 Ga0453683_0226145 3300044673 Bacteria 1190
176 Ga0453683_0384624 3300044673 Bacteria 903
177 Ga0453683_0458055 3300044673 Bacteria 825
178 Ga0453684_0000133 3300044712 Bacteria 329529
179 Ga0453684_0000143 3300044712 Bacteria 315998
180 Ga0453684_0000161 3300044712 Bacteria 298175
181 Ga0453684_0000202 3300044712 Bacteria 261894
182 Ga0453684_0000256 3300044712 Bacteria 228862
183 Ga0453684_0000547 3300044712 Bacteria 142253
184 Ga0453684_0000666 3300044712 Bacteria 122914
185 Ga0453684_0003018 3300044712 Bacteria 39143
186 Ga0453684_0003372 3300044712 Bacteria 36146
187 Ga0453684_0004089 3300044712 Bacteria 31673
188 Ga0453684_0004181 3300044712 Bacteria 31096
189 Ga0453684_0004935 3300044712 Bacteria 27197
190 Ga0453684_0005732 3300044712 Bacteria 24290
191 Ga0453684_0006648 3300044712 Bacteria 21842
192 Ga0453684_0010375 3300044712 Bacteria 15941
193 Ga0453684_0011558 3300044712 Bacteria 14761
194 Ga0453684_0013070 3300044712 Bacteria 13561
195 Ga0453684_0027175 3300044712 Bacteria 8219
196 Ga0453684_0029760 3300044712 Bacteria 7740
197 Ga0453684_0032136 3300044712 Bacteria 7355
198 Ga0453684_0035460 3300044712 Bacteria 6893
199 Ga0453684_0036625 3300044712 Bacteria 6758
200 Ga0453684_0040281 3300044712 Bacteria 6349
201 Ga0453684_0046954 3300044712 Bacteria 5734
202 Ga0453684_0053669 3300044712 Bacteria 5258
203 Ga0453684_0058822 3300044712 Bacteria 4961
204 Ga0453684_0081944 3300044712 Bacteria 4022
205 Ga0453684_0085165 3300044712 Bacteria 3928
206 Ga0453684_0094765 3300044712 Bacteria 3671
207 Ga0453684_0097642 3300044712 Bacteria 3605
208 Ga0453684_0098114 3300044712 Bacteria 3593
209 Ga0453684_0124856 3300044712 Bacteria 3100
210 Ga0453684_0138003 3300044712 Bacteria 2916
211 Ga0453684_0146175 3300044712 Bacteria 2816
212 Ga0453684_0180234 3300044712 Bacteria 2481
213 Ga0453684_0210566 3300044712 Bacteria 2260
214 Ga0453684_0289260 3300044712 Unclassified 1866
215 Ga0453684_0298930 3300044712 Bacteria 1830
216 Ga0453684_0316045 3300044712 Bacteria 1770
217 Ga0453684_0382885 3300044712 Bacteria 1579
218 Ga0453684_0756946 3300044712 Bacteria 1051
219 Ga0451576_0000002 3300045051 Bacteria 1670975
220 Ga0451576_0000059 3300045051 Bacteria 296795
221 Ga0451576_0000097 3300045051 Bacteria 220569
222 Ga0451576_0000275 3300045051 Bacteria 126175
223 Ga0451576_0000329 3300045051 Bacteria 114749
224 Ga0451576_0000348 3300045051 Bacteria 111104
225 Ga0451576_0001335 3300045051 Bacteria 42641
226 Ga0451576_0001443 3300045051 Bacteria 40486
227 Ga0451576_0002500 3300045051 Bacteria 27283
228 Ga0451576_0003763 3300045051 Bacteria 20464
229 Ga0451576_0005519 3300045051 Bacteria 15796
230 Ga0451576_0008553 3300045051 Bacteria 12001
231 Ga0451576_0030527 3300045051 Bacteria 5759
232 Ga0451576_0041355 3300045051 Bacteria 4874
233 Ga0451576_0060455 3300045051 Bacteria 3953
234 Ga0451576_0060920 3300045051 Bacteria 3936
235 Ga0451576_0079556 3300045051 Bacteria 3411
236 Ga0451576_0131644 3300045051 Bacteria 2607
237 Ga0451576_0146753 3300045051 Bacteria 2460
238 Ga0451576_0357555 3300045051 Bacteria 1529
239 Ga0495585_0001130 3300046492 Bacteria 21890
240 Ga0495606_0138518 3300046507 Bacteria 1439
241 Ga0495648_0008427 3300046524 Bacteria 8113
242 Ga0495663_0089604 3300046525 Bacteria 1001
243 Ga0495633_0000072 3300046558 Bacteria 131197
244 Ga0495668_0000009 3300046616 Bacteria 492623
245 Ga0495625_0000831 3300046660 Bacteria 42424
246 Ga0495625_0001804 3300046660 Bacteria 24594
247 Ga0495625_0026564 3300046660 Unclassified 4373
248 Ga0495646_0169945 3300046680 Bacteria 1202
249 Ga0495660_0095361 3300046810 Unclassified 1539
250 Ga0495686_0000490 3300047472 Bacteria 58423
251 Ga0495686_0036190 3300047472 Bacteria 3169
252 Ga0501308_022997 3300049128 Bacteria 793
253 Ga0495682_0026117 3300049460 Bacteria 2171
254 Ga0501225_0023726 3300049705 Bacteria 1690
255 nmdc:mga0k408_296_c1 3300050493 Bacteria 27045
256 nmdc:mga0k408_3988_c1 3300050493 Bacteria 7827
257 Ga0500635_0001727 3300053080 Bacteria 5307
258 Ga0500635_0009058 3300053080 Bacteria 2750
259 Ga0500583_0000033 3300053092 Bacteria 99894
260 Ga0500583_0000255 3300053092 Bacteria 19066
261 Ga0500608_004560 3300053122 Bacteria 5389
262 Ga0500618_000057 3300053125 Bacteria 98383
263 Ga0500564_188488 3300053138 Bacteria 855
264 Ga0500579_182560 3300053143 Bacteria 822
265 Ga0500588_0025431 3300053146 Bacteria 1646
266 2522552400 2522125168 Bacteria 7376607
267 2911139763 2911138879 Bacteria 5811561
268 Ga0453683_0251678
269 JGI25162J39368_1000008
270 JGI25162J39368_1000097
271 JGI25162J39368_1000316
272 JGI25164J39214_1001071
273 JGI25165J46597_1000305
274 rootH2_10301277
275 rootH1_10006108
276 rootH1_10034610
277 rootH1_10091970
278 Ga0055536_1004560
279 Ga0065165_1000097
280 Ga0065704_10072443
281 Ga0065704_10134677
282 Ga0068869_100423856
283 Ga0068868_100021896
284 Ga0070674_100133682
285 Ga0070679_100448362
286 Ga0068853_100074445
287 Ga0068855_100292117
288 Ga0068856_100023318
289 Ga0068859_101006233
290 Ga0070716_100070351
291 Ga0075366_10000325
292 Ga0075366_10003988
293 Ga0097620_101006278
294 Ga0105240_10012083
295 Ga0105240_10036721
296 Ga0105240_10421455
297 Ga0105241_10010394
298 Ga0105241_10107374
299 Ga0105237_10008869
300 Ga0105237_10015239
301 Ga0105237_10026198
302 Ga0105238_10076317
303 Ga0105239_10000522
304 Ga0105239_10000821
305 Ga0105239_10005049
306 Ga0157371_10149280
307 Ga0157371_10673462
308 Ga0157370_10026477
309 Ga0157370_10059941
310 Ga0157370_10106495
311 Ga0157374_10240391
312 Ga0157378_10007182
313 Ga0163162_11033460
314 Ga0157375_10110653
315 Ga0163161_10076939
316 Ga0207427_101238
317 Ga0209437_100026
318 Ga0209437_100030
319 Ga0209233_1000206
320 Ga0209455_1000779
321 Ga0209676_1000191
322 Ga0209050_1029133
323 Ga0207647_10314827
324 Ga0207654_10546440
325 Ga0207695_10010661
326 Ga0207671_10006327
327 Ga0207671_10421960
328 Ga0207652_10535998
329 Ga0207665_10096461
330 Ga0207667_10257976
331 Ga0207667_10544346
332 Ga0265334_10007244
333 Ga0265323_10000668
334 Ga0307517_10248099
335 Ga0307515_10000427
336 Ga0307515_10001800
337 Ga0265338_10001369
338 Ga0265338_10010120
339 Ga0265338_10192569
340 Ga0265338_10257044
341 Ga0316177_1175435
342 Ga0316176_1083896
343 Ga0265330_10064791
344 Ga0265327_10000031
345 Ga0265327_10001618
346 Ga0265327_10010995
347 Ga0265316_10001134
348 Ga0265316_10003506
349 Ga0265316_10021454
350 Ga0265316_10129068
351 Ga0265316_10133326
352 Ga0265316_10428804
353 Ga0307509_10025130
354 Ga0316579_10078092
355 Ga0265342_10060614
356 Ga0316576_10088216
357 Ga0316576_10106403
358 Ga0316576_10160137
359 Ga0316576_10163325
360 Ga0316576_10506739
361 Ga0316578_10020583
362 Ga0316578_10047292
363 Ga0316578_10050918
364 Ga0316578_10072186
365 Ga0307405_10000002
366 Ga0316577_10035297
367 Ga0307412_10042048
368 Ga0307414_10048291
369 Ga0307414_10502595
370 Ga0316585_10128528
371 Ga0316580_10046303
372 Ga0316593_10156943
373 Ga0307510_10179459
374 Ga0316588_1005394
375 Ga0316574_0071199
376 Ga0316574_0102024
377 Ga0316582_0045722
378 Ga0316582_0143137
379 Ga0316584_0001670
380 Ga0316584_0041208
381 Ga0316584_0048063
382 Ga0316584_0091765
383 Ga0395899_0000025
384 Ga0395899_0128447
385 Ga0395899_0172597
386 Ga0395900_0009856
387 Ga0395900_0112411
388 Ga0395905_0000516
389 Ga0395901_0010588
390 Ga0400483_084047
391 Ga0400483_142260
392 Ga0400489_32566
393 Ga0451795_0152631
394 Ga0451795_0227479
395 Ga0451852_03773
396 Ga0451852_11136
397 Ga0451852_19816
398 Ga0451852_27508
399 Ga0451852_28164
400 Ga0451852_38027
401 Ga0451852_44550
402 Ga0451855_0081525
403 Ga0451855_0133183
404 Ga0451855_1156345
405 Ga0439457_023147
406 Ga0451577_0000043
407 Ga0451577_0000048
408 Ga0451577_0000617
409 Ga0451577_0007702
410 Ga0451577_0008957
411 Ga0451577_0009069
412 Ga0451577_0013270
413 Ga0451577_0014587
414 Ga0451577_0017144
415 Ga0451577_0028837
416 Ga0451577_0039639
417 Ga0451577_0050151
418 Ga0451577_0068209
419 Ga0451577_0069595
420 Ga0451577_0075478
421 Ga0451577_0094689
422 Ga0451577_0109423
423 Ga0451577_0118296
424 Ga0451577_0146124
425 Ga0451577_0148973
426 Ga0451577_0247580
427 Ga0451577_0500109
428 Ga0451577_0739692
429 Ga0451577_0857500
430 Ga0453683_0000078
431 Ga0453683_0000120
432 Ga0453683_0000126
433 Ga0453683_0000728
434 Ga0453683_0003444
435 Ga0453683_0004138
436 Ga0453683_0008690
437 Ga0453683_0010738
438 Ga0453683_0011567
439 Ga0453683_0068590
440 Ga0453683_0080323
441 Ga0453683_0095097
442 Ga0453683_0226145
443 Ga0453683_0384624
444 Ga0453683_0458055
445 Ga0453684_0000133
446 Ga0453684_0000143
447 Ga0453684_0000161
448 Ga0453684_0000202
449 Ga0453684_0000256
450 Ga0453684_0000547
451 Ga0453684_0000666
452 Ga0453684_0003018
453 Ga0453684_0003372
454 Ga0453684_0004089
455 Ga0453684_0004181
456 Ga0453684_0004935
457 Ga0453684_0005732
458 Ga0453684_0006648
459 Ga0453684_0010375
460 Ga0453684_0011558
461 Ga0453684_0013070
462 Ga0453684_0027175
463 Ga0453684_0029760
464 Ga0453684_0032136
465 Ga0453684_0035460
466 Ga0453684_0036625
467 Ga0453684_0040281
468 Ga0453684_0046954
469 Ga0453684_0053669
470 Ga0453684_0058822
471 Ga0453684_0081944
472 Ga0453684_0085165
473 Ga0453684_0094765
474 Ga0453684_0097642
475 Ga0453684_0098114
476 Ga0453684_0124856
477 Ga0453684_0138003
478 Ga0453684_0146175
479 Ga0453684_0180234
480 Ga0453684_0210566
481 Ga0453684_0289260
482 Ga0453684_0298930
483 Ga0453684_0316045
484 Ga0453684_0382885
485 Ga0453684_0756946
486 Ga0451576_0000002
487 Ga0451576_0000059
488 Ga0451576_0000097
489 Ga0451576_0000275
490 Ga0451576_0000329
491 Ga0451576_0000348
492 Ga0451576_0001335
493 Ga0451576_0001443
494 Ga0451576_0002500
495 Ga0451576_0003763
496 Ga0451576_0005519
497 Ga0451576_0008553
498 Ga0451576_0030527
499 Ga0451576_0041355
500 Ga0451576_0060455
501 Ga0451576_0060920
502 Ga0451576_0079556
503 Ga0451576_0131644
504 Ga0451576_0146753
505 Ga0451576_0357555
506 Ga0495585_0001130
507 Ga0495606_0138518
508 Ga0495648_0008427
509 Ga0495663_0089604
510 Ga0495633_0000072
511 Ga0495668_0000009
512 Ga0495625_0000831
513 Ga0495625_0001804
514 Ga0495625_0026564
515 Ga0495646_0169945
516 Ga0495660_0095361
517 Ga0495686_0000490
518 Ga0495686_0036190
519 Ga0501308_022997
520 Ga0495682_0026117
521 Ga0501225_0023726
522 nmdc:mga0k408_296_c1
523 nmdc:mga0k408_3988_c1
524 Ga0500635_0001727
525 Ga0500635_0009058
526 Ga0500583_0000033
527 Ga0500583_0000255
528 Ga0500608_004560
529 Ga0500618_000057
530 Ga0500564_188488
531 Ga0500579_182560
532 Ga0500588_0025431
533 2522552400
534 2911139763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

133

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9826 5 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.982 5 119
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9819 5 119
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9779 2 119
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9754 2 121
ID Description Score Start End Superfamily
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9799 5 83 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9751 2 83 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9727 2 119 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9706 5 83 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9699 5 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y1XLC9-F1-model_v4 Response regulator 0.979 1 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0G1YX15-F1-model_v4 PAS domain S-box 0.9775 1 119 GO:0000160
AF-A0A3N5E267-F1-model_v4 Response regulator 0.9732 1 119 GO:0000160
AF-A0A4R5JHH3-F1-model_v4 deleted 0.9712 1 119
AF-A0A556W6H0-F1-model_v4 Response regulator 0.9641 5 121 GO:0000160

Map