F375570

General Info

Members Datasets Scaffolds Average Seq Length
268 175 536 138

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_11939370|Ga0207687_119393701
Length 145
Sequence MTFAGINYLAVIIAAVIGWLAGAIYYGVLANPWVAAHGKTMEAFKAEQAAHKGTVHAWLPFALAFLAELVMAYVLAGVLGHLGPGQVTLKNGIISALFLWLGFVVTTIFVNNAYPGRKYSLSVIDSIHWLGVLVIQGAIIGALGI

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
145 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.04
Nodule 0
Rhizoplane 1.12
Rhizosphere 80.22
Stem 0
Stem Tuber 0
Unclassified 11.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_11939370 3300025927 Bacteria 503
2 JGI25406J46586_10048635 3300003203 Bacteria 1437
3 Ga0065712_10472226 3300005290 Bacteria 669
4 Ga0065715_10227135 3300005293 Bacteria 1232
5 Ga0070658_10028190 3300005327 Bacteria 4507
6 Ga0070658_11355024 3300005327 Bacteria 618
7 Ga0070676_10572630 3300005328 Bacteria 811
8 Ga0070683_100020767 3300005329 Bacteria 5850
9 Ga0070683_100112709 3300005329 Bacteria 2567
10 Ga0070690_100394717 3300005330 Bacteria 1015
11 Ga0070690_100513153 3300005330 Bacteria 899
12 Ga0070680_100005465 3300005336 Bacteria 9618
13 Ga0070689_100123517 3300005340 Bacteria 2070
14 Ga0070691_10054521 3300005341 Bacteria 1914
15 Ga0070687_100560169 3300005343 Bacteria 779
16 Ga0070661_100783527 3300005344 Bacteria 781
17 Ga0070669_101102521 3300005353 Bacteria 684
18 Ga0070675_100438153 3300005354 Bacteria 1170
19 Ga0070675_100881216 3300005354 Bacteria 820
20 Ga0070675_101325081 3300005354 Bacteria 663
21 Ga0070671_100046332 3300005355 Bacteria 3616
22 Ga0070674_100443549 3300005356 Bacteria 1070
23 Ga0070673_100506091 3300005364 Unclassified 1093
24 Ga0070673_100921143 3300005364 Bacteria 811
25 Ga0070673_100925542 3300005364 Bacteria 809
26 Ga0070688_100347754 3300005365 Bacteria 1085
27 Ga0070688_100417790 3300005365 Bacteria 996
28 Ga0070659_100394991 3300005366 Bacteria 1167
29 Ga0070713_100106779 3300005436 Bacteria 2434
30 Ga0070701_11129011 3300005438 Bacteria 553
31 Ga0070711_100637575 3300005439 Bacteria 892
32 Ga0070708_100198254 3300005445 Bacteria 1879
33 Ga0070663_100828415 3300005455 Bacteria 795
34 Ga0070678_100407757 3300005456 Bacteria 1182
35 Ga0070681_10040443 3300005458 Bacteria 4671
36 Ga0070681_10604967 3300005458 Bacteria 1010
37 Ga0070681_11131536 3300005458 Unclassified 704
38 Ga0070706_100074280 3300005467 Bacteria 3147
39 Ga0070679_100021166 3300005530 Bacteria 6345
40 Ga0070679_100276730 3300005530 Bacteria 1631
41 Ga0070679_100577146 3300005530 Unclassified 1068
42 Ga0070679_101119234 3300005530 Bacteria 732
43 Ga0070684_100244784 3300005535 Bacteria 1639
44 Ga0070697_100104903 3300005536 Bacteria 2351
45 Ga0070697_101069009 3300005536 Bacteria 718
46 Ga0068853_100347225 3300005539 Bacteria 1380
47 Ga0070672_100148370 3300005543 Bacteria 1939
48 Ga0070672_100295750 3300005543 Bacteria 1372
49 Ga0070693_100427071 3300005547 Bacteria 925
50 Ga0070665_100010063 3300005548 Bacteria 9570
51 Ga0070665_100262826 3300005548 Bacteria 1727
52 Ga0070665_100675842 3300005548 Unclassified 1046
53 Ga0068855_100042867 3300005563 Bacteria 5362
54 Ga0068855_101236108 3300005563 Bacteria 775
55 Ga0070664_100285948 3300005564 Bacteria 1488
56 Ga0068856_101418118 3300005614 Unclassified 709
57 Ga0068852_100019683 3300005616 Bacteria 5349
58 Ga0068859_102608571 3300005617 Bacteria 556
59 Ga0068864_100264211 3300005618 Bacteria 1602
60 Ga0068864_102110886 3300005618 Bacteria 570
61 Ga0068866_10803150 3300005718 Bacteria 654
62 Ga0068863_100886577 3300005841 Bacteria 892
63 Ga0068858_100353781 3300005842 Unclassified 1407
64 Ga0068858_101878381 3300005842 Bacteria 592
65 Ga0068860_100307861 3300005843 Unclassified 1553
66 Ga0068860_100349587 3300005843 Bacteria 1455
67 Ga0068862_100281751 3300005844 Bacteria 1524
68 Ga0068862_100365621 3300005844 Bacteria 1342
69 Ga0068862_100881266 3300005844 Bacteria 879
70 Ga0081455_10002662 3300005937 Bacteria 21123
71 Ga0081455_10023876 3300005937 Bacteria 5679
72 Ga0081455_10037742 3300005937 Bacteria 4285
73 Ga0081455_10319056 3300005937 Bacteria 1108
74 Ga0081539_10001201 3300005985 Bacteria 46698
75 Ga0081539_10016532 3300005985 Bacteria 5257
76 Ga0075365_10357540 3300006038 Bacteria 1029
77 Ga0075365_10549388 3300006038 Bacteria 817
78 Ga0075365_11199737 3300006038 Unclassified 534
79 Ga0075368_10247894 3300006042 Bacteria 761
80 Ga0075363_100159065 3300006048 Bacteria 1278
81 Ga0075362_10003937 3300006177 Bacteria 5275
82 Ga0075362_10033631 3300006177 Bacteria 2230
83 Ga0075362_10410297 3300006177 Unclassified 684
84 Ga0075367_10074033 3300006178 Bacteria 2053
85 Ga0075367_10189436 3300006178 Bacteria 1283
86 Ga0075367_10269283 3300006178 Bacteria 1070
87 Ga0075369_10004250 3300006186 Bacteria 5276
88 Ga0075369_10045975 3300006186 Bacteria 1878
89 Ga0075369_10061066 3300006186 Bacteria 1645
90 Ga0075366_10397851 3300006195 Bacteria 848
91 Ga0075366_10458876 3300006195 Bacteria 786
92 Ga0068871_101176472 3300006358 Bacteria 719
93 Ga0075430_101778199 3300006846 Bacteria 506
94 Ga0097620_102608366 3300006931 Bacteria 556
95 Ga0099794_10036245 3300007265 Unclassified 2331
96 Ga0099795_10597352 3300007788 Bacteria 525
97 Ga0105240_10070869 3300009093 Bacteria 4311
98 Ga0105240_10479426 3300009093 Bacteria 1387
99 Ga0105240_10853845 3300009093 Bacteria 982
100 Ga0105240_11326503 3300009093 Bacteria 758
101 Ga0105240_11373599 3300009093 Bacteria 743
102 Ga0111539_11036714 3300009094 Bacteria 954
103 Ga0105245_10381738 3300009098 Bacteria 1403
104 Ga0105243_10223990 3300009148 Bacteria 1664
105 Ga0105243_10490047 3300009148 Unclassified 1162
106 Ga0105243_10580032 3300009148 Bacteria 1076
107 Ga0105241_10898812 3300009174 Bacteria 822
108 Ga0105241_11573876 3300009174 Unclassified 635
109 Ga0105238_10017413 3300009551 Bacteria 7301
110 Ga0105238_10732502 3300009551 Bacteria 1002
111 Ga0105238_12427416 3300009551 Unclassified 560
112 Ga0105249_10870041 3300009553 Bacteria 967
113 Ga0105239_10878178 3300010375 Bacteria 1029
114 Ga0105246_11375779 3300011119 Bacteria 657
115 Ga0157373_11513232 3300013100 Bacteria 512
116 Ga0157371_10196779 3300013102 Bacteria 1444
117 Ga0157370_10795737 3300013104 Bacteria 860
118 Ga0157370_10911155 3300013104 Bacteria 797
119 Ga0157370_11300619 3300013104 Bacteria 655
120 Ga0157369_10233404 3300013105 Bacteria 1923
121 Ga0157369_11094345 3300013105 Bacteria 815
122 Ga0163162_10486246 3300013306 Bacteria 1366
123 Ga0163162_11070331 3300013306 Bacteria 913
124 Ga0157372_10461994 3300013307 Bacteria 1479
125 Ga0157375_11483218 3300013308 Unclassified 800
126 Ga0157380_11059957 3300014326 Bacteria 847
127 Ga0157377_10619653 3300014745 Bacteria 774
128 Ga0157376_10593789 3300014969 Bacteria 1101
129 Ga0157376_11054198 3300014969 Bacteria 837
130 Ga0213871_10015100 3300021441 Bacteria 1842
131 Ga0207426_1013091 3300025302 Bacteria 3088
132 Ga0207426_1044898 3300025302 Bacteria 1348
133 Ga0207642_10496986 3300025899 Bacteria 746
134 Ga0207647_10343912 3300025904 Bacteria 845
135 Ga0207645_10396831 3300025907 Bacteria 927
136 Ga0207705_10064629 3300025909 Bacteria 2644
137 Ga0207684_10074774 3300025910 Bacteria 2879
138 Ga0207684_11008607 3300025910 Bacteria 696
139 Ga0207684_11094775 3300025910 Unclassified 663
140 Ga0207707_10008472 3300025912 Bacteria 8916
141 Ga0207695_10260429 3300025913 Bacteria 1632
142 Ga0207695_10718881 3300025913 Bacteria 879
143 Ga0207693_10344282 3300025915 Bacteria 1167
144 Ga0207660_10099056 3300025917 Bacteria 2175
145 Ga0207660_10144817 3300025917 Bacteria 1820
146 Ga0207657_10516041 3300025919 Unclassified 936
147 Ga0207649_10810247 3300025920 Bacteria 731
148 Ga0207652_10027924 3300025921 Bacteria 4706
149 Ga0207652_10383385 3300025921 Unclassified 1268
150 Ga0207646_10067118 3300025922 Bacteria 3202
151 Ga0207681_10127280 3300025923 Bacteria 1878
152 Ga0207681_10941117 3300025923 Bacteria 724
153 Ga0207694_10451246 3300025924 Bacteria 1073
154 Ga0207700_10121818 3300025928 Bacteria 2116
155 Ga0207690_10208776 3300025932 Bacteria 1487
156 Ga0207706_10562882 3300025933 Bacteria 981
157 Ga0207709_11052048 3300025935 Bacteria 667
158 Ga0207669_10472147 3300025937 Bacteria 998
159 Ga0207691_10104502 3300025940 Bacteria 2524
160 Ga0207661_10454063 3300025944 Bacteria 1167
161 Ga0207667_10053514 3300025949 Bacteria 4247
162 Ga0207667_11991141 3300025949 Bacteria 541
163 Ga0207640_10238156 3300025981 Bacteria 1405
164 Ga0207658_11117802 3300025986 Unclassified 720
165 Ga0207658_11298137 3300025986 Bacteria 666
166 Ga0207703_10133495 3300026035 Bacteria 2147
167 Ga0207703_10134779 3300026035 Bacteria 2137
168 Ga0207703_10931279 3300026035 Bacteria 832
169 Ga0207678_10367068 3300026067 Unclassified 1243
170 Ga0207708_10185360 3300026075 Bacteria 1653
171 Ga0207702_10274882 3300026078 Bacteria 1590
172 Ga0207702_10608687 3300026078 Bacteria 1072
173 Ga0207641_10763671 3300026088 Bacteria 955
174 Ga0207648_10459215 3300026089 Bacteria 1161
175 Ga0207676_10236349 3300026095 Bacteria 1637
176 Ga0207676_10514497 3300026095 Bacteria 1139
177 Ga0207675_100529415 3300026118 Bacteria 1176
178 Ga0207683_10161908 3300026121 Bacteria 2023
179 Ga0207698_10320403 3300026142 Bacteria 1451
180 Ga0209813_10240676 3300027866 Bacteria 684
181 Ga0268266_10005090 3300028379 Bacteria 12395
182 Ga0268266_10241566 3300028379 Bacteria 1667
183 Ga0268266_10501030 3300028379 Unclassified 1159
184 Ga0268266_10980710 3300028379 Bacteria 818
185 Ga0268265_10234253 3300028380 Bacteria 1616
186 Ga0268265_11382595 3300028380 Bacteria 706
187 Ga0268265_11422909 3300028380 Unclassified 696
188 Ga0268264_10267739 3300028381 Unclassified 1595
189 Ga0265330_10104649 3300031235 Bacteria 1210
190 Ga0265332_10168082 3300031238 Bacteria 916
191 Ga0265332_10297049 3300031238 Bacteria 667
192 Ga0265320_10056081 3300031240 Bacteria 1894
193 Ga0265325_10044126 3300031241 Bacteria 2323
194 Ga0265325_10303019 3300031241 Bacteria 713
195 Ga0265331_10090632 3300031250 Bacteria 1413
196 Ga0307513_10093906 3300031456 Bacteria 3047
197 Ga0307513_10152274 3300031456 Bacteria 2219
198 Ga0265313_10008719 3300031595 Bacteria 6697
199 Ga0265314_10049978 3300031711 Bacteria 2924
200 Ga0265342_10491436 3300031712 Bacteria 627
201 Ga0307416_100633815 3300032002 Bacteria 1152
202 Ga0373943_0530431 3300035170 Bacteria 690
203 Ga0373931_0159248 3300035691 Unclassified 1322
204 Ga0373927_0033903 3300035695 Bacteria 3322
205 Ga0373933_0092617 3300035724 Bacteria 1867
206 Ga0373937_1315333 3300036401 Bacteria 671
207 Ga0395899_0015641 3300037312 Bacteria 5786
208 Ga0395899_0512606 3300037312 Bacteria 776
209 Ga0395900_0716037 3300037418 Bacteria 933
210 Ga0395905_1293150 3300037471 Bacteria 633
211 Ga0436364_1100707 3300037853 Unclassified 539
212 Ga0436364_1426850 3300037853 Unclassified 772
213 Ga0395901_0432356 3300038443 Bacteria 1348
214 Ga0395901_0460445 3300038443 Bacteria 1299
215 Ga0436365_0257746 3300039437 Bacteria 5280
216 Ga0436365_0668247 3300039437 Unclassified 708
217 Ga0436360_1338344 3300039438 Bacteria 21044
218 Ga0436361_0951352 3300039447 Bacteria 2008
219 Ga0439453_0001993 3300041408 Bacteria 2744
220 Ga0439440_0046290 3300042993 Bacteria 1074
221 Ga0466967_0049223 3300045976 Bacteria 3684
222 Ga0495592_0525447 3300046454 Viruses 731
223 Ga0496110_1437071 3300048913 Bacteria 599
224 Ga0496112_0197209 3300048915 Bacteria 1974
225 Ga0496112_0709240 3300048915 Bacteria 934
226 Ga0496126_0055725 3300048929 Bacteria 3575
227 Ga0501032_0872175 3300049569 Bacteria 567
228 Ga0501034_0001551 3300049571 Bacteria 30141
229 Ga0501034_0010209 3300049571 Bacteria 9795
230 Ga0501034_0026966 3300049571 Bacteria 5845
231 Ga0501034_0083613 3300049571 Bacteria 3194
232 Ga0501034_1248503 3300049571 Unclassified 621
233 Ga0501034_1360726 3300049571 Bacteria 586
234 Ga0501043_0542467 3300049579 Bacteria 865
235 Ga0501046_0376621 3300049580 Bacteria 1028
236 Ga0501047_0267670 3300049581 Bacteria 1555
237 Ga0501068_0092821 3300049584 Bacteria 1864
238 Ga0501070_0255502 3300049586 Bacteria 1433
239 Ga0501070_0364570 3300049586 Bacteria 1172
240 Ga0501070_1398890 3300049586 Bacteria 532
241 Ga0501080_0219077 3300049742 Bacteria 1742
242 Ga0501044_0027504 3300049823 Bacteria 6009
243 Ga0501044_1106463 3300049823 Bacteria 661
244 nmdc:mga03683_2410_c1 3300050489 Bacteria 5804
245 nmdc:mga03683_269465_c1 3300050489 Bacteria 794
246 nmdc:mga03683_375658_c1 3300050489 Unclassified 676
247 nmdc:mga03n38_176991_c1 3300050490 Bacteria 1090
248 nmdc:mga03n38_344089_c1 3300050490 Bacteria 810
249 nmdc:mga03n38_348051_c1 3300050490 Bacteria 806
250 nmdc:mga00v17_390883_c1 3300050491 Unclassified 904
251 nmdc:mga0yw44_1022005_c1 3300050492 Unclassified 559
252 nmdc:mga0yw44_1222378_c1 3300050492 Bacteria 507
253 nmdc:mga0k408_285315_c1 3300050493 Bacteria 985
254 nmdc:mga04h51_193027_c1 3300050495 Bacteria 797
255 nmdc:mga04h51_274811_c1 3300050495 Bacteria 681
256 nmdc:mga07m45_231384_c1 3300050496 Bacteria 1075
257 nmdc:mga07m45_381849_c1 3300050496 Bacteria 818
258 nmdc:mga07m45_453924_c1 3300050496 Bacteria 743
259 nmdc:mga08y16_295350_c1 3300050511 Unclassified 1670
260 nmdc:mga0sz30_42462_c1 3300050516 Bacteria 1913
261 nmdc:mga0sz30_67845_c1 3300050516 Bacteria 1532
262 Ga0500583_0505043 3300053092 Bacteria 567
263 Ga0500641_0067448 3300053096 Bacteria 1500
264 Ga0500557_220285 3300053105 Bacteria 604
265 Ga0500655_061584 3300053133 Bacteria 757
266 Ga0500658_0028942 3300053134 Bacteria 2153
267 Ga0500604_0094492 3300053151 Bacteria 980
268 Ga0500616_0004096 3300053153 Bacteria 10586
269 Ga0207687_11939370
270 JGI25406J46586_10048635
271 Ga0065712_10472226
272 Ga0065715_10227135
273 Ga0070658_10028190
274 Ga0070658_11355024
275 Ga0070676_10572630
276 Ga0070683_100020767
277 Ga0070683_100112709
278 Ga0070690_100394717
279 Ga0070690_100513153
280 Ga0070680_100005465
281 Ga0070689_100123517
282 Ga0070691_10054521
283 Ga0070687_100560169
284 Ga0070661_100783527
285 Ga0070669_101102521
286 Ga0070675_100438153
287 Ga0070675_100881216
288 Ga0070675_101325081
289 Ga0070671_100046332
290 Ga0070674_100443549
291 Ga0070673_100506091
292 Ga0070673_100921143
293 Ga0070673_100925542
294 Ga0070688_100347754
295 Ga0070688_100417790
296 Ga0070659_100394991
297 Ga0070713_100106779
298 Ga0070701_11129011
299 Ga0070711_100637575
300 Ga0070708_100198254
301 Ga0070663_100828415
302 Ga0070678_100407757
303 Ga0070681_10040443
304 Ga0070681_10604967
305 Ga0070681_11131536
306 Ga0070706_100074280
307 Ga0070679_100021166
308 Ga0070679_100276730
309 Ga0070679_100577146
310 Ga0070679_101119234
311 Ga0070684_100244784
312 Ga0070697_100104903
313 Ga0070697_101069009
314 Ga0068853_100347225
315 Ga0070672_100148370
316 Ga0070672_100295750
317 Ga0070693_100427071
318 Ga0070665_100010063
319 Ga0070665_100262826
320 Ga0070665_100675842
321 Ga0068855_100042867
322 Ga0068855_101236108
323 Ga0070664_100285948
324 Ga0068856_101418118
325 Ga0068852_100019683
326 Ga0068859_102608571
327 Ga0068864_100264211
328 Ga0068864_102110886
329 Ga0068866_10803150
330 Ga0068863_100886577
331 Ga0068858_100353781
332 Ga0068858_101878381
333 Ga0068860_100307861
334 Ga0068860_100349587
335 Ga0068862_100281751
336 Ga0068862_100365621
337 Ga0068862_100881266
338 Ga0081455_10002662
339 Ga0081455_10023876
340 Ga0081455_10037742
341 Ga0081455_10319056
342 Ga0081539_10001201
343 Ga0081539_10016532
344 Ga0075365_10357540
345 Ga0075365_10549388
346 Ga0075365_11199737
347 Ga0075368_10247894
348 Ga0075363_100159065
349 Ga0075362_10003937
350 Ga0075362_10033631
351 Ga0075362_10410297
352 Ga0075367_10074033
353 Ga0075367_10189436
354 Ga0075367_10269283
355 Ga0075369_10004250
356 Ga0075369_10045975
357 Ga0075369_10061066
358 Ga0075366_10397851
359 Ga0075366_10458876
360 Ga0068871_101176472
361 Ga0075430_101778199
362 Ga0097620_102608366
363 Ga0099794_10036245
364 Ga0099795_10597352
365 Ga0105240_10070869
366 Ga0105240_10479426
367 Ga0105240_10853845
368 Ga0105240_11326503
369 Ga0105240_11373599
370 Ga0111539_11036714
371 Ga0105245_10381738
372 Ga0105243_10223990
373 Ga0105243_10490047
374 Ga0105243_10580032
375 Ga0105241_10898812
376 Ga0105241_11573876
377 Ga0105238_10017413
378 Ga0105238_10732502
379 Ga0105238_12427416
380 Ga0105249_10870041
381 Ga0105239_10878178
382 Ga0105246_11375779
383 Ga0157373_11513232
384 Ga0157371_10196779
385 Ga0157370_10795737
386 Ga0157370_10911155
387 Ga0157370_11300619
388 Ga0157369_10233404
389 Ga0157369_11094345
390 Ga0163162_10486246
391 Ga0163162_11070331
392 Ga0157372_10461994
393 Ga0157375_11483218
394 Ga0157380_11059957
395 Ga0157377_10619653
396 Ga0157376_10593789
397 Ga0157376_11054198
398 Ga0213871_10015100
399 Ga0207426_1013091
400 Ga0207426_1044898
401 Ga0207642_10496986
402 Ga0207647_10343912
403 Ga0207645_10396831
404 Ga0207705_10064629
405 Ga0207684_10074774
406 Ga0207684_11008607
407 Ga0207684_11094775
408 Ga0207707_10008472
409 Ga0207695_10260429
410 Ga0207695_10718881
411 Ga0207693_10344282
412 Ga0207660_10099056
413 Ga0207660_10144817
414 Ga0207657_10516041
415 Ga0207649_10810247
416 Ga0207652_10027924
417 Ga0207652_10383385
418 Ga0207646_10067118
419 Ga0207681_10127280
420 Ga0207681_10941117
421 Ga0207694_10451246
422 Ga0207700_10121818
423 Ga0207690_10208776
424 Ga0207706_10562882
425 Ga0207709_11052048
426 Ga0207669_10472147
427 Ga0207691_10104502
428 Ga0207661_10454063
429 Ga0207667_10053514
430 Ga0207667_11991141
431 Ga0207640_10238156
432 Ga0207658_11117802
433 Ga0207658_11298137
434 Ga0207703_10133495
435 Ga0207703_10134779
436 Ga0207703_10931279
437 Ga0207678_10367068
438 Ga0207708_10185360
439 Ga0207702_10274882
440 Ga0207702_10608687
441 Ga0207641_10763671
442 Ga0207648_10459215
443 Ga0207676_10236349
444 Ga0207676_10514497
445 Ga0207675_100529415
446 Ga0207683_10161908
447 Ga0207698_10320403
448 Ga0209813_10240676
449 Ga0268266_10005090
450 Ga0268266_10241566
451 Ga0268266_10501030
452 Ga0268266_10980710
453 Ga0268265_10234253
454 Ga0268265_11382595
455 Ga0268265_11422909
456 Ga0268264_10267739
457 Ga0265330_10104649
458 Ga0265332_10168082
459 Ga0265332_10297049
460 Ga0265320_10056081
461 Ga0265325_10044126
462 Ga0265325_10303019
463 Ga0265331_10090632
464 Ga0307513_10093906
465 Ga0307513_10152274
466 Ga0265313_10008719
467 Ga0265314_10049978
468 Ga0265342_10491436
469 Ga0307416_100633815
470 Ga0373943_0530431
471 Ga0373931_0159248
472 Ga0373927_0033903
473 Ga0373933_0092617
474 Ga0373937_1315333
475 Ga0395899_0015641
476 Ga0395899_0512606
477 Ga0395900_0716037
478 Ga0395905_1293150
479 Ga0436364_1100707
480 Ga0436364_1426850
481 Ga0395901_0432356
482 Ga0395901_0460445
483 Ga0436365_0257746
484 Ga0436365_0668247
485 Ga0436360_1338344
486 Ga0436361_0951352
487 Ga0439453_0001993
488 Ga0439440_0046290
489 Ga0466967_0049223
490 Ga0495592_0525447
491 Ga0496110_1437071
492 Ga0496112_0197209
493 Ga0496112_0709240
494 Ga0496126_0055725
495 Ga0501032_0872175
496 Ga0501034_0001551
497 Ga0501034_0010209
498 Ga0501034_0026966
499 Ga0501034_0083613
500 Ga0501034_1248503
501 Ga0501034_1360726
502 Ga0501043_0542467
503 Ga0501046_0376621
504 Ga0501047_0267670
505 Ga0501068_0092821
506 Ga0501070_0255502
507 Ga0501070_0364570
508 Ga0501070_1398890
509 Ga0501080_0219077
510 Ga0501044_0027504
511 Ga0501044_1106463
512 nmdc:mga03683_2410_c1
513 nmdc:mga03683_269465_c1
514 nmdc:mga03683_375658_c1
515 nmdc:mga03n38_176991_c1
516 nmdc:mga03n38_344089_c1
517 nmdc:mga03n38_348051_c1
518 nmdc:mga00v17_390883_c1
519 nmdc:mga0yw44_1022005_c1
520 nmdc:mga0yw44_1222378_c1
521 nmdc:mga0k408_285315_c1
522 nmdc:mga04h51_193027_c1
523 nmdc:mga04h51_274811_c1
524 nmdc:mga07m45_231384_c1
525 nmdc:mga07m45_381849_c1
526 nmdc:mga07m45_453924_c1
527 nmdc:mga08y16_295350_c1
528 nmdc:mga0sz30_42462_c1
529 nmdc:mga0sz30_67845_c1
530 Ga0500583_0505043
531 Ga0500641_0067448
532 Ga0500557_220285
533 Ga0500655_061584
534 Ga0500658_0028942
535 Ga0500604_0094492
536 Ga0500616_0004096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08570

DUF1761

Protein of unknown function (DUF1761)

9

141

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i2z-assembly1.cif.gz_B isolated globin domain of the bordetella pertussis globin-coupled sensor 0.4147 8 133
6m9a-assembly1.cif.gz_C-2 bordetella pertussis globin coupled sensor regulatory domain (bpegreg) 0.4002 8 139
6m9a-assembly1.cif.gz_C-2 bordetella pertussis globin coupled sensor regulatory domain (bpegreg) 0.3807 8 139
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.3806 2 135
6i2z-assembly1.cif.gz_B isolated globin domain of the bordetella pertussis globin-coupled sensor 0.3756 8 133
ID Description Score Start End Superfamily
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7044 14 135 1.20.120.550
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6281 14 135 1.20.120.550
af_D4ACC3_12_148_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4918 58 129 1.10.1760.20
af_E7FF19_1_301_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4766 8 135 1.20.1250.20
af_P28246_11_389_1.20.1720.10 Mainly Alpha;Up-down Bundle;Multidrug resistance protein D;Multidrug resistance protein D 0.4268 3 133 1.20.1720.10
ID Description Score Start End GO Terms
AF-A0A4R9LNN9-F1-model_v4 DUF1761 domain-containing protein 0.9503 6 136 GO:0016020
AF-A0A4Q3TE27-F1-model_v4 DUF1761 domain-containing protein 0.9447 3 138 GO:0016020
AF-A0A1H1HN90-F1-model_v4 DUF1761 domain-containing protein 0.9438 5 135 GO:0016020
AF-A0A6L5Z5A7-F1-model_v4 DUF1761 family protein 0.9434 6 135 GO:0016020
AF-A0A6N9AN32-F1-model_v4 DUF1761 domain-containing protein 0.9402 4 135 GO:0016020

Map