F375363

General Info

Members Datasets Scaffolds Average Seq Length
268 171 265 259

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100146400|Ga0068857_1001464002
Length 278
Sequence VSDLVRPTAATWLIRICSMPKARKNALITGASLGIGRELAKLFAADQYDLVLVARDANRLAQFANELQQPFGINAKCFPLDLAASSAPQFLFDQLWRENIGIDVLVNNAGFGKLGAFSAVSVEDSLGQIQLNIVALTHLTRLFVNPMLERKSGKILNVASTAGFQPGPTMAVYYATKAYVISFSEAIASEVRGTGVSVTCLCPGATDTNFQKIAGTEETTLFRRLRPMNAATVARDGYRGLMKGKPLVISGFRNWLLTESLRLSPRRLVTEVSRKILE

Samples

Sample ID Description Type Environment
1 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
2 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.87
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10219908 3300003323 Bacteria 1337
2 Ga0070676_10092810 3300005328 Bacteria 1852
3 Ga0070683_100014185 3300005329 Bacteria 6962
4 Ga0070683_100115793 3300005329 Unclassified 2531
5 Ga0070683_100254805 3300005329 Bacteria 1669
6 Ga0070690_100097109 3300005330 Bacteria 1948
7 Ga0070670_100001706 3300005331 Bacteria 17892
8 Ga0070670_100095231 3300005331 Bacteria 2561
9 Ga0068869_100011734 3300005334 Bacteria 5760
10 Ga0070680_100261069 3300005336 Bacteria 1465
11 Ga0070680_100328533 3300005336 Bacteria 1299
12 Ga0068868_100017613 3300005338 Bacteria 5327
13 Ga0068868_100051856 3300005338 Bacteria 3229
14 Ga0068868_100758150 3300005338 Bacteria 872
15 Ga0070660_100509569 3300005339 Bacteria 1001
16 Ga0070689_100148420 3300005340 Unclassified 1890
17 Ga0070689_100220511 3300005340 Bacteria 1555
18 Ga0070687_100041081 3300005343 Bacteria 2335
19 Ga0070687_100322316 3300005343 Unclassified 988
20 Ga0070675_100205562 3300005354 Bacteria 1710
21 Ga0070671_100020969 3300005355 Bacteria 5331
22 Ga0070671_100032659 3300005355 Bacteria 4301
23 Ga0070674_100050415 3300005356 Bacteria 2866
24 Ga0070674_100129520 3300005356 Bacteria 1879
25 Ga0070673_100072585 3300005364 Bacteria 2768
26 Ga0070659_100083237 3300005366 Bacteria 2557
27 Ga0070714_100313906 3300005435 Bacteria 1464
28 Ga0070714_100729098 3300005435 Bacteria 957
29 Ga0070713_100084638 3300005436 Bacteria 2714
30 Ga0070713_100456177 3300005436 Unclassified 1201
31 Ga0070711_100000865 3300005439 Bacteria 15917
32 Ga0070708_100100908 3300005445 Bacteria 2642
33 Ga0070708_100449897 3300005445 Bacteria 1215
34 Ga0070678_100245736 3300005456 Bacteria 1498
35 Ga0070662_100018221 3300005457 Bacteria 4747
36 Ga0070681_10000513 3300005458 Bacteria 31715
37 Ga0070681_10001443 3300005458 Bacteria 20931
38 Ga0070681_10071265 3300005458 Bacteria 3440
39 Ga0068867_100053195 3300005459 Bacteria 2990
40 Ga0068867_100384957 3300005459 Bacteria 1179
41 Ga0070685_10109124 3300005466 Bacteria 1702
42 Ga0070706_100164177 3300005467 Unclassified 2074
43 Ga0070706_100336731 3300005467 Bacteria 1407
44 Ga0070707_100102198 3300005468 Unclassified 2777
45 Ga0070707_100115382 3300005468 Bacteria 2606
46 Ga0070698_100417287 3300005471 Bacteria 1276
47 Ga0070679_100008087 3300005530 Bacteria 9887
48 Ga0070679_100185507 3300005530 Bacteria 2051
49 Ga0070684_100034929 3300005535 Unclassified 4301
50 Ga0070684_100089161 3300005535 Bacteria 2741
51 Ga0070684_100167643 3300005535 Bacteria 1994
52 Ga0070697_100000119 3300005536 Bacteria 61992
53 Ga0070697_100038452 3300005536 Bacteria 3866
54 Ga0068853_100487770 3300005539 Bacteria 1162
55 Ga0070672_100032826 3300005543 Bacteria 3923
56 Ga0070686_100075428 3300005544 Bacteria 2218
57 Ga0070686_100145866 3300005544 Bacteria 1652
58 Ga0070695_100303807 3300005545 Bacteria 1180
59 Ga0070696_100333532 3300005546 Bacteria 1170
60 Ga0070693_100103247 3300005547 Bacteria 1740
61 Ga0068855_100000412 3300005563 Bacteria 52997
62 Ga0068855_100000425 3300005563 Bacteria 52146
63 Ga0068855_100018276 3300005563 Bacteria 8420
64 Ga0070664_100005786 3300005564 Bacteria 9974
65 Ga0068857_100002572 3300005577 Bacteria 14860
66 Ga0068857_100005929 3300005577 Bacteria 10432
67 Ga0068857_100146400 3300005577 Bacteria 2137
68 Ga0068854_100004475 3300005578 Bacteria 8814
69 Ga0068854_100020751 3300005578 Bacteria 4452
70 Ga0068856_100000670 3300005614 Bacteria 37158
71 Ga0068856_100000708 3300005614 Bacteria 36263
72 Ga0068856_100001577 3300005614 Bacteria 23871
73 Ga0068852_100104839 3300005616 Bacteria 2560
74 Ga0068852_100243972 3300005616 Bacteria 1718
75 Ga0068859_100000279 3300005617 Bacteria 50882
76 Ga0068864_100000722 3300005618 Bacteria 27599
77 Ga0068866_10005261 3300005718 Bacteria 5333
78 Ga0068851_10019712 3300005834 Bacteria 3260
79 Ga0068863_100002208 3300005841 Bacteria 19334
80 Ga0068863_100094808 3300005841 Bacteria 2832
81 Ga0068863_100410863 3300005841 Bacteria 1325
82 Ga0068858_100002272 3300005842 Bacteria 19444
83 Ga0068858_100051476 3300005842 Bacteria 3810
84 Ga0068860_100007256 3300005843 Bacteria 11086
85 Ga0081455_10002716 3300005937 Bacteria 20888
86 Ga0081455_10003398 3300005937 Bacteria 18327
87 Ga0081455_10118191 3300005937 Bacteria 2093
88 Ga0070717_10007054 3300006028 Bacteria 8322
89 Ga0070712_100481946 3300006175 Unclassified 1037
90 Ga0097621_100000210 3300006237 Bacteria 38363
91 Ga0097621_100001848 3300006237 Bacteria 14513
92 Ga0097621_100030212 3300006237 Bacteria 4287
93 Ga0097621_100270573 3300006237 Bacteria 1493
94 Ga0068871_100000168 3300006358 Bacteria 43632
95 Ga0068871_100000787 3300006358 Bacteria 21292
96 Ga0068871_100046525 3300006358 Bacteria 3495
97 Ga0075428_100007549 3300006844 Bacteria 12051
98 Ga0075430_100112360 3300006846 Bacteria 2271
99 Ga0075431_100005968 3300006847 Bacteria 12063
100 Ga0075434_100126226 3300006871 Bacteria 2575
101 Ga0075429_100004465 3300006880 Bacteria 12038
102 Ga0075429_100262898 3300006880 Bacteria 1511
103 Ga0075436_100047303 3300006914 Bacteria 2967
104 Ga0097620_100000279 3300006931 Bacteria 50882
105 Ga0075435_100206530 3300007076 Bacteria 1665
106 Ga0105240_10060791 3300009093 Bacteria 4710
107 Ga0105240_10198550 3300009093 Bacteria 2353
108 Ga0111539_10009844 3300009094 Bacteria 12063
109 Ga0114129_10012508 3300009147 Bacteria 12083
110 Ga0105243_10249851 3300009148 Bacteria 1583
111 Ga0105241_10064628 3300009174 Bacteria 2825
112 Ga0105241_10080020 3300009174 Bacteria 2556
113 Ga0105241_10109548 3300009174 Bacteria 2208
114 Ga0105242_10466336 3300009176 Bacteria 1194
115 Ga0105248_10010479 3300009177 Bacteria 10209
116 Ga0105248_10654569 3300009177 Bacteria 1185
117 Ga0105237_10100611 3300009545 Bacteria 2882
118 Ga0105238_10000382 3300009551 Bacteria 47455
119 Ga0105239_10025445 3300010375 Bacteria 6517
120 Ga0105239_10296586 3300010375 Bacteria 1820
121 Ga0157373_10002773 3300013100 Bacteria 13254
122 Ga0157373_10037161 3300013100 Bacteria 3492
123 Ga0157371_10039293 3300013102 Bacteria 3383
124 Ga0157370_10154291 3300013104 Bacteria 2136
125 Ga0157369_10000269 3300013105 Bacteria 69979
126 Ga0157374_10000436 3300013296 Bacteria 37798
127 Ga0157374_10001029 3300013296 Bacteria 24206
128 Ga0157374_10001822 3300013296 Bacteria 17965
129 Ga0157374_10200043 3300013296 Bacteria 1956
130 Ga0157378_10000014 3300013297 Bacteria 144214
131 Ga0157378_10000413 3300013297 Bacteria 42040
132 Ga0157378_10007193 3300013297 Bacteria 9723
133 Ga0157378_10217592 3300013297 Bacteria 1814
134 Ga0157372_10000423 3300013307 Bacteria 46475
135 Ga0157372_10000641 3300013307 Bacteria 38393
136 Ga0157372_10004039 3300013307 Bacteria 15735
137 Ga0157372_10209743 3300013307 Bacteria 2257
138 Ga0157375_10808095 3300013308 Unclassified 1086
139 Ga0163163_10008646 3300014325 Bacteria 9057
140 Ga0163163_10679053 3300014325 Bacteria 1093
141 Ga0207642_10002117 3300025899 Bacteria 6143
142 Ga0207647_10022413 3300025904 Bacteria 4195
143 Ga0207684_10203691 3300025910 Unclassified 1707
144 Ga0207684_10460886 3300025910 Bacteria 1091
145 Ga0207654_10076767 3300025911 Bacteria 2001
146 Ga0207707_10000828 3300025912 Bacteria 30353
147 Ga0207707_10038831 3300025912 Bacteria 4161
148 Ga0207695_10050686 3300025913 Bacteria 4364
149 Ga0207695_10061902 3300025913 Bacteria 3866
150 Ga0207660_10181968 3300025917 Bacteria 1633
151 Ga0207662_10018552 3300025918 Unclassified 3950
152 Ga0207662_10073538 3300025918 Bacteria 2073
153 Ga0207657_10395171 3300025919 Bacteria 1088
154 Ga0207652_10276456 3300025921 Bacteria 1515
155 Ga0207652_10405877 3300025921 Bacteria 1229
156 Ga0207646_10135696 3300025922 Unclassified 2215
157 Ga0207646_10290504 3300025922 Bacteria 1477
158 Ga0207694_10000430 3300025924 Bacteria 39056
159 Ga0207650_10001691 3300025925 Bacteria 15671
160 Ga0207700_10072614 3300025928 Bacteria 2654
161 Ga0207700_10392632 3300025928 Unclassified 1215
162 Ga0207690_10331094 3300025932 Bacteria 1199
163 Ga0207706_10065123 3300025933 Bacteria 3209
164 Ga0207691_10107492 3300025940 Bacteria 2483
165 Ga0207711_10455500 3300025941 Bacteria 1191
166 Ga0207689_10063023 3300025942 Bacteria 3049
167 Ga0207661_10260218 3300025944 Bacteria 1545
168 Ga0207679_10001482 3300025945 Bacteria 14719
169 Ga0207667_10000311 3300025949 Bacteria 67671
170 Ga0207667_10005374 3300025949 Bacteria 15617
171 Ga0207667_10092633 3300025949 Bacteria 3121
172 Ga0207651_10195939 3300025960 Unclassified 1615
173 Ga0207640_10003104 3300025981 Bacteria 8931
174 Ga0207640_10030028 3300025981 Bacteria 3344
175 Ga0207677_10002452 3300026023 Bacteria 9745
176 Ga0207677_10055683 3300026023 Bacteria 2706
177 Ga0207677_10205954 3300026023 Bacteria 1567
178 Ga0207703_10001667 3300026035 Bacteria 19971
179 Ga0207703_10048055 3300026035 Unclassified 3442
180 Ga0207639_10454093 3300026041 Bacteria 1164
181 Ga0207702_10001654 3300026078 Bacteria 22011
182 Ga0207702_10002343 3300026078 Bacteria 18095
183 Ga0207702_10002543 3300026078 Bacteria 17174
184 Ga0207702_10303295 3300026078 Unclassified 1516
185 Ga0207641_10002584 3300026088 Bacteria 16638
186 Ga0207641_10031067 3300026088 Bacteria 4428
187 Ga0207641_10384502 3300026088 Bacteria 1345
188 Ga0207641_10432743 3300026088 Unclassified 1269
189 Ga0207648_10147570 3300026089 Bacteria 2075
190 Ga0207676_10003051 3300026095 Bacteria 11952
191 Ga0207674_10000788 3300026116 Bacteria 41336
192 Ga0207674_10007893 3300026116 Bacteria 12363
193 Ga0207683_10287618 3300026121 Bacteria 1503
194 Ga0207698_10101020 3300026142 Bacteria 2391
195 Ga0207698_10149960 3300026142 Bacteria 2022
196 Ga0207698_10199580 3300026142 Bacteria 1790
197 Ga0209179_1006629 3300027512 Bacteria 1877
198 Ga0207428_10006244 3300027907 Bacteria 11012
199 Ga0268264_10004971 3300028381 Bacteria 11265
200 Ga0265334_10023816 3300028573 Unclassified 2488
201 Ga0307515_10054966 3300028794 Bacteria 5831
202 Ga0265327_10002594 3300031251 Bacteria 18703
203 Ga0265327_10043196 3300031251 Bacteria 2414
204 Ga0265327_10110099 3300031251 Bacteria 1317
205 Ga0265316_10472284 3300031344 Bacteria 898
206 Ga0307408_100443089 3300031548 Bacteria 1125
207 Ga0307409_100134541 3300031995 Bacteria 2119
208 Ga0307409_100326032 3300031995 Bacteria 1439
209 Ga0307416_100145968 3300032002 Bacteria 2160
210 Ga0373926_0003096 3300035083 Bacteria 5341
211 Ga0373944_0020010 3300035089 Bacteria 1924
212 Ga0373954_0159906 3300035118 Unclassified 1102
213 Ga0373955_0040586 3300035172 Unclassified 2490
214 Ga0373931_0018672 3300035691 Unclassified 3450
215 Ga0373927_0025879 3300035695 Bacteria 3836
216 Ga0373933_0115976 3300035724 Unclassified 1674
217 Ga0373937_0018254 3300036401 Bacteria 6262
218 Ga0373937_0323405 3300036401 Bacteria 1459
219 Ga0373925_0021927 3300037068 Bacteria 4657
220 Ga0373925_0075652 3300037068 Bacteria 2552
221 Ga0436362_0808646 3300039453 Unclassified 1339
222 Ga0450890_009355 3300042127 Bacteria 1255
223 Ga0451577_0011208 3300042876 Bacteria 8501
224 Ga0451577_0059817 3300042876 Bacteria 3397
225 Ga0451577_0082896 3300042876 Unclassified 2860
226 Ga0453683_0072384 3300044673 Bacteria 2157
227 Ga0453683_0319098 3300044673 Bacteria 995
228 Ga0466961_0132219 3300044693 Unclassified 1564
229 Ga0466963_0025547 3300044694 Bacteria 3768
230 Ga0466964_0087821 3300044706 Bacteria 1348
231 Ga0453684_0000091 3300044712 Bacteria 387720
232 Ga0453684_0072560 3300044712 Bacteria 4345
233 Ga0453684_0299578 3300044712 Bacteria 1828
234 Ga0453684_0322488 3300044712 Bacteria 1749
235 Ga0453684_0347341 3300044712 Bacteria 1674
236 Ga0453684_0590950 3300044712 Bacteria 1218
237 Ga0466970_0297283 3300044765 Unclassified 910
238 Ga0466959_0042418 3300045049 Unclassified 3356
239 Ga0451576_0171817 3300045051 Bacteria 2262
240 Ga0466967_0018460 3300045976 Bacteria 5576
241 Ga0466967_0019700 3300045976 Bacteria 5432
242 Ga0466967_0188689 3300045976 Bacteria 1947
243 Ga0495580_0000337 3300046472 Bacteria 38443
244 Ga0495639_0308888 3300046475 Unclassified 789
245 Ga0495645_0189307 3300046543 Bacteria 1404
246 Ga0495676_0166310 3300047321 Bacteria 1556
247 Ga0496100_0387033 3300048903 Bacteria 1063
248 Ga0496102_0021353 3300048905 Bacteria 5726
249 Ga0496105_0237499 3300048908 Bacteria 1480
250 Ga0496112_0086233 3300048915 Bacteria 3107
251 Ga0496112_0168771 3300048915 Bacteria 2154
252 Ga0501038_0429669 3300049574 Bacteria 1018
253 Ga0501069_0119002 3300049585 Bacteria 1508
254 Ga0501202_007574 3300049652 Bacteria 1966
255 Ga0501044_0287641 3300049823 Bacteria 1576
256 nmdc:mga05p37_5061_c1 3300050507 Bacteria 5598
257 nmdc:mga09592_14604_c1 3300050508 Bacteria 6410
258 nmdc:mga09592_576621_c1 3300050508 Bacteria 965
259 nmdc:mga0qj67_101977_c1 3300050509 Bacteria 2314
260 nmdc:mga06r32_4869_c1 3300050510 Bacteria 12090
261 nmdc:mga08y16_30052_c1 3300050511 Bacteria 5722
262 nmdc:mga0n895_123993_c1 3300050512 Bacteria 2606
263 nmdc:mga0rr50_200914_c1 3300050513 Bacteria 1638
264 nmdc:mga08x19_31394_c1 3300050514 Bacteria 3341
265 Ga0466962_0064549 3300061719 Unclassified 1748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049652 Ga0501202_007574 Ga0501202_007574_1273_1950 220
2 3300046475 Ga0495639_0308888 Ga0495639_0308888_19_732 232
3 3300042876 Ga0451577_0011208 Ga0451577_0011208_7411_8193 238
4 3300044712 Ga0453684_0000091 Ga0453684_0000091_19717_20499 238
5 3300005466 Ga0070685_10109124 Ga0070685_101091242 239
6 3300005339 Ga0070660_100509569 Ga0070660_1005095691 240
7 3300005456 Ga0070678_100245736 Ga0070678_1002457362 240
8 3300005458 Ga0070681_10071265 Ga0070681_100712653 240
9 3300005539 Ga0068853_100487770 Ga0068853_1004877701 240
10 3300005563 Ga0068855_100000425 Ga0068855_10000042516 240
11 3300005616 Ga0068852_100243972 Ga0068852_1002439721 240
12 3300005841 Ga0068863_100002208 Ga0068863_10000220814 240
13 3300006237 Ga0097621_100000210 Ga0097621_10000021022 240
14 3300006358 Ga0068871_100000168 Ga0068871_10000016824 240
15 3300009093 Ga0105240_10198550 Ga0105240_101985502 240
16 3300009177 Ga0105248_10010479 Ga0105248_1001047910 240
17 3300013296 Ga0157374_10000436 Ga0157374_1000043622 240
18 3300013297 Ga0157378_10000413 Ga0157378_1000041321 240
19 3300013307 Ga0157372_10004039 Ga0157372_100040396 240
20 3300025912 Ga0207707_10038831 Ga0207707_100388313 240
21 3300025919 Ga0207657_10395171 Ga0207657_103951712 240
22 3300025921 Ga0207652_10276456 Ga0207652_102764562 240
23 3300026041 Ga0207639_10454093 Ga0207639_104540931 240
24 3300026088 Ga0207641_10002584 Ga0207641_1000258411 240
25 3300026089 Ga0207648_10147570 Ga0207648_101475703 240
26 3300026121 Ga0207683_10287618 Ga0207683_102876182 240
27 3300026142 Ga0207698_10199580 Ga0207698_101995801 240
28 3300048903 Ga0496100_0387033 Ga0496100_0387033_300_1040 240
29 iso_pu_bacteria 2910245624 2910249712 247
30 3300005937 Ga0081455_10002716 Ga0081455_1000271617 248
31 3300005937 Ga0081455_10003398 Ga0081455_100033987 248
32 3300005937 Ga0081455_10118191 Ga0081455_101181913 248
33 3300006880 Ga0075429_100262898 Ga0075429_1002628982 248
34 3300031995 Ga0307409_100134541 Ga0307409_1001345412 248
35 3300032002 Ga0307416_100145968 Ga0307416_1001459682 248
36 3300050508 nmdc:mga09592_576621_c1 nmdc:mga09592_576621_c1_144_911 248
37 iso_pu_bacteria 2866552031 2866554696 248
38 iso_pu_bacteria 8056207758 8056213979 248
39 3300042876 Ga0451577_0059817 Ga0451577_0059817_483_1247 249
40 3300044712 Ga0453684_0299578 Ga0453684_0299578_791_1555 249
41 3300036401 Ga0373937_0323405 Ga0373937_0323405_447_1208 250
42 3300046543 Ga0495645_0189307 Ga0495645_0189307_478_1239 250
43 3300005329 Ga0070683_100014185 Ga0070683_1000141857 251
44 3300005336 Ga0070680_100328533 Ga0070680_1003285332 251
45 3300005338 Ga0068868_100051856 Ga0068868_1000518563 251
46 3300005338 Ga0068868_100758150 Ga0068868_1007581501 251
47 3300005355 Ga0070671_100032659 Ga0070671_1000326593 251
48 3300005436 Ga0070713_100084638 Ga0070713_1000846383 251
49 3300005458 Ga0070681_10001443 Ga0070681_100014434 251
50 3300005530 Ga0070679_100008087 Ga0070679_1000080875 251
51 3300005530 Ga0070679_100185507 Ga0070679_1001855073 251
52 3300005535 Ga0070684_100034929 Ga0070684_1000349294 251
53 3300005535 Ga0070684_100089161 Ga0070684_1000891611 251
54 3300005563 Ga0068855_100000412 Ga0068855_10000041234 251
55 3300005577 Ga0068857_100002572 Ga0068857_1000025726 251
56 3300005578 Ga0068854_100020751 Ga0068854_1000207511 251
57 3300005614 Ga0068856_100000670 Ga0068856_1000006706 251
58 3300005614 Ga0068856_100000708 Ga0068856_1000007083 251
59 3300005616 Ga0068852_100104839 Ga0068852_1001048393 251
60 3300005834 Ga0068851_10019712 Ga0068851_100197123 251
61 3300005841 Ga0068863_100410863 Ga0068863_1004108631 251
62 3300005842 Ga0068858_100051476 Ga0068858_1000514762 251
63 3300006237 Ga0097621_100001848 Ga0097621_10000184811 251
64 3300006358 Ga0068871_100000787 Ga0068871_10000078719 251
65 3300009093 Ga0105240_10060791 Ga0105240_100607912 251
66 3300009174 Ga0105241_10109548 Ga0105241_101095482 251
67 3300009551 Ga0105238_10000382 Ga0105238_1000038233 251
68 3300010375 Ga0105239_10025445 Ga0105239_100254454 251
69 3300013105 Ga0157369_10000269 Ga0157369_1000026943 251
70 3300013296 Ga0157374_10001822 Ga0157374_1000182219 251
71 3300013297 Ga0157378_10007193 Ga0157378_100071933 251
72 3300013307 Ga0157372_10000641 Ga0157372_100006416 251
73 3300025911 Ga0207654_10076767 Ga0207654_100767673 251
74 3300025912 Ga0207707_10000828 Ga0207707_1000082810 251
75 3300025913 Ga0207695_10050686 Ga0207695_100506862 251
76 3300025913 Ga0207695_10061902 Ga0207695_100619022 251
77 3300025917 Ga0207660_10181968 Ga0207660_101819682 251
78 3300025921 Ga0207652_10405877 Ga0207652_104058771 251
79 3300025924 Ga0207694_10000430 Ga0207694_1000043015 251
80 3300025928 Ga0207700_10072614 Ga0207700_100726143 251
81 3300025949 Ga0207667_10000311 Ga0207667_1000031116 251
82 3300025949 Ga0207667_10005374 Ga0207667_1000537414 251
83 3300025981 Ga0207640_10030028 Ga0207640_100300282 251
84 3300026023 Ga0207677_10002452 Ga0207677_1000245210 251
85 3300026023 Ga0207677_10205954 Ga0207677_102059542 251
86 3300026035 Ga0207703_10048055 Ga0207703_100480552 251
87 3300026078 Ga0207702_10002343 Ga0207702_100023436 251
88 3300026078 Ga0207702_10002543 Ga0207702_100025434 251
89 3300026088 Ga0207641_10384502 Ga0207641_103845022 251
90 3300026116 Ga0207674_10007893 Ga0207674_100078938 251
91 3300026142 Ga0207698_10101020 Ga0207698_101010202 251
92 3300039453 Ga0436362_0808646 Ga0436362_0808646_457_1230 251
93 3300048905 Ga0496102_0021353 Ga0496102_0021353_1719_2495 251
94 3300048908 Ga0496105_0237499 Ga0496105_0237499_680_1456 251
95 3300005459 Ga0068867_100384957 Ga0068867_1003849572 252
96 3300009176 Ga0105242_10466336 Ga0105242_104663362 252
97 3300031251 Ga0265327_10110099 Ga0265327_101100991 252
98 3300005328 Ga0070676_10092810 Ga0070676_100928102 253
99 3300005329 Ga0070683_100115793 Ga0070683_1001157932 253
100 3300005329 Ga0070683_100254805 Ga0070683_1002548051 253
101 3300005330 Ga0070690_100097109 Ga0070690_1000971093 253
102 3300005331 Ga0070670_100001706 Ga0070670_10000170610 253
103 3300005334 Ga0068869_100011734 Ga0068869_1000117342 253
104 3300005336 Ga0070680_100261069 Ga0070680_1002610692 253
105 3300005338 Ga0068868_100017613 Ga0068868_1000176132 253
106 3300005340 Ga0070689_100148420 Ga0070689_1001484202 253
107 3300005343 Ga0070687_100041081 Ga0070687_1000410811 253
108 3300005354 Ga0070675_100205562 Ga0070675_1002055623 253
109 3300005356 Ga0070674_100129520 Ga0070674_1001295203 253
110 3300005366 Ga0070659_100083237 Ga0070659_1000832371 253
111 3300005435 Ga0070714_100313906 Ga0070714_1003139062 253
112 3300005435 Ga0070714_100729098 Ga0070714_1007290981 253
113 3300005436 Ga0070713_100456177 Ga0070713_1004561771 253
114 3300005457 Ga0070662_100018221 Ga0070662_1000182212 253
115 3300005458 Ga0070681_10000513 Ga0070681_1000051321 253
116 3300005459 Ga0068867_100053195 Ga0068867_1000531953 253
117 3300005535 Ga0070684_100167643 Ga0070684_1001676431 253
118 3300005536 Ga0070697_100000119 Ga0070697_1000001198 253
119 3300005544 Ga0070686_100075428 Ga0070686_1000754282 253
120 3300005545 Ga0070695_100303807 Ga0070695_1003038071 253
121 3300005546 Ga0070696_100333532 Ga0070696_1003335322 253
122 3300005547 Ga0070693_100103247 Ga0070693_1001032472 253
123 3300005563 Ga0068855_100018276 Ga0068855_1000182763 253
124 3300005564 Ga0070664_100005786 Ga0070664_10000578611 253
125 3300005577 Ga0068857_100005929 Ga0068857_1000059298 253
126 3300005577 Ga0068857_100146400 Ga0068857_1001464002 253
127 3300005578 Ga0068854_100004475 Ga0068854_1000044756 253
128 3300005614 Ga0068856_100001577 Ga0068856_1000015778 253
129 3300005617 Ga0068859_100000279 Ga0068859_10000027937 253
130 3300005618 Ga0068864_100000722 Ga0068864_10000072220 253
131 3300005718 Ga0068866_10005261 Ga0068866_100052613 253
132 3300005842 Ga0068858_100002272 Ga0068858_1000022723 253
133 3300005843 Ga0068860_100007256 Ga0068860_1000072568 253
134 3300006175 Ga0070712_100481946 Ga0070712_1004819461 253
135 3300006237 Ga0097621_100030212 Ga0097621_1000302122 253
136 3300006237 Ga0097621_100270573 Ga0097621_1002705732 253
137 3300006358 Ga0068871_100046525 Ga0068871_1000465253 253
138 3300006931 Ga0097620_100000279 Ga0097620_10000027937 253
139 3300009148 Ga0105243_10249851 Ga0105243_102498512 253
140 3300009174 Ga0105241_10064628 Ga0105241_100646282 253
141 3300009174 Ga0105241_10080020 Ga0105241_100800203 253
142 3300009177 Ga0105248_10654569 Ga0105248_106545691 253
143 3300009545 Ga0105237_10100611 Ga0105237_101006112 253
144 3300010375 Ga0105239_10296586 Ga0105239_102965862 253
145 3300013100 Ga0157373_10002773 Ga0157373_1000277310 253
146 3300013100 Ga0157373_10037161 Ga0157373_100371613 253
147 3300013102 Ga0157371_10039293 Ga0157371_100392935 253
148 3300013104 Ga0157370_10154291 Ga0157370_101542912 253
149 3300013296 Ga0157374_10001029 Ga0157374_1000102924 253
150 3300013296 Ga0157374_10200043 Ga0157374_102000432 253
151 3300013297 Ga0157378_10000014 Ga0157378_1000001439 253
152 3300013307 Ga0157372_10000423 Ga0157372_1000042324 253
153 3300013307 Ga0157372_10209743 Ga0157372_102097432 253
154 3300014325 Ga0163163_10679053 Ga0163163_106790532 253
155 3300025899 Ga0207642_10002117 Ga0207642_100021175 253
156 3300025904 Ga0207647_10022413 Ga0207647_100224133 253
157 3300025918 Ga0207662_10073538 Ga0207662_100735381 253
158 3300025925 Ga0207650_10001691 Ga0207650_100016918 253
159 3300025928 Ga0207700_10392632 Ga0207700_103926322 253
160 3300025932 Ga0207690_10331094 Ga0207690_103310942 253
161 3300025933 Ga0207706_10065123 Ga0207706_100651234 253
162 3300025941 Ga0207711_10455500 Ga0207711_104555002 253
163 3300025942 Ga0207689_10063023 Ga0207689_100630233 253
164 3300025944 Ga0207661_10260218 Ga0207661_102602182 253
165 3300025945 Ga0207679_10001482 Ga0207679_100014828 253
166 3300025949 Ga0207667_10092633 Ga0207667_100926334 253
167 3300025981 Ga0207640_10003104 Ga0207640_100031046 253
168 3300026023 Ga0207677_10055683 Ga0207677_100556833 253
169 3300026035 Ga0207703_10001667 Ga0207703_100016673 253
170 3300026078 Ga0207702_10001654 Ga0207702_1000165417 253
171 3300026078 Ga0207702_10303295 Ga0207702_103032952 253
172 3300026088 Ga0207641_10031067 Ga0207641_100310675 253
173 3300026095 Ga0207676_10003051 Ga0207676_1000305111 253
174 3300026116 Ga0207674_10000788 Ga0207674_100007884 253
175 3300026142 Ga0207698_10149960 Ga0207698_101499603 253
176 3300028381 Ga0268264_10004971 Ga0268264_100049714 253
177 3300028573 Ga0265334_10023816 Ga0265334_100238161 253
178 3300035118 Ga0373954_0159906 Ga0373954_0159906_201_983 253
179 3300035172 Ga0373955_0040586 Ga0373955_0040586_124_906 253
180 3300035691 Ga0373931_0018672 Ga0373931_0018672_541_1323 253
181 3300035724 Ga0373933_0115976 Ga0373933_0115976_438_1220 253
182 3300036401 Ga0373937_0018254 Ga0373937_0018254_1807_2589 253
183 3300042876 Ga0451577_0082896 Ga0451577_0082896_779_1558 253
184 3300044693 Ga0466961_0132219 Ga0466961_0132219_248_1030 253
185 3300044706 Ga0466964_0087821 Ga0466964_0087821_335_1117 253
186 3300044712 Ga0453684_0347341 Ga0453684_0347341_236_1015 253
187 3300044765 Ga0466970_0297283 Ga0466970_0297283_109_891 253
188 3300045049 Ga0466959_0042418 Ga0466959_0042418_1531_2313 253
189 3300048915 Ga0496112_0086233 Ga0496112_0086233_2249_3031 253
190 3300048915 Ga0496112_0168771 Ga0496112_0168771_445_1227 253
191 3300061719 Ga0466962_0064549 Ga0466962_0064549_568_1350 253
192 3300005340 Ga0070689_100220511 Ga0070689_1002205113 254
193 3300005343 Ga0070687_100322316 Ga0070687_1003223161 254
194 3300005355 Ga0070671_100020969 Ga0070671_1000209696 254
195 3300005364 Ga0070673_100072585 Ga0070673_1000725851 254
196 3300005445 Ga0070708_100100908 Ga0070708_1001009083 254
197 3300005467 Ga0070706_100336731 Ga0070706_1003367312 254
198 3300005468 Ga0070707_100115382 Ga0070707_1001153822 254
199 3300005543 Ga0070672_100032826 Ga0070672_1000328263 254
200 3300005544 Ga0070686_100145866 Ga0070686_1001458663 254
201 3300005841 Ga0068863_100094808 Ga0068863_1000948083 254
202 3300006028 Ga0070717_10007054 Ga0070717_100070543 254
203 3300013297 Ga0157378_10217592 Ga0157378_102175921 254
204 3300013308 Ga0157375_10808095 Ga0157375_108080951 254
205 3300014325 Ga0163163_10008646 Ga0163163_100086465 254
206 3300025918 Ga0207662_10018552 Ga0207662_100185523 254
207 3300025922 Ga0207646_10290504 Ga0207646_102905042 254
208 3300025940 Ga0207691_10107492 Ga0207691_101074922 254
209 3300025960 Ga0207651_10195939 Ga0207651_101959391 254
210 3300026088 Ga0207641_10432743 Ga0207641_104327431 254
211 3300031251 Ga0265327_10002594 Ga0265327_100025949 254
212 3300031251 Ga0265327_10043196 Ga0265327_100431962 254
213 3300031344 Ga0265316_10472284 Ga0265316_104722841 254
214 3300035695 Ga0373927_0025879 Ga0373927_0025879_2762_3544 254
215 3300037068 Ga0373925_0021927 Ga0373925_0021927_172_1011 254
216 3300044673 Ga0453683_0072384 Ga0453683_0072384_975_1757 254
217 3300045976 Ga0466967_0018460 Ga0466967_0018460_265_1050 254
218 3300046472 Ga0495580_0000337 Ga0495580_0000337_18637_19419 254
219 3300005439 Ga0070711_100000865 Ga0070711_1000008654 255
220 3300035083 Ga0373926_0003096 Ga0373926_0003096_39_857 255
221 3300035089 Ga0373944_0020010 Ga0373944_0020010_154_972 255
222 3300044673 Ga0453683_0319098 Ga0453683_0319098_82_867 255
223 3300044712 Ga0453684_0072560 Ga0453684_0072560_1740_2525 255
224 3300044712 Ga0453684_0322488 Ga0453684_0322488_657_1442 255
225 3300044712 Ga0453684_0590950 Ga0453684_0590950_370_1155 255
226 3300045051 Ga0451576_0171817 Ga0451576_0171817_905_1690 255
227 3300049574 Ga0501038_0429669 Ga0501038_0429669_93_893 255
228 3300049823 Ga0501044_0287641 Ga0501044_0287641_545_1345 255
229 3300005445 Ga0070708_100449897 Ga0070708_1004498971 256
230 3300005467 Ga0070706_100164177 Ga0070706_1001641772 256
231 3300005468 Ga0070707_100102198 Ga0070707_1001021982 256
232 3300005471 Ga0070698_100417287 Ga0070698_1004172872 256
233 3300005536 Ga0070697_100038452 Ga0070697_1000384522 256
234 3300006871 Ga0075434_100126226 Ga0075434_1001262264 256
235 3300006914 Ga0075436_100047303 Ga0075436_1000473032 256
236 3300007076 Ga0075435_100206530 Ga0075435_1002065302 256
237 3300025910 Ga0207684_10203691 Ga0207684_102036913 256
238 3300025910 Ga0207684_10460886 Ga0207684_104608861 256
239 3300025922 Ga0207646_10135696 Ga0207646_101356963 256
240 3300028794 Ga0307515_10054966 Ga0307515_100549664 256
241 3300050512 nmdc:mga0n895_123993_c1 nmdc:mga0n895_123993_c1_234_1025 256
242 3300050513 nmdc:mga0rr50_200914_c1 nmdc:mga0rr50_200914_c1_659_1450 256
243 3300050514 nmdc:mga08x19_31394_c1 nmdc:mga08x19_31394_c1_1809_2600 256
244 3300006844 Ga0075428_100007549 Ga0075428_10000754911 258
245 3300006846 Ga0075430_100112360 Ga0075430_1001123603 258
246 3300006847 Ga0075431_100005968 Ga0075431_10000596811 258
247 3300006880 Ga0075429_100004465 Ga0075429_10000446511 258
248 3300009094 Ga0111539_10009844 Ga0111539_100098444 258
249 3300009147 Ga0114129_10012508 Ga0114129_100125084 258
250 3300027512 Ga0209179_1006629 Ga0209179_10066292 258
251 3300027907 Ga0207428_10006244 Ga0207428_100062442 258
252 3300031548 Ga0307408_100443089 Ga0307408_1004430892 258
253 3300037068 Ga0373925_0075652 Ga0373925_0075652_475_1290 258
254 3300042127 Ga0450890_009355 Ga0450890_009355_203_991 258
255 3300047321 Ga0495676_0166310 Ga0495676_0166310_40_855 258
256 3300050507 nmdc:mga05p37_5061_c1 nmdc:mga05p37_5061_c1_1442_2260 258
257 3300050508 nmdc:mga09592_14604_c1 nmdc:mga09592_14604_c1_4148_4966 258
258 3300050509 nmdc:mga0qj67_101977_c1 nmdc:mga0qj67_101977_c1_916_1734 258
259 3300050510 nmdc:mga06r32_4869_c1 nmdc:mga06r32_4869_c1_1429_2247 258
260 3300050511 nmdc:mga08y16_30052_c1 nmdc:mga08y16_30052_c1_3485_4303 258
261 3300003323 rootH1_10219908 rootH1_102199082 259
262 3300005331 Ga0070670_100095231 Ga0070670_1000952312 259
263 3300005356 Ga0070674_100050415 Ga0070674_1000504152 259
264 3300031995 Ga0307409_100326032 Ga0307409_1003260322 259
265 3300044694 Ga0466963_0025547 Ga0466963_0025547_1307_2086 259
266 3300045976 Ga0466967_0019700 Ga0466967_0019700_225_1010 259
267 3300045976 Ga0466967_0188689 Ga0466967_0188689_589_1368 259
268 3300049585 Ga0501069_0119002 Ga0501069_0119002_170_955 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

24

219

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

236

0.91

PF08659

KR

KR domain

25

207

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2v-assembly2.cif.gz_D structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.912 5 222
8g93-assembly1.cif.gz_A crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9072 4 237
2q2q-assembly2.cif.gz_E-2 structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.9022 5 222
8g93-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.8998 4 240
2q2q-assembly3.cif.gz_G structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.8981 5 227
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 86 184 3.40.50.720
af_Q54CD7_32_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 4 215 3.40.50.720
af_I6Y9I3_9_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9192 5 245 3.40.50.720
af_I6YB11_7_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9184 4 234 3.40.50.720
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9173 1 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7H0G6I9-F1-model_v4 deleted 0.9976 1 259
AF-A0A5C9CYI3-F1-model_v4 deleted 0.9973 105 259
AF-A0A4R3E829-F1-model_v4 Short subunit dehydrogenase 0.9936 80 256 GO:0016491
AF-A0A354EN24-F1-model_v4 Oxidoreductase 0.9931 24 257 GO:0016491
AF-A0A527IV19-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9909 41 258 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.21 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map