F375534

General Info

Members Datasets Scaffolds Average Seq Length
268 189 537 73

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1003738|Ga0182006_10037388
Length 67
Sequence MKKPKQKKLVLFCSIAFTAILFTSCTSVKGYQKGKINDSEMVLSNRKIEKTELSFQSYREGGGCGCN

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
115 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
116 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
159 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
160 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
168 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
172 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
173 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
174 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
175 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
176 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
177 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
178 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
179 2738541278 Niastella sp. CF465 Isolate Unclassified
180 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
181 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
182 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
183 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
184 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
185 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
186 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
187 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
188 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
189 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.28
Metatranscriptomes 0.37
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.67
Nodule 0
Rhizoplane 4.1
Rhizosphere 62.31
Stem 0
Stem Tuber 0
Unclassified 21.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1003738 3300015261 Bacteria 7685
2 JGI24736J21556_1006011 3300001904 Unclassified 2048
3 JGI24740J21852_10137470 3300001979 Bacteria 609
4 JGI24737J22298_10019029 3300001990 Bacteria 2197
5 JGI24735J21928_10005473 3300002067 Bacteria 4212
6 JGI24751J29686_10000335 3300002459 Bacteria 17022
7 rootH1_10178882 3300003316 Bacteria 1440
8 rootH2_10143945 3300003320 Bacteria 7753
9 rootH2_10150697 3300003320 Bacteria 1982
10 rootL2_10085798 3300003322 Bacteria 11878
11 rootH1_10029004 3300003316 Bacteria 1936
12 rootH1_10029004 3300003323 Bacteria 45866
13 rootH1_10145983 3300003323 Bacteria 2751
14 rootH1_10148156 3300003323 Bacteria 4242
15 rootH1_10280854 3300003323 Bacteria 2371
16 Ga0006562J51391_1007671 3300003578 Bacteria 3845
17 Ga0055535_1003103 3300003761 Bacteria 5012
18 Ga0055542_1010534 3300003762 Unclassified 1684
19 Ga0055531_10000104 3300003794 Bacteria 92278
20 Ga0065714_10064592 3300005288 Bacteria 30958
21 Ga0065714_10129771 3300005288 Bacteria 1261
22 Ga0065714_10150368 3300005288 Bacteria 1109
23 Ga0065714_10450076 3300005288 Bacteria 554
24 Ga0065704_10126310 3300005289 Bacteria 1691
25 Ga0065704_10771297 3300005289 Bacteria 533
26 Ga0065715_10461403 3300005293 Bacteria 815
27 Ga0065715_11046788 3300005293 Bacteria 533
28 Ga0070658_10134503 3300005327 Bacteria 2062
29 Ga0070658_10297301 3300005327 Unclassified 1376
30 Ga0070670_100390375 3300005331 Bacteria 1227
31 Ga0070670_100572023 3300005331 Bacteria 1009
32 Ga0070660_100778052 3300005339 Bacteria 804
33 Ga0070691_10070880 3300005341 Bacteria 1691
34 Ga0070675_100055191 3300005354 Bacteria 3270
35 Ga0070673_101445861 3300005364 Unclassified 648
36 Ga0070659_100435752 3300005366 Bacteria 1110
37 Ga0070700_100449049 3300005441 Bacteria 981
38 Ga0070663_101564506 3300005455 Bacteria 587
39 Ga0068867_101857732 3300005459 Unclassified 567
40 Ga0068853_100645430 3300005539 Bacteria 1007
41 Ga0068853_101501455 3300005539 Unclassified 652
42 Ga0070672_101814587 3300005543 Bacteria 548
43 Ga0070686_100092835 3300005544 Unclassified 2022
44 Ga0068855_100000302 3300005563 Bacteria 61501
45 Ga0068855_100692496 3300005563 Bacteria 1091
46 Ga0068857_100502417 3300005577 Bacteria 1138
47 Ga0068854_101183167 3300005578 Bacteria 684
48 Ga0068852_100153544 3300005616 Unclassified 2143
49 Ga0068859_100274520 3300005617 Bacteria 1778
50 Ga0068859_102049611 3300005617 Unclassified 632
51 Ga0068859_102819616 3300005617 Bacteria 533
52 Ga0068864_100006576 3300005618 Bacteria 9517
53 Ga0068864_102090881 3300005618 Unclassified 573
54 Ga0068851_10201693 3300005834 Unclassified 1110
55 Ga0068863_100244616 3300005841 Bacteria 1732
56 Ga0068863_100470786 3300005841 Bacteria 1235
57 Ga0068860_100093690 3300005843 Unclassified 2863
58 Ga0068862_100399883 3300005844 Bacteria 1285
59 Ga0075429_100958430 3300006880 Bacteria 748
60 Ga0068865_100769845 3300006881 Unclassified 828
61 Ga0097620_100274513 3300006931 Bacteria 1778
62 Ga0097620_102048893 3300006931 Unclassified 632
63 Ga0097620_102817647 3300006931 Bacteria 533
64 Ga0075435_100384715 3300007076 Bacteria 1205
65 Ga0105244_10093198 3300009036 Bacteria 1480
66 Ga0105242_10414600 3300009176 Bacteria 1260
67 Ga0105249_10093095 3300009553 Bacteria 2822
68 Ga0105249_12528084 3300009553 Unclassified 586
69 Ga0157373_10000464 3300013100 Bacteria 32220
70 Ga0157371_10000749 3300013102 Bacteria 37566
71 Ga0157370_10000073 3300013104 Bacteria 109460
72 Ga0157370_10002241 3300013104 Bacteria 23522
73 Ga0157370_10013044 3300013104 Bacteria 8581
74 Ga0157370_10017422 3300013104 Bacteria 7248
75 Ga0157370_12095112 3300013104 Bacteria 507
76 Ga0157369_10000575 3300013105 Bacteria 48226
77 Ga0157369_10079952 3300013105 Unclassified 3501
78 Ga0157374_12447787 3300013296 Bacteria 549
79 Ga0157374_12628200 3300013296 Bacteria 531
80 Ga0157378_10408271 3300013297 Bacteria 1340
81 Ga0157378_11002274 3300013297 Bacteria 870
82 Ga0157372_10001047 3300013307 Bacteria 30262
83 Ga0157375_11005357 3300013308 Bacteria 973
84 Ga0163163_10620514 3300014325 Bacteria 1145
85 Ga0163163_11680350 3300014325 Unclassified 696
86 Ga0157380_10387222 3300014326 Bacteria 1322
87 Ga0157380_12947294 3300014326 Bacteria 542
88 Ga0157377_11440972 3300014745 Bacteria 545
89 Ga0157376_10171656 3300014969 Bacteria 1975
90 Ga0182006_1059224 3300015261 Bacteria 1450
91 Ga0213876_10005503 3300021384 Bacteria 6952
92 Ga0207427_119748 3300025231 Bacteria 611
93 Ga0209258_100252 3300025242 Bacteria 97179
94 Ga0209646_1016772 3300025246 Unclassified 1084
95 Ga0209148_1000217 3300025254 Bacteria 98076
96 Ga0209257_1000013 3300025304 Bacteria 1047305
97 Ga0207697_10119692 3300025315 Bacteria 1132
98 Ga0207656_10494230 3300025321 Unclassified 621
99 Ga0207647_10000043 3300025904 Bacteria 91109
100 Ga0207654_11074168 3300025911 Unclassified 586
101 Ga0207650_10890735 3300025925 Unclassified 755
102 Ga0207650_11004097 3300025925 Bacteria 710
103 Ga0207659_11828206 3300025926 Bacteria 516
104 Ga0207690_11284973 3300025932 Unclassified 611
105 Ga0207661_11349489 3300025944 Bacteria 655
106 Ga0207679_11815764 3300025945 Bacteria 557
107 Ga0207667_10003734 3300025949 Bacteria 18783
108 Ga0207667_10618029 3300025949 Bacteria 1091
109 Ga0207712_10088006 3300025961 Bacteria 2279
110 Ga0207712_11375868 3300025961 Unclassified 631
111 Ga0207712_11759593 3300025961 Unclassified 555
112 Ga0207639_11074510 3300026041 Bacteria 754
113 Ga0207641_10121373 3300026088 Bacteria 2333
114 Ga0207648_11690137 3300026089 Bacteria 594
115 Ga0207676_10048576 3300026095 Bacteria 3295
116 Ga0207676_11444388 3300026095 Unclassified 684
117 Ga0207674_10323114 3300026116 Bacteria 1493
118 Ga0207675_101642365 3300026118 Bacteria 663
119 Ga0207698_11165864 3300026142 Unclassified 784
120 Ga0268266_10000016 3300028379 Bacteria 629101
121 Ga0268265_11515367 3300028380 Bacteria 674
122 Ga0268265_12148565 3300028380 Bacteria 565
123 Ga0268264_10000080 3300028381 Bacteria 249126
124 Ga0268264_10212200 3300028381 Unclassified 1778
125 Ga0307517_10111651 3300028786 Bacteria 2076
126 Ga0307515_10525322 3300028794 Bacteria 793
127 Ga0307512_10300545 3300030522 Unclassified 748
128 Ga0265327_10355956 3300031251 Bacteria 639
129 Ga0307513_10072929 3300031456 Bacteria 3576
130 Ga0307509_10102525 3300031507 Bacteria 2893
131 Ga0307509_10575856 3300031507 Bacteria 801
132 Ga0307508_10446310 3300031616 Bacteria 886
133 Ga0307508_10700820 3300031616 Bacteria 622
134 Ga0307508_10869563 3300031616 Bacteria 525
135 Ga0307516_10306321 3300031730 Bacteria 1263
136 Ga0307405_10000002 3300031731 Bacteria 575196
137 Ga0307410_10000074 3300031852 Bacteria 34345
138 Ga0307406_10014604 3300031901 Bacteria 4522
139 Ga0307409_102503560 3300031995 Bacteria 545
140 Ga0307414_10001289 3300032004 Bacteria 12953
141 Ga0307510_10179212 3300033180 Bacteria 1684
142 Ga0373927_0094282 3300035695 Bacteria 1945
143 Ga0373937_1165209 3300036401 Bacteria 719
144 Ga0373925_0706252 3300037068 Bacteria 831
145 Ga0395900_1234881 3300037418 Unclassified 662
146 Ga0395905_1099039 3300037471 Unclassified 698
147 Ga0395901_0075895 3300038443 Bacteria 3507
148 Ga0436365_0457865 3300039437 Bacteria 1524
149 Ga0436365_0720735 3300039437 Unclassified 2776
150 Ga0436365_1209857 3300039437 Bacteria 949
151 Ga0436365_1743396 3300039437 Bacteria 55864
152 Ga0451793_0101961 3300041452 Bacteria 708
153 Ga0451793_0972277 3300041452 Bacteria 594
154 Ga0451793_1649510 3300041452 Bacteria 1291
155 Ga0451797_0428943 3300041453 Unclassified 842
156 Ga0451800_1518574 3300041459 Bacteria 605
157 Ga0451804_0371327 3300041463 Bacteria 924
158 Ga0451804_0693970 3300041463 Bacteria 516
159 Ga0451807_0090642 3300041486 Bacteria 723
160 Ga0451807_2098309 3300041486 Bacteria 624
161 Ga0451807_2768889 3300041486 Bacteria 621
162 Ga0451837_1495203 3300041494 Bacteria 870
163 Ga0451841_0430544 3300041498 Bacteria 1298
164 Ga0451841_0958041 3300041498 Bacteria 511
165 Ga0451849_0203026 3300041505 Bacteria 847
166 Ga0451849_0866106 3300041505 Bacteria 796
167 Ga0451849_0964599 3300041505 Bacteria 557
168 Ga0451843_1027579 3300041509 Unclassified 569
169 Ga0451843_1633812 3300041509 Bacteria 559
170 Ga0451853_3139791 3300041512 Bacteria 705
171 Ga0451853_3527723 3300041512 Bacteria 661
172 Ga0466972_0004999 3300044658 Bacteria 6648
173 Ga0453683_0090504 3300044673 Bacteria 1918
174 Ga0453684_0149220 3300044712 Bacteria 2781
175 Ga0495638_0291509 3300046460 Unclassified 883
176 Ga0495638_0426346 3300046460 Unclassified 682
177 Ga0495610_0112409 3300046512 Bacteria 1205
178 Ga0495610_0279460 3300046512 Bacteria 651
179 Ga0495632_0114253 3300046519 Bacteria 1266
180 Ga0495632_0143410 3300046519 Bacteria 1107
181 Ga0495643_0011106 3300046522 Bacteria 5505
182 Ga0495643_0107997 3300046522 Bacteria 1418
183 Ga0495648_0014901 3300046524 Bacteria 5664
184 Ga0495609_0000058 3300046538 Bacteria 143601
185 Ga0495633_0004790 3300046558 Bacteria 8482
186 Ga0495668_0002446 3300046616 Bacteria 15264
187 Ga0495611_0068822 3300046648 Bacteria 1616
188 Ga0495625_0010370 3300046660 Bacteria 7717
189 Ga0495658_0456164 3300046683 Bacteria 817
190 Ga0495600_0329630 3300046809 Bacteria 959
191 Ga0495687_000004 3300047443 Bacteria 779298
192 Ga0496101_1162589 3300048904 Bacteria 605
193 Ga0496116_0000390 3300048919 Bacteria 64244
194 Ga0496124_0125960 3300048927 Bacteria 2040
195 Ga0496125_0000567 3300048928 Bacteria 63543
196 Ga0496126_0000804 3300048929 Bacteria 56196
197 Ga0496126_0002856 3300048929 Bacteria 22579
198 Ga0496126_0691439 3300048929 Unclassified 794
199 Ga0495682_0224616 3300049460 Unclassified 665
200 Ga0501034_0000410 3300049571 Bacteria 72148
201 Ga0501037_0205700 3300049573 Bacteria 1389
202 Ga0501043_0425399 3300049579 Bacteria 1001
203 Ga0501043_1248579 3300049579 Unclassified 520
204 Ga0501047_0032528 3300049581 Bacteria 5035
205 Ga0501047_0073698 3300049581 Unclassified 3287
206 Ga0501047_0089689 3300049581 Bacteria 2952
207 Ga0501048_0561032 3300049582 Unclassified 819
208 Ga0501048_0598209 3300049582 Bacteria 792
209 Ga0501207_091957 3300049654 Bacteria 598
210 Ga0501249_000001 3300049679 Bacteria 268580
211 Ga0501249_103697 3300049679 Bacteria 683
212 Ga0501257_002279 3300049686 Bacteria 4026
213 Ga0501280_000905 3300049776 Bacteria 6315
214 Ga0501035_0153790 3300049822 Unclassified 1994
215 Ga0501035_0234730 3300049822 Bacteria 1562
216 Ga0501044_0225308 3300049823 Unclassified 1824
217 Ga0501044_1133559 3300049823 Unclassified 651
218 nmdc:mga0k408_30718_c1 3300050493 Bacteria 3064
219 Ga0500578_0343674 3300053086 Bacteria 874
220 Ga0500644_0000101 3300053088 Bacteria 54447
221 Ga0500646_0023854 3300053090 Bacteria 1643
222 Ga0500646_0133015 3300053090 Unclassified 810
223 Ga0500583_0000290 3300053092 Bacteria 17375
224 Ga0500583_0000882 3300053092 Bacteria 8642
225 Ga0500583_0009590 3300053092 Bacteria 3549
226 Ga0500583_0015989 3300053092 Bacteria 2984
227 Ga0500651_0289336 3300053093 Bacteria 943
228 Ga0500651_0392340 3300053093 Unclassified 781
229 Ga0500641_0000014 3300053096 Bacteria 150696
230 Ga0500641_0000017 3300053096 Bacteria 132678
231 Ga0500648_402534 3300053097 Unclassified 518
232 Ga0500594_0224306 3300053118 Unclassified 622
233 Ga0500607_055454 3300053121 Unclassified 2095
234 Ga0500642_0158389 3300053130 Bacteria 1062
235 Ga0500642_0309376 3300053130 Bacteria 711
236 Ga0500658_0000003 3300053134 Bacteria 512506
237 Ga0500658_0147213 3300053134 Unclassified 1060
238 Ga0500658_0243651 3300053134 Unclassified 826
239 Ga0500559_0016923 3300053136 Bacteria 3080
240 Ga0500568_0066996 3300053139 Unclassified 1380
241 Ga0500603_189484 3300053150 Unclassified 649
242 Ga0500622_0006148 3300053156 Bacteria 7044
243 Ga0500622_0036541 3300053156 Bacteria 2567
244 Ga0500622_0267517 3300053156 Bacteria 742
245 Ga0500627_0057458 3300053158 Bacteria 1707
246 Ga0500627_0445177 3300053158 Unclassified 546
247 Ga0500639_244189 3300053163 Unclassified 726
248 Ga0500636_0160265 3300053177 Unclassified 1227
249 Ga0500637_0115506 3300053178 Unclassified 1557
250 Ga0500570_220585 3300053724 Unclassified 544
251 Ga0500584_032153 3300053726 Bacteria 2433
252 Ga0500587_023065 3300053739 Bacteria 821
253 2587866575 2585428095 Bacteria 3789702
254 2588234068 2585428187 Bacteria 4629388
255 2644372563 2643221667 Bacteria 5627472
256 2644640782 2643221716 Bacteria 4986332
257 2644683206 2643221725 Bacteria 5087956
258 2738731249 2738541278 Bacteria 9755573
259 2802652904 2802428842 Bacteria 4926114
260 2902050016 2902048731 Bacteria 4976191
261 2904421302 2904419702 Bacteria 5166287
262 2919195431 2919191525 Bacteria 5765973
263 2958461009 2958458903 Bacteria 5301041
264 2958462971 2958458903 Bacteria 5301041
265 2958512143 2958512119 Bacteria 4528530
266 2965320915 2965320100 Bacteria 3975600
267 2977270995 2977268062 Bacteria 5243061
268 8054310217 8054307821 Bacteria 5212224
269 8056442456 8056440228 Bacteria 4946504
270 Ga0182006_1003738
271 JGI24736J21556_1006011
272 JGI24740J21852_10137470
273 JGI24737J22298_10019029
274 JGI24735J21928_10005473
275 JGI24751J29686_10000335
276 rootH1_10178882
277 rootH2_10143945
278 rootH2_10150697
279 rootL2_10085798
280 rootH1_10029004
281 rootH1_10145983
282 rootH1_10148156
283 rootH1_10280854
284 Ga0006562J51391_1007671
285 Ga0055535_1003103
286 Ga0055542_1010534
287 Ga0055531_10000104
288 Ga0065714_10064592
289 Ga0065714_10129771
290 Ga0065714_10150368
291 Ga0065714_10450076
292 Ga0065704_10126310
293 Ga0065704_10771297
294 Ga0065715_10461403
295 Ga0065715_11046788
296 Ga0070658_10134503
297 Ga0070658_10297301
298 Ga0070670_100390375
299 Ga0070670_100572023
300 Ga0070660_100778052
301 Ga0070691_10070880
302 Ga0070675_100055191
303 Ga0070673_101445861
304 Ga0070659_100435752
305 Ga0070700_100449049
306 Ga0070663_101564506
307 Ga0068867_101857732
308 Ga0068853_100645430
309 Ga0068853_101501455
310 Ga0070672_101814587
311 Ga0070686_100092835
312 Ga0068855_100000302
313 Ga0068855_100692496
314 Ga0068857_100502417
315 Ga0068854_101183167
316 Ga0068852_100153544
317 Ga0068859_100274520
318 Ga0068859_102049611
319 Ga0068859_102819616
320 Ga0068864_100006576
321 Ga0068864_102090881
322 Ga0068851_10201693
323 Ga0068863_100244616
324 Ga0068863_100470786
325 Ga0068860_100093690
326 Ga0068862_100399883
327 Ga0075429_100958430
328 Ga0068865_100769845
329 Ga0097620_100274513
330 Ga0097620_102048893
331 Ga0097620_102817647
332 Ga0075435_100384715
333 Ga0105244_10093198
334 Ga0105242_10414600
335 Ga0105249_10093095
336 Ga0105249_12528084
337 Ga0157373_10000464
338 Ga0157371_10000749
339 Ga0157370_10000073
340 Ga0157370_10002241
341 Ga0157370_10013044
342 Ga0157370_10017422
343 Ga0157370_12095112
344 Ga0157369_10000575
345 Ga0157369_10079952
346 Ga0157374_12447787
347 Ga0157374_12628200
348 Ga0157378_10408271
349 Ga0157378_11002274
350 Ga0157372_10001047
351 Ga0157375_11005357
352 Ga0163163_10620514
353 Ga0163163_11680350
354 Ga0157380_10387222
355 Ga0157380_12947294
356 Ga0157377_11440972
357 Ga0157376_10171656
358 Ga0182006_1059224
359 Ga0213876_10005503
360 Ga0207427_119748
361 Ga0209258_100252
362 Ga0209646_1016772
363 Ga0209148_1000217
364 Ga0209257_1000013
365 Ga0207697_10119692
366 Ga0207656_10494230
367 Ga0207647_10000043
368 Ga0207654_11074168
369 Ga0207650_10890735
370 Ga0207650_11004097
371 Ga0207659_11828206
372 Ga0207690_11284973
373 Ga0207661_11349489
374 Ga0207679_11815764
375 Ga0207667_10003734
376 Ga0207667_10618029
377 Ga0207712_10088006
378 Ga0207712_11375868
379 Ga0207712_11759593
380 Ga0207639_11074510
381 Ga0207641_10121373
382 Ga0207648_11690137
383 Ga0207676_10048576
384 Ga0207676_11444388
385 Ga0207674_10323114
386 Ga0207675_101642365
387 Ga0207698_11165864
388 Ga0268266_10000016
389 Ga0268265_11515367
390 Ga0268265_12148565
391 Ga0268264_10000080
392 Ga0268264_10212200
393 Ga0307517_10111651
394 Ga0307515_10525322
395 Ga0307512_10300545
396 Ga0265327_10355956
397 Ga0307513_10072929
398 Ga0307509_10102525
399 Ga0307509_10575856
400 Ga0307508_10446310
401 Ga0307508_10700820
402 Ga0307508_10869563
403 Ga0307516_10306321
404 Ga0307405_10000002
405 Ga0307410_10000074
406 Ga0307406_10014604
407 Ga0307409_102503560
408 Ga0307414_10001289
409 Ga0307510_10179212
410 Ga0373927_0094282
411 Ga0373937_1165209
412 Ga0373925_0706252
413 Ga0395900_1234881
414 Ga0395905_1099039
415 Ga0395901_0075895
416 Ga0436365_0457865
417 Ga0436365_0720735
418 Ga0436365_1209857
419 Ga0436365_1743396
420 Ga0451793_0101961
421 Ga0451793_0972277
422 Ga0451793_1649510
423 Ga0451797_0428943
424 Ga0451800_1518574
425 Ga0451804_0371327
426 Ga0451804_0693970
427 Ga0451807_0090642
428 Ga0451807_2098309
429 Ga0451807_2768889
430 Ga0451837_1495203
431 Ga0451841_0430544
432 Ga0451841_0958041
433 Ga0451849_0203026
434 Ga0451849_0866106
435 Ga0451849_0964599
436 Ga0451843_1027579
437 Ga0451843_1633812
438 Ga0451853_3139791
439 Ga0451853_3527723
440 Ga0466972_0004999
441 Ga0453683_0090504
442 Ga0453684_0149220
443 Ga0495638_0291509
444 Ga0495638_0426346
445 Ga0495610_0112409
446 Ga0495610_0279460
447 Ga0495632_0114253
448 Ga0495632_0143410
449 Ga0495643_0011106
450 Ga0495643_0107997
451 Ga0495648_0014901
452 Ga0495609_0000058
453 Ga0495633_0004790
454 Ga0495668_0002446
455 Ga0495611_0068822
456 Ga0495625_0010370
457 Ga0495658_0456164
458 Ga0495600_0329630
459 Ga0495687_000004
460 Ga0496101_1162589
461 Ga0496116_0000390
462 Ga0496124_0125960
463 Ga0496125_0000567
464 Ga0496126_0000804
465 Ga0496126_0002856
466 Ga0496126_0691439
467 Ga0495682_0224616
468 Ga0501034_0000410
469 Ga0501037_0205700
470 Ga0501043_0425399
471 Ga0501043_1248579
472 Ga0501047_0032528
473 Ga0501047_0073698
474 Ga0501047_0089689
475 Ga0501048_0561032
476 Ga0501048_0598209
477 Ga0501207_091957
478 Ga0501249_000001
479 Ga0501249_103697
480 Ga0501257_002279
481 Ga0501280_000905
482 Ga0501035_0153790
483 Ga0501035_0234730
484 Ga0501044_0225308
485 Ga0501044_1133559
486 nmdc:mga0k408_30718_c1
487 Ga0500578_0343674
488 Ga0500644_0000101
489 Ga0500646_0023854
490 Ga0500646_0133015
491 Ga0500583_0000290
492 Ga0500583_0000882
493 Ga0500583_0009590
494 Ga0500583_0015989
495 Ga0500651_0289336
496 Ga0500651_0392340
497 Ga0500641_0000014
498 Ga0500641_0000017
499 Ga0500648_402534
500 Ga0500594_0224306
501 Ga0500607_055454
502 Ga0500642_0158389
503 Ga0500642_0309376
504 Ga0500658_0000003
505 Ga0500658_0147213
506 Ga0500658_0243651
507 Ga0500559_0016923
508 Ga0500568_0066996
509 Ga0500603_189484
510 Ga0500622_0006148
511 Ga0500622_0036541
512 Ga0500622_0267517
513 Ga0500627_0057458
514 Ga0500627_0445177
515 Ga0500639_244189
516 Ga0500636_0160265
517 Ga0500637_0115506
518 Ga0500570_220585
519 Ga0500584_032153
520 Ga0500587_023065
521 2587866575
522 2588234068
523 2644372563
524 2644640782
525 2644683206
526 2738731249
527 2802652904
528 2902050016
529 2904421302
530 2919195431
531 2958461009
532 2958462971
533 2958512143
534 2965320915
535 2977270995
536 8054310217
537 8056442456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map