F375572

General Info

Members Datasets Scaffolds Average Seq Length
268 165 536 146

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10262111|Ga0207700_102621112
Length 165
Sequence MVGGPGVMGHGWTQMNTDKEGFDLEVKLAIYRHFAATGVRPSCEEIAAKVAGSASEVAEAYQRLRAQRVLVLEDDGVSIRMAPPFSGVATQHVVKAEGRSYFANCAWDALGIPAALGKAATVHSRCEQSMEALRLEVGVGGPAATDWVFHCLVPAAHWWDDIVFT

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
99 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 10.45
Rhizosphere 89.18
Stem 0
Stem Tuber 0
Unclassified 20.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10262111 3300025928 Bacteria 1480
2 SwRhRL3b_contig_660992 2162886006 Unclassified 971
3 Ga0065707_10001160 3300005295 Bacteria 11042
4 Ga0070670_100053523 3300005331 Bacteria 3466
5 Ga0070670_100114537 3300005331 Bacteria 2324
6 Ga0070666_10079177 3300005335 Bacteria 2244
7 Ga0070669_100007577 3300005353 Bacteria 7769
8 Ga0070675_100121687 3300005354 Bacteria 2218
9 Ga0070675_100175203 3300005354 Unclassified 1852
10 Ga0070674_100046603 3300005356 Bacteria 2967
11 Ga0070673_100089647 3300005364 Bacteria 2511
12 Ga0070667_100001518 3300005367 Bacteria 20774
13 Ga0070667_100950508 3300005367 Unclassified 801
14 Ga0070700_100281790 3300005441 Bacteria 1205
15 Ga0070694_100325825 3300005444 Unclassified 1183
16 Ga0070708_100470027 3300005445 Unclassified 1186
17 Ga0070678_100557369 3300005456 Bacteria 1018
18 Ga0068867_100014307 3300005459 Bacteria 5620
19 Ga0070685_11344601 3300005466 Bacteria 547
20 Ga0070706_100007600 3300005467 Bacteria 10144
21 Ga0070707_100086174 3300005468 Bacteria 3037
22 Ga0070707_100255327 3300005468 Unclassified 1706
23 Ga0070707_100426518 3300005468 Bacteria 1286
24 Ga0070699_100259411 3300005518 Bacteria 1554
25 Ga0070699_100368797 3300005518 Bacteria 1295
26 Ga0070699_100871224 3300005518 Unclassified 824
27 Ga0070697_101156860 3300005536 Unclassified 689
28 Ga0070672_100021633 3300005543 Bacteria 4710
29 Ga0070695_100904795 3300005545 Unclassified 713
30 Ga0070696_100364349 3300005546 Unclassified 1122
31 Ga0070693_100402186 3300005547 Bacteria 950
32 Ga0070665_100013484 3300005548 Bacteria 8222
33 Ga0070704_100531554 3300005549 Unclassified 1025
34 Ga0070704_100839170 3300005549 Bacteria 823
35 Ga0070704_101028171 3300005549 Bacteria 746
36 Ga0068855_100300219 3300005563 Bacteria 1779
37 Ga0068856_100034525 3300005614 Bacteria 4954
38 Ga0068856_101821407 3300005614 Unclassified 620
39 Ga0070702_100034151 3300005615 Bacteria 2802
40 Ga0068859_102120322 3300005617 Unclassified 620
41 Ga0068864_100080914 3300005618 Bacteria 2847
42 Ga0068864_101246034 3300005618 Unclassified 743
43 Ga0068866_10031815 3300005718 Bacteria 2545
44 Ga0068866_10550047 3300005718 Bacteria 772
45 Ga0068863_100058414 3300005841 Bacteria 3650
46 Ga0068863_100151269 3300005841 Bacteria 2221
47 Ga0068858_100038792 3300005842 Bacteria 4418
48 Ga0068860_100006675 3300005843 Bacteria 11592
49 Ga0068860_100007489 3300005843 Bacteria 10919
50 Ga0068860_100477518 3300005843 Bacteria 1242
51 Ga0068862_100087024 3300005844 Bacteria 2717
52 Ga0081539_10022385 3300005985 Bacteria 4184
53 Ga0075428_100395633 3300006844 Unclassified 1481
54 Ga0075430_101191612 3300006846 Viruses 627
55 Ga0075431_100571858 3300006847 Viruses 1116
56 Ga0075431_100760120 3300006847 Bacteria 944
57 Ga0075431_100937711 3300006847 Bacteria 834
58 Ga0075433_10000966 3300006852 Bacteria 20371
59 Ga0075433_10003958 3300006852 Bacteria 11475
60 Ga0075434_100000240 3300006871 Bacteria 38105
61 Ga0075434_100007530 3300006871 Bacteria 10082
62 Ga0075434_100241901 3300006871 Bacteria 1825
63 Ga0075429_100003980 3300006880 Bacteria 12645
64 Ga0075429_100046413 3300006880 Bacteria 3780
65 Ga0068865_100110339 3300006881 Bacteria 2028
66 Ga0068865_100268756 3300006881 Bacteria 1353
67 Ga0075436_100023222 3300006914 Plasmid 4261
68 Ga0075436_100038314 3300006914 Bacteria 3309
69 Ga0075436_100180668 3300006914 Unclassified 1491
70 Ga0075436_100541358 3300006914 Unclassified 854
71 Ga0097620_102120271 3300006931 Unclassified 620
72 Ga0075435_100003081 3300007076 Bacteria 11250
73 Ga0075435_101344631 3300007076 Unclassified 626
74 Ga0111539_10198711 3300009094 Bacteria 2339
75 Ga0111539_10269712 3300009094 Bacteria 1981
76 Ga0105247_10084715 3300009101 Bacteria 2003
77 Ga0114129_10000614 3300009147 Bacteria 44231
78 Ga0114129_10007425 3300009147 Bacteria 15607
79 Ga0114129_10008256 3300009147 Bacteria 14850
80 Ga0114129_10104555 3300009147 Plasmid 3913
81 Ga0114129_10198942 3300009147 Bacteria 2715
82 Ga0114129_10809214 3300009147 Bacteria 1195
83 Ga0114129_10938574 3300009147 Bacteria 1094
84 Ga0114129_11025450 3300009147 Bacteria 1037
85 Ga0105243_10678182 3300009148 Bacteria 1002
86 Ga0105241_10138047 3300009174 Bacteria 1982
87 Ga0105242_10092613 3300009176 Bacteria 2546
88 Ga0105248_10109200 3300009177 Bacteria 3119
89 Ga0099796_10064128 3300010159 Bacteria 1310
90 Ga0105246_10012192 3300011119 Bacteria 5356
91 Ga0157374_10364826 3300013296 Bacteria 1437
92 Ga0157378_10017074 3300013297 Bacteria 6363
93 Ga0157378_10022419 3300013297 Bacteria 5559
94 Ga0157375_10297147 3300013308 Unclassified 1778
95 Ga0157375_11272461 3300013308 Bacteria 864
96 Ga0157375_12143494 3300013308 Bacteria 665
97 Ga0163163_10044194 3300014325 Bacteria 4369
98 Ga0157380_10731966 3300014326 Bacteria 998
99 Ga0157379_10027231 3300014968 Bacteria 5089
100 Ga0157376_10009711 3300014969 Bacteria 7003
101 Ga0207653_10086987 3300025885 Bacteria 1090
102 Ga0207642_10015874 3300025899 Bacteria 2821
103 Ga0207710_10153858 3300025900 Bacteria 1117
104 Ga0207699_10423518 3300025906 Unclassified 951
105 Ga0207684_10077457 3300025910 Bacteria 2827
106 Ga0207684_10229685 3300025910 Bacteria 1601
107 Ga0207662_10784754 3300025918 Bacteria 671
108 Ga0207646_10072512 3300025922 Bacteria 3076
109 Ga0207646_10257720 3300025922 Bacteria 1576
110 Ga0207650_10055888 3300025925 Bacteria 2931
111 Ga0207650_10059044 3300025925 Bacteria 2858
112 Ga0207659_10167018 3300025926 Unclassified 1733
113 Ga0207659_10681488 3300025926 Bacteria 880
114 Ga0207706_10669501 3300025933 Unclassified 888
115 Ga0207686_10301886 3300025934 Unclassified 1189
116 Ga0207670_10030245 3300025936 Bacteria 3459
117 Ga0207669_10011052 3300025937 Bacteria 4376
118 Ga0207704_10042298 3300025938 Bacteria 2681
119 Ga0207691_10034409 3300025940 Bacteria 4711
120 Ga0207711_10044066 3300025941 Bacteria 3807
121 Ga0207679_10070447 3300025945 Bacteria 2635
122 Ga0207651_10119786 3300025960 Bacteria 1994
123 Ga0207651_10336916 3300025960 Bacteria 1266
124 Ga0207668_10692516 3300025972 Unclassified 895
125 Ga0207658_10047066 3300025986 Bacteria 3154
126 Ga0207677_11205806 3300026023 Bacteria 693
127 Ga0207703_10017393 3300026035 Bacteria 5613
128 Ga0207678_10074896 3300026067 Bacteria 2900
129 Ga0207702_10455173 3300026078 Bacteria 1242
130 Ga0207702_11425245 3300026078 Unclassified 686
131 Ga0207641_10010353 3300026088 Bacteria 7666
132 Ga0207641_10108831 3300026088 Unclassified 2454
133 Ga0207648_10014534 3300026089 Bacteria 7269
134 Ga0207648_10262339 3300026089 Bacteria 1542
135 Ga0207676_10322223 3300026095 Bacteria 1419
136 Ga0207676_10611329 3300026095 Bacteria 1048
137 Ga0207676_11547907 3300026095 Unclassified 660
138 Ga0207675_100031128 3300026118 Bacteria 4968
139 Ga0207683_10488766 3300026121 Bacteria 1136
140 Ga0268266_10034114 3300028379 Bacteria 4327
141 Ga0268264_10014122 3300028381 Bacteria 6567
142 Ga0268264_10351817 3300028381 Unclassified 1402
143 Ga0268264_10625940 3300028381 Bacteria 1063
144 Ga0307409_100026737 3300031995 Bacteria 4076
145 Ga0307416_100908777 3300032002 Bacteria 981
146 Ga0307411_10540600 3300032005 Bacteria 992
147 Ga0307411_11507943 3300032005 Bacteria 618
148 Ga0373958_0159181 3300034819 Unclassified 570
149 Ga0373959_0063423 3300034820 Unclassified 822
150 Ga0373939_0007614 3300035114 Bacteria 2633
151 Ga0373941_0201069 3300035115 Unclassified 757
152 Ga0373960_0104536 3300035121 Bacteria 922
153 Ga0373943_0083601 3300035170 Unclassified 1641
154 Ga0373943_0307182 3300035170 Unclassified 902
155 Ga0373946_0006259 3300035171 Bacteria 4312
156 Ga0373942_0066500 3300035207 Bacteria 1044
157 Ga0373931_0057445 3300035691 Bacteria 2087
158 Ga0373935_0513624 3300035692 Unclassified 871
159 Ga0373925_0200797 3300037068 Bacteria 1585
160 Ga0373925_0228492 3300037068 Bacteria 1487
161 Ga0373925_0487746 3300037068 Unclassified 1011
162 Ga0395900_1148713 3300037418 Unclassified 693
163 Ga0450920_024333 3300042122 Bacteria 1176
164 Ga0439446_0004290 3300042156 Bacteria 3605
165 Ga0450908_011787 3300042184 Bacteria 1595
166 Ga0439435_0282112 3300042436 Unclassified 565
167 Ga0453683_0181509 3300044673 Bacteria 1335
168 Ga0453683_0461672 3300044673 Bacteria 822
169 Ga0453684_0007693 3300044712 Bacteria 19703
170 Ga0453684_0777676 3300044712 Bacteria 1034
171 Ga0453684_1089491 3300044712 Unclassified 845
172 Ga0451576_0012021 3300045051 Bacteria 9774
173 Ga0451576_1446878 3300045051 Bacteria 715
174 Ga0495629_0000001 3300046459 Bacteria 807972
175 Ga0495653_0365615 3300046463 Unclassified 925
176 Ga0495580_0341242 3300046472 Unclassified 1016
177 Ga0495580_0408393 3300046472 Unclassified 915
178 Ga0495580_0755036 3300046472 Unclassified 633
179 Ga0495639_0000255 3300046475 Bacteria 26409
180 Ga0495662_0338974 3300046476 Unclassified 739
181 Ga0495644_0097987 3300046523 Bacteria 1109
182 Ga0495666_0003982 3300046526 Bacteria 7471
183 Ga0495666_0547042 3300046526 Unclassified 516
184 Ga0495586_0004947 3300046535 Bacteria 7126
185 Ga0495622_0012170 3300046557 Bacteria 3981
186 Ga0495656_0206641 3300046615 Bacteria 977
187 Ga0495635_0001175 3300046663 Bacteria 17454
188 Ga0495588_0194653 3300046674 Bacteria 1071
189 Ga0495647_0191074 3300046681 Bacteria 895
190 Ga0495658_0009333 3300046683 Bacteria 4886
191 Ga0495669_0473807 3300046684 Bacteria 608
192 Ga0495613_0280992 3300046689 Bacteria 1156
193 Ga0495624_0060659 3300046690 Bacteria 2371
194 Ga0495589_0096972 3300046794 Bacteria 1429
195 Ga0495600_0092149 3300046809 Bacteria 1976
196 Ga0495581_0013423 3300047315 Bacteria 4751
197 Ga0495674_0919253 3300047319 Unclassified 674
198 Ga0495676_0041465 3300047321 Bacteria 3789
199 Ga0495676_0403128 3300047321 Bacteria 907
200 Ga0495680_0000796 3300047322 Bacteria 35250
201 Ga0495684_0001985 3300047471 Bacteria 16444
202 Ga0496101_0145192 3300048904 Bacteria 1811
203 Ga0496102_0032561 3300048905 Bacteria 4683
204 Ga0496102_0044414 3300048905 Bacteria 4032
205 Ga0496103_0026340 3300048906 Bacteria 3521
206 Ga0496103_0118682 3300048906 Bacteria 1684
207 Ga0496104_0003350 3300048907 Bacteria 13835
208 Ga0496104_0060685 3300048907 Bacteria 3583
209 Ga0496105_0034140 3300048908 Bacteria 4183
210 Ga0496105_0056697 3300048908 Bacteria 3234
211 Ga0496106_0003824 3300048909 Bacteria 11223
212 Ga0496106_0069618 3300048909 Bacteria 2686
213 Ga0496106_0208912 3300048909 Bacteria 1555
214 Ga0496106_1532915 3300048909 Bacteria 512
215 Ga0496107_0030126 3300048910 Bacteria 3866
216 Ga0496108_0000569 3300048911 Bacteria 28900
217 Ga0496108_0009799 3300048911 Bacteria 7762
218 Ga0496109_0000424 3300048912 Bacteria 37140
219 Ga0496109_0102332 3300048912 Bacteria 2658
220 Ga0496110_0021396 3300048913 Bacteria 5475
221 Ga0496110_0021885 3300048913 Bacteria 5421
222 Ga0496111_0136340 3300048914 Unclassified 1818
223 Ga0496111_0399575 3300048914 Bacteria 1015
224 Ga0496112_0000410 3300048915 Bacteria 28180
225 Ga0496112_0743007 3300048915 Bacteria 908
226 Ga0496113_0000141 3300048916 Bacteria 31116
227 Ga0496113_0039380 3300048916 Bacteria 3479
228 Ga0496113_0145832 3300048916 Unclassified 1865
229 Ga0496114_1032774 3300048917 Unclassified 706
230 Ga0501036_0105204 3300049572 Bacteria 2387
231 nmdc:mga05p37_1023783_c1 3300050507 Bacteria 874
232 nmdc:mga05p37_1028220_c1 3300050507 Unclassified 872
233 nmdc:mga05p37_1288802_c1 3300050507 Bacteria 746
234 nmdc:mga05p37_242710_c1 3300050507 Bacteria 2165
235 nmdc:mga05p37_343153_c1 3300050507 Bacteria 1760
236 nmdc:mga05p37_42534_c1 3300050507 Bacteria 5583
237 nmdc:mga05p37_5045_c1 3300050507 Bacteria 13768
238 nmdc:mga05p37_964_c1 3300050507 Bacteria 30384
239 nmdc:mga05p37_998319_c1 3300050507 Bacteria 889
240 nmdc:mga09592_219378_c1 3300050508 Bacteria 1648
241 nmdc:mga09592_514430_c1 3300050508 Bacteria 1030
242 nmdc:mga09592_6196_c2 3300050508 Bacteria 9402
243 nmdc:mga09592_73501_c1 3300050508 Bacteria 2905
244 nmdc:mga06r32_258979_c1 3300050510 Bacteria 1727
245 nmdc:mga06r32_331288_c1 3300050510 Bacteria 1507
246 nmdc:mga06r32_551478_c1 3300050510 Unclassified 1126
247 nmdc:mga06r32_708722_c1 3300050510 Bacteria 972
248 nmdc:mga08y16_228805_c1 3300050511 Bacteria 1923
249 nmdc:mga0n895_104109_c1 3300050512 Bacteria 2850
250 nmdc:mga0n895_239414_c1 3300050512 Bacteria 1841
251 nmdc:mga0n895_24048_c1 3300050512 Bacteria 5736
252 nmdc:mga0n895_36199_c1 3300050512 Bacteria 4765
253 nmdc:mga0n895_82108_c1 3300050512 Bacteria 3213
254 nmdc:mga0rr50_1337178_c1 3300050513 Unclassified 607
255 nmdc:mga0rr50_244477_c1 3300050513 Bacteria 1488
256 nmdc:mga0rr50_394498_c1 3300050513 Bacteria 1168
257 nmdc:mga0rr50_849_c1 3300050513 Bacteria 16428
258 nmdc:mga08x19_12257_c1 3300050514 Bacteria 5161
259 nmdc:mga08x19_28324_c1 3300050514 Plasmid 3507
260 nmdc:mga08x19_48915_c1 3300050514 Unclassified 1623
261 nmdc:mga08x19_960549_c1 3300050514 Unclassified 607
262 nmdc:mga0a205_14326_c1 3300050515 Bacteria 7394
263 nmdc:mga0a205_157108_c1 3300050515 Bacteria 2172
264 nmdc:mga0a205_201477_c1 3300050515 Unclassified 1881
265 nmdc:mga0a205_2352_c1 3300050515 Bacteria 16687
266 nmdc:mga0a205_245_c1 3300050515 Bacteria 38677
267 Ga0495619_0047488 3300053085 Bacteria 2827
268 Ga0500566_0012294 3300053094 Bacteria 5042
269 Ga0207700_10262111
270 SwRhRL3b_contig_660992
271 Ga0065707_10001160
272 Ga0070670_100053523
273 Ga0070670_100114537
274 Ga0070666_10079177
275 Ga0070669_100007577
276 Ga0070675_100121687
277 Ga0070675_100175203
278 Ga0070674_100046603
279 Ga0070673_100089647
280 Ga0070667_100001518
281 Ga0070667_100950508
282 Ga0070700_100281790
283 Ga0070694_100325825
284 Ga0070708_100470027
285 Ga0070678_100557369
286 Ga0068867_100014307
287 Ga0070685_11344601
288 Ga0070706_100007600
289 Ga0070707_100086174
290 Ga0070707_100255327
291 Ga0070707_100426518
292 Ga0070699_100259411
293 Ga0070699_100368797
294 Ga0070699_100871224
295 Ga0070697_101156860
296 Ga0070672_100021633
297 Ga0070695_100904795
298 Ga0070696_100364349
299 Ga0070693_100402186
300 Ga0070665_100013484
301 Ga0070704_100531554
302 Ga0070704_100839170
303 Ga0070704_101028171
304 Ga0068855_100300219
305 Ga0068856_100034525
306 Ga0068856_101821407
307 Ga0070702_100034151
308 Ga0068859_102120322
309 Ga0068864_100080914
310 Ga0068864_101246034
311 Ga0068866_10031815
312 Ga0068866_10550047
313 Ga0068863_100058414
314 Ga0068863_100151269
315 Ga0068858_100038792
316 Ga0068860_100006675
317 Ga0068860_100007489
318 Ga0068860_100477518
319 Ga0068862_100087024
320 Ga0081539_10022385
321 Ga0075428_100395633
322 Ga0075430_101191612
323 Ga0075431_100571858
324 Ga0075431_100760120
325 Ga0075431_100937711
326 Ga0075433_10000966
327 Ga0075433_10003958
328 Ga0075434_100000240
329 Ga0075434_100007530
330 Ga0075434_100241901
331 Ga0075429_100003980
332 Ga0075429_100046413
333 Ga0068865_100110339
334 Ga0068865_100268756
335 Ga0075436_100023222
336 Ga0075436_100038314
337 Ga0075436_100180668
338 Ga0075436_100541358
339 Ga0097620_102120271
340 Ga0075435_100003081
341 Ga0075435_101344631
342 Ga0111539_10198711
343 Ga0111539_10269712
344 Ga0105247_10084715
345 Ga0114129_10000614
346 Ga0114129_10007425
347 Ga0114129_10008256
348 Ga0114129_10104555
349 Ga0114129_10198942
350 Ga0114129_10809214
351 Ga0114129_10938574
352 Ga0114129_11025450
353 Ga0105243_10678182
354 Ga0105241_10138047
355 Ga0105242_10092613
356 Ga0105248_10109200
357 Ga0099796_10064128
358 Ga0105246_10012192
359 Ga0157374_10364826
360 Ga0157378_10017074
361 Ga0157378_10022419
362 Ga0157375_10297147
363 Ga0157375_11272461
364 Ga0157375_12143494
365 Ga0163163_10044194
366 Ga0157380_10731966
367 Ga0157379_10027231
368 Ga0157376_10009711
369 Ga0207653_10086987
370 Ga0207642_10015874
371 Ga0207710_10153858
372 Ga0207699_10423518
373 Ga0207684_10077457
374 Ga0207684_10229685
375 Ga0207662_10784754
376 Ga0207646_10072512
377 Ga0207646_10257720
378 Ga0207650_10055888
379 Ga0207650_10059044
380 Ga0207659_10167018
381 Ga0207659_10681488
382 Ga0207706_10669501
383 Ga0207686_10301886
384 Ga0207670_10030245
385 Ga0207669_10011052
386 Ga0207704_10042298
387 Ga0207691_10034409
388 Ga0207711_10044066
389 Ga0207679_10070447
390 Ga0207651_10119786
391 Ga0207651_10336916
392 Ga0207668_10692516
393 Ga0207658_10047066
394 Ga0207677_11205806
395 Ga0207703_10017393
396 Ga0207678_10074896
397 Ga0207702_10455173
398 Ga0207702_11425245
399 Ga0207641_10010353
400 Ga0207641_10108831
401 Ga0207648_10014534
402 Ga0207648_10262339
403 Ga0207676_10322223
404 Ga0207676_10611329
405 Ga0207676_11547907
406 Ga0207675_100031128
407 Ga0207683_10488766
408 Ga0268266_10034114
409 Ga0268264_10014122
410 Ga0268264_10351817
411 Ga0268264_10625940
412 Ga0307409_100026737
413 Ga0307416_100908777
414 Ga0307411_10540600
415 Ga0307411_11507943
416 Ga0373958_0159181
417 Ga0373959_0063423
418 Ga0373939_0007614
419 Ga0373941_0201069
420 Ga0373960_0104536
421 Ga0373943_0083601
422 Ga0373943_0307182
423 Ga0373946_0006259
424 Ga0373942_0066500
425 Ga0373931_0057445
426 Ga0373935_0513624
427 Ga0373925_0200797
428 Ga0373925_0228492
429 Ga0373925_0487746
430 Ga0395900_1148713
431 Ga0450920_024333
432 Ga0439446_0004290
433 Ga0450908_011787
434 Ga0439435_0282112
435 Ga0453683_0181509
436 Ga0453683_0461672
437 Ga0453684_0007693
438 Ga0453684_0777676
439 Ga0453684_1089491
440 Ga0451576_0012021
441 Ga0451576_1446878
442 Ga0495629_0000001
443 Ga0495653_0365615
444 Ga0495580_0341242
445 Ga0495580_0408393
446 Ga0495580_0755036
447 Ga0495639_0000255
448 Ga0495662_0338974
449 Ga0495644_0097987
450 Ga0495666_0003982
451 Ga0495666_0547042
452 Ga0495586_0004947
453 Ga0495622_0012170
454 Ga0495656_0206641
455 Ga0495635_0001175
456 Ga0495588_0194653
457 Ga0495647_0191074
458 Ga0495658_0009333
459 Ga0495669_0473807
460 Ga0495613_0280992
461 Ga0495624_0060659
462 Ga0495589_0096972
463 Ga0495600_0092149
464 Ga0495581_0013423
465 Ga0495674_0919253
466 Ga0495676_0041465
467 Ga0495676_0403128
468 Ga0495680_0000796
469 Ga0495684_0001985
470 Ga0496101_0145192
471 Ga0496102_0032561
472 Ga0496102_0044414
473 Ga0496103_0026340
474 Ga0496103_0118682
475 Ga0496104_0003350
476 Ga0496104_0060685
477 Ga0496105_0034140
478 Ga0496105_0056697
479 Ga0496106_0003824
480 Ga0496106_0069618
481 Ga0496106_0208912
482 Ga0496106_1532915
483 Ga0496107_0030126
484 Ga0496108_0000569
485 Ga0496108_0009799
486 Ga0496109_0000424
487 Ga0496109_0102332
488 Ga0496110_0021396
489 Ga0496110_0021885
490 Ga0496111_0136340
491 Ga0496111_0399575
492 Ga0496112_0000410
493 Ga0496112_0743007
494 Ga0496113_0000141
495 Ga0496113_0039380
496 Ga0496113_0145832
497 Ga0496114_1032774
498 Ga0501036_0105204
499 nmdc:mga05p37_1023783_c1
500 nmdc:mga05p37_1028220_c1
501 nmdc:mga05p37_1288802_c1
502 nmdc:mga05p37_242710_c1
503 nmdc:mga05p37_343153_c1
504 nmdc:mga05p37_42534_c1
505 nmdc:mga05p37_5045_c1
506 nmdc:mga05p37_964_c1
507 nmdc:mga05p37_998319_c1
508 nmdc:mga09592_219378_c1
509 nmdc:mga09592_514430_c1
510 nmdc:mga09592_6196_c2
511 nmdc:mga09592_73501_c1
512 nmdc:mga06r32_258979_c1
513 nmdc:mga06r32_331288_c1
514 nmdc:mga06r32_551478_c1
515 nmdc:mga06r32_708722_c1
516 nmdc:mga08y16_228805_c1
517 nmdc:mga0n895_104109_c1
518 nmdc:mga0n895_239414_c1
519 nmdc:mga0n895_24048_c1
520 nmdc:mga0n895_36199_c1
521 nmdc:mga0n895_82108_c1
522 nmdc:mga0rr50_1337178_c1
523 nmdc:mga0rr50_244477_c1
524 nmdc:mga0rr50_394498_c1
525 nmdc:mga0rr50_849_c1
526 nmdc:mga08x19_12257_c1
527 nmdc:mga08x19_28324_c1
528 nmdc:mga08x19_48915_c1
529 nmdc:mga08x19_960549_c1
530 nmdc:mga0a205_14326_c1
531 nmdc:mga0a205_157108_c1
532 nmdc:mga0a205_201477_c1
533 nmdc:mga0a205_2352_c1
534 nmdc:mga0a205_245_c1
535 Ga0495619_0047488
536 Ga0500566_0012294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03243

MerB

Alkylmercury lyase

85

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jhf-assembly1.cif.gz_A lexa g85d mutant 0.918 6 62
2ev0-assembly1.cif.gz_B bacillus subtilis manganese transport regulator (mntr) bound to cadmium 0.9088 6 54
3r60-assembly1.cif.gz_B structure of the mntr fe2+ complex 0.904 6 54
4hx7-assembly1.cif.gz_B structure of mntr e11k mutant complexed with cd2+ 0.9039 6 54
3r61-assembly1.cif.gz_B structure of the mntr co2+ complex 0.8976 6 54
ID Description Score Start End Superfamily
af_P32144_11_67_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 6 56 1.10.10.10
2ev5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9166 4 54 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 6 54 1.10.10.10
4hx4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 4 54 1.10.10.10
af_P0A0Q0_3_60_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.905 2 56 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3A4X1L6-F1-model_v4 Uncharacterized protein 0.9812 6 87
AF-A0A3D3YWE3-F1-model_v4 Uncharacterized protein 0.9676 11 91
AF-A0A520PIB2-F1-model_v4 Uncharacterized protein 0.9649 4 87
AF-A0A2V8EIU5-F1-model_v4 Alkylmercury lyase 0.9646 9 98
AF-A0A534KN90-F1-model_v4 deleted 0.9576 4 78

Map