F375340

General Info

Members Datasets Scaffolds Average Seq Length
268 159 536 94

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100222363|Ga0070706_1002223633
Length 102
Sequence MTSPTYDYLDGNAAAGELSKVFAMDVTAAEGQCAHCGAIKRFADTHVYMQGPGVVARCSVCQQVLLRLVSVRQHVFLDLRGMTYLTLDTAHDRPSELTHSAS

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 2.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.36
Rhizosphere 96.64
Stem 0
Stem Tuber 0
Unclassified 26.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100222363 3300005467 Bacteria 1762
2 JGI24751J29686_10000142 3300002459 Bacteria 35602
3 JGI25404J52841_10003621 3300003659 Bacteria 3067
4 JGI25404J52841_10014201 3300003659 Bacteria 1727
5 Ga0065704_10334619 3300005289 Unclassified 808
6 Ga0065704_10514258 3300005289 Bacteria 657
7 Ga0065715_10272893 3300005293 Bacteria 1106
8 Ga0065707_10110942 3300005295 Unclassified 2411
9 Ga0065707_10115156 3300005295 Bacteria 2255
10 Ga0065707_10430612 3300005295 Bacteria 820
11 Ga0070676_10260070 3300005328 Bacteria 1162
12 Ga0070683_100363226 3300005329 Bacteria 1379
13 Ga0070683_100935071 3300005329 Unclassified 832
14 Ga0070670_100000401 3300005331 Bacteria 35589
15 Ga0068869_100316406 3300005334 Bacteria 1265
16 Ga0070680_100330582 3300005336 Bacteria 1294
17 Ga0068868_101665610 3300005338 Unclassified 600
18 Ga0070660_100461909 3300005339 Bacteria 1054
19 Ga0070660_101143303 3300005339 Unclassified 659
20 Ga0070689_100826497 3300005340 Unclassified 816
21 Ga0070661_100199461 3300005344 Bacteria 1528
22 Ga0070692_10128588 3300005345 Bacteria 1421
23 Ga0070669_100585413 3300005353 Bacteria 933
24 Ga0070673_100473413 3300005364 Bacteria 1130
25 Ga0070659_100023761 3300005366 Bacteria 4693
26 Ga0070659_101298422 3300005366 Unclassified 645
27 Ga0070667_100888560 3300005367 Bacteria 829
28 Ga0070709_10160664 3300005434 Bacteria 1562
29 Ga0070713_100406022 3300005436 Bacteria 1273
30 Ga0070710_10339799 3300005437 Bacteria 991
31 Ga0070701_10366669 3300005438 Unclassified 904
32 Ga0070711_100240332 3300005439 Unclassified 1416
33 Ga0070711_100897677 3300005439 Bacteria 756
34 Ga0070694_100012332 3300005444 Bacteria 5309
35 Ga0070694_100822450 3300005444 Unclassified 763
36 Ga0070708_100001907 3300005445 Bacteria 16041
37 Ga0070708_100005700 3300005445 Bacteria 9879
38 Ga0070708_100006187 3300005445 Bacteria 9516
39 Ga0070708_100067028 3300005445 Bacteria 3222
40 Ga0070708_100133481 3300005445 Bacteria 2299
41 Ga0070708_100674561 3300005445 Bacteria 973
42 Ga0070708_101406389 3300005445 Unclassified 651
43 Ga0070663_100405208 3300005455 Bacteria 1116
44 Ga0070662_100140516 3300005457 Bacteria 1871
45 Ga0070681_10035695 3300005458 Bacteria 4993
46 Ga0070681_10082637 3300005458 Bacteria 3167
47 Ga0070681_10196722 3300005458 Bacteria 1935
48 Ga0070706_100000217 3300005467 Bacteria 70703
49 Ga0070706_100027690 3300005467 Bacteria 5214
50 Ga0070706_100033755 3300005467 Unclassified 4724
51 Ga0070706_100098141 3300005467 Bacteria 2722
52 Ga0070707_100008552 3300005468 Bacteria 9512
53 Ga0070707_100008776 3300005468 Bacteria 9375
54 Ga0070707_100016464 3300005468 Bacteria 6937
55 Ga0070707_100139548 3300005468 Unclassified 2359
56 Ga0070707_100269234 3300005468 Unclassified 1656
57 Ga0070698_100007906 3300005471 Bacteria 11510
58 Ga0070698_100027904 3300005471 Bacteria 5864
59 Ga0070698_100036747 3300005471 Bacteria 5055
60 Ga0070698_100134805 3300005471 Bacteria 2424
61 Ga0070698_100235100 3300005471 Bacteria 1765
62 Ga0070698_100258653 3300005471 Bacteria 1673
63 Ga0070699_100005638 3300005518 Bacteria 10973
64 Ga0070699_100120667 3300005518 Bacteria 2305
65 Ga0070699_100197072 3300005518 Bacteria 1790
66 Ga0070699_100264697 3300005518 Bacteria 1538
67 Ga0070699_100491043 3300005518 Bacteria 1115
68 Ga0070699_100758236 3300005518 Bacteria 888
69 Ga0070699_100799883 3300005518 Bacteria 863
70 Ga0070679_100048723 3300005530 Bacteria 4220
71 Ga0070684_100657423 3300005535 Bacteria 976
72 Ga0070684_102011204 3300005535 Unclassified 545
73 Ga0070697_100001510 3300005536 Bacteria 17674
74 Ga0070697_100021591 3300005536 Bacteria 5102
75 Ga0070697_100362683 3300005536 Bacteria 1253
76 Ga0070697_100746447 3300005536 Unclassified 865
77 Ga0070697_100777594 3300005536 Unclassified 846
78 Ga0070697_101063857 3300005536 Unclassified 720
79 Ga0070697_101078663 3300005536 Unclassified 714
80 Ga0070695_100780111 3300005545 Bacteria 764
81 Ga0068855_100944600 3300005563 Bacteria 909
82 Ga0068855_102244328 3300005563 Unclassified 547
83 Ga0070664_100024821 3300005564 Bacteria 4964
84 Ga0068857_100000277 3300005577 Bacteria 35101
85 Ga0068857_100681059 3300005577 Unclassified 976
86 Ga0068856_101254359 3300005614 Bacteria 757
87 Ga0068859_100340699 3300005617 Bacteria 1593
88 Ga0068859_100718309 3300005617 Unclassified 1089
89 Ga0068864_100019820 3300005618 Bacteria 5623
90 Ga0068864_101050227 3300005618 Unclassified 809
91 Ga0068863_101636823 3300005841 Unclassified 653
92 Ga0068858_100131656 3300005842 Bacteria 2346
93 Ga0068858_100206485 3300005842 Bacteria 1858
94 Ga0068858_100711935 3300005842 Bacteria 977
95 Ga0068860_101075806 3300005843 Unclassified 823
96 Ga0068862_100321634 3300005844 Bacteria 1428
97 Ga0068862_102164488 3300005844 Unclassified 567
98 Ga0081538_10014088 3300005981 Bacteria 6282
99 Ga0081540_1000118 3300005983 Bacteria 84097
100 Ga0081540_1000162 3300005983 Bacteria 68999
101 Ga0081540_1000379 3300005983 Bacteria 44561
102 Ga0070717_10004234 3300006028 Bacteria 10346
103 Ga0070717_10033562 3300006028 Unclassified 4141
104 Ga0070717_10162064 3300006028 Bacteria 1940
105 Ga0070717_10585235 3300006028 Bacteria 1012
106 Ga0070717_10943570 3300006028 Unclassified 786
107 Ga0070716_100093480 3300006173 Bacteria 1826
108 Ga0070712_100027037 3300006175 Bacteria 3827
109 Ga0075430_101363649 3300006846 Unclassified 583
110 Ga0075431_100008684 3300006847 Bacteria 10180
111 Ga0075433_10243461 3300006852 Unclassified 1596
112 Ga0075433_10710757 3300006852 Bacteria 880
113 Ga0075429_101614747 3300006880 Bacteria 563
114 Ga0075436_100182140 3300006914 Bacteria 1485
115 Ga0075436_100197993 3300006914 Bacteria 1422
116 Ga0097620_100340711 3300006931 Bacteria 1593
117 Ga0097620_100718399 3300006931 Unclassified 1089
118 Ga0075435_100013076 3300007076 Bacteria 6164
119 Ga0075435_101301146 3300007076 Unclassified 637
120 Ga0099794_10024113 3300007265 Bacteria 2790
121 Ga0099794_10127983 3300007265 Bacteria 1281
122 Ga0099794_10780202 3300007265 Unclassified 511
123 Ga0111539_10683066 3300009094 Bacteria 1195
124 Ga0105245_10475906 3300009098 Bacteria 1261
125 Ga0114129_12150422 3300009147 Bacteria 672
126 Ga0114129_13190771 3300009147 Unclassified 533
127 Ga0105241_10267205 3300009174 Bacteria 1456
128 Ga0105248_10994107 3300009177 Bacteria 948
129 Ga0105237_10942175 3300009545 Archaea 870
130 Ga0105237_11334866 3300009545 Unclassified 723
131 Ga0105249_13193520 3300009553 Unclassified 527
132 Ga0105239_10178077 3300010375 Bacteria 2378
133 Ga0105246_11764050 3300011119 Unclassified 590
134 Ga0157374_10314234 3300013296 Bacteria 1552
135 Ga0157378_11162765 3300013297 Unclassified 810
136 Ga0163162_10074862 3300013306 Bacteria 3445
137 Ga0163162_10247014 3300013306 Bacteria 1916
138 Ga0163162_11133090 3300013306 Bacteria 887
139 Ga0163162_12616349 3300013306 Bacteria 581
140 Ga0157372_10976295 3300013307 Bacteria 981
141 Ga0157372_11328101 3300013307 Unclassified 830
142 Ga0157375_12271466 3300013308 Bacteria 647
143 Ga0163163_10002035 3300014325 Bacteria 17089
144 Ga0163163_11203808 3300014325 Bacteria 820
145 Ga0157380_12095208 3300014326 Unclassified 628
146 Ga0157377_10210007 3300014745 Bacteria 1241
147 Ga0157379_10021494 3300014968 Bacteria 5712
148 Ga0157379_11361715 3300014968 Bacteria 687
149 Ga0206350_11067893 3300020080 Unclassified 539
150 Ga0207647_10012591 3300025904 Bacteria 5883
151 Ga0207647_10079277 3300025904 Bacteria 1972
152 Ga0207699_11472142 3300025906 Unclassified 504
153 Ga0207645_10788111 3300025907 Bacteria 646
154 Ga0207684_10000062 3300025910 Bacteria 202863
155 Ga0207684_10003305 3300025910 Bacteria 15820
156 Ga0207684_10008565 3300025910 Bacteria 9096
157 Ga0207684_10042228 3300025910 Bacteria 3865
158 Ga0207684_10073291 3300025910 Bacteria 2908
159 Ga0207684_11581776 3300025910 Bacteria 531
160 Ga0207707_10040386 3300025912 Bacteria 4075
161 Ga0207707_10097287 3300025912 Bacteria 2572
162 Ga0207707_10183034 3300025912 Bacteria 1829
163 Ga0207671_11220284 3300025914 Unclassified 588
164 Ga0207693_10038892 3300025915 Bacteria 3745
165 Ga0207663_10433854 3300025916 Unclassified 1011
166 Ga0207663_10490426 3300025916 Unclassified 953
167 Ga0207660_10030428 3300025917 Bacteria 3711
168 Ga0207660_10064685 3300025917 Bacteria 2640
169 Ga0207657_10120572 3300025919 Bacteria 2158
170 Ga0207649_10269737 3300025920 Bacteria 1233
171 Ga0207652_10168508 3300025921 Bacteria 1965
172 Ga0207646_10000353 3300025922 Bacteria 62321
173 Ga0207646_10001038 3300025922 Bacteria 35444
174 Ga0207646_10242480 3300025922 Bacteria 1628
175 Ga0207646_10279369 3300025922 Bacteria 1509
176 Ga0207650_10000005 3300025925 Bacteria 663190
177 Ga0207700_10664481 3300025928 Unclassified 929
178 Ga0207690_10107080 3300025932 Bacteria 2007
179 Ga0207706_10021793 3300025933 Bacteria 5751
180 Ga0207670_11163272 3300025936 Unclassified 652
181 Ga0207665_10195540 3300025939 Bacteria 1471
182 Ga0207665_10702651 3300025939 Unclassified 795
183 Ga0207661_10663957 3300025944 Bacteria 958
184 Ga0207679_10125244 3300025945 Bacteria 2052
185 Ga0207667_10688552 3300025949 Bacteria 1025
186 Ga0207677_11282128 3300026023 Unclassified 672
187 Ga0207703_10255283 3300026035 Bacteria 1582
188 Ga0207703_10419461 3300026035 Bacteria 1245
189 Ga0207639_10377984 3300026041 Bacteria 1271
190 Ga0207678_10456418 3300026067 Bacteria 1111
191 Ga0207702_11299445 3300026078 Bacteria 721
192 Ga0207641_12452201 3300026088 Unclassified 520
193 Ga0207676_10314254 3300026095 Bacteria 1435
194 Ga0207676_11576505 3300026095 Unclassified 654
195 Ga0207674_10001205 3300026116 Bacteria 33690
196 Ga0207674_10568700 3300026116 Bacteria 1095
197 Ga0207675_100787167 3300026118 Bacteria 964
198 Ga0209588_1040803 3300027671 Bacteria 1498
199 Ga0268264_11031692 3300028381 Unclassified 830
200 Ga0373926_0057312 3300035083 Bacteria 1415
201 Ga0373944_0055072 3300035089 Bacteria 1263
202 Ga0373945_0000048 3300035116 Bacteria 25327
203 Ga0373953_0506227 3300035117 Bacteria 535
204 Ga0373954_0029125 3300035118 Bacteria 2542
205 Ga0373943_0111465 3300035170 Bacteria 1444
206 Ga0373946_0045730 3300035171 Bacteria 1812
207 Ga0373924_0000166 3300035410 Bacteria 19368
208 Ga0373924_0313553 3300035410 Bacteria 697
209 Ga0373935_0143128 3300035692 Bacteria 1617
210 Ga0373937_0240522 3300036401 Bacteria 1705
211 Ga0373937_0644013 3300036401 Bacteria 1005
212 Ga0373925_0305658 3300037068 Bacteria 1285
213 Ga0395900_0547510 3300037418 Bacteria 1102
214 Ga0395900_0973337 3300037418 Bacteria 769
215 Ga0395900_1021473 3300037418 Unclassified 746
216 Ga0395898_0432723 3300037466 Bacteria 1254
217 Ga0395898_1067657 3300037466 Unclassified 742
218 Ga0395905_0011494 3300037471 Bacteria 8555
219 Ga0395905_0014666 3300037471 Bacteria 7476
220 Ga0395905_0366443 3300037471 Bacteria 1334
221 Ga0395901_0178485 3300038443 Bacteria 2227
222 Ga0395901_0367282 3300038443 Bacteria 1483
223 Ga0395901_0414051 3300038443 Unclassified 1383
224 Ga0395901_0596972 3300038443 Bacteria 1114
225 Ga0439448_0303413 3300042005 Unclassified 567
226 Ga0451577_0043121 3300042876 Bacteria 4041
227 Ga0453683_0006803 3300044673 Bacteria 7812
228 Ga0453683_0071915 3300044673 Bacteria 2164
229 Ga0453683_0980499 3300044673 Unclassified 561
230 Ga0453684_0007315 3300044712 Bacteria 20420
231 Ga0451576_0039479 3300045051 Bacteria 4996
232 Ga0466958_0291389 3300045836 Bacteria 1047
233 Ga0495583_0223575 3300046506 Unclassified 760
234 Ga0495609_0048568 3300046538 Bacteria 1896
235 Ga0495645_0382858 3300046543 Unclassified 900
236 Ga0495645_0658410 3300046543 Unclassified 639
237 Ga0495623_0630308 3300046679 Unclassified 554
238 Ga0495613_0025164 3300046689 Unclassified 4436
239 Ga0496100_1617550 3300048903 Unclassified 512
240 Ga0496105_0880371 3300048908 Unclassified 676
241 Ga0496106_0272157 3300048909 Bacteria 1356
242 Ga0496108_0579849 3300048911 Bacteria 978
243 Ga0496109_0037118 3300048912 Bacteria 4402
244 Ga0496109_0522562 3300048912 Bacteria 1120
245 Ga0496110_0349058 3300048913 Bacteria 1348
246 Ga0496112_0022021 3300048915 Bacteria 6067
247 Ga0496112_0334649 3300048915 Bacteria 1458
248 Ga0501076_0316485 3300049592 Bacteria 1280
249 nmdc:mga05p37_1042645_c1 3300050507 Bacteria 864
250 nmdc:mga05p37_120889_c2 3300050507 Unclassified 1632
251 nmdc:mga09592_1356651_c1 3300050508 Bacteria 583
252 nmdc:mga09592_913031_c1 3300050508 Bacteria 738
253 nmdc:mga06r32_719934_c1 3300050510 Bacteria 963
254 nmdc:mga0n895_1094005_c1 3300050512 Unclassified 775
255 nmdc:mga0rr50_1057908_c1 3300050513 Unclassified 691
256 nmdc:mga0rr50_1227049_c1 3300050513 Unclassified 637
257 nmdc:mga08x19_15148_c1 3300050514 Bacteria 4686
258 nmdc:mga0a205_24947_c1 3300050515 Bacteria 5691
259 nmdc:mga0a205_368518_c2 3300050515 Bacteria 959
260 nmdc:mga0a205_504975_c1 3300050515 Bacteria 1066
261 nmdc:mga0a205_5075_c1 3300050515 Bacteria 11837
262 Ga0495595_0726881 3300053084 Bacteria 509
263 Ga0587073_0094150 3300059492 Unclassified 767
264 Ga0587091_017191 3300059511 Unclassified 1215
265 Ga0587094_028133 3300059513 Unclassified 857
266 Ga0587128_005965 3300059630 Bacteria 1480
267 Ga0587128_020858 3300059630 Bacteria 1005
268 Ga0587114_038923 3300059655 Unclassified 762
269 Ga0070706_100222363
270 JGI24751J29686_10000142
271 JGI25404J52841_10003621
272 JGI25404J52841_10014201
273 Ga0065704_10334619
274 Ga0065704_10514258
275 Ga0065715_10272893
276 Ga0065707_10110942
277 Ga0065707_10115156
278 Ga0065707_10430612
279 Ga0070676_10260070
280 Ga0070683_100363226
281 Ga0070683_100935071
282 Ga0070670_100000401
283 Ga0068869_100316406
284 Ga0070680_100330582
285 Ga0068868_101665610
286 Ga0070660_100461909
287 Ga0070660_101143303
288 Ga0070689_100826497
289 Ga0070661_100199461
290 Ga0070692_10128588
291 Ga0070669_100585413
292 Ga0070673_100473413
293 Ga0070659_100023761
294 Ga0070659_101298422
295 Ga0070667_100888560
296 Ga0070709_10160664
297 Ga0070713_100406022
298 Ga0070710_10339799
299 Ga0070701_10366669
300 Ga0070711_100240332
301 Ga0070711_100897677
302 Ga0070694_100012332
303 Ga0070694_100822450
304 Ga0070708_100001907
305 Ga0070708_100005700
306 Ga0070708_100006187
307 Ga0070708_100067028
308 Ga0070708_100133481
309 Ga0070708_100674561
310 Ga0070708_101406389
311 Ga0070663_100405208
312 Ga0070662_100140516
313 Ga0070681_10035695
314 Ga0070681_10082637
315 Ga0070681_10196722
316 Ga0070706_100000217
317 Ga0070706_100027690
318 Ga0070706_100033755
319 Ga0070706_100098141
320 Ga0070707_100008552
321 Ga0070707_100008776
322 Ga0070707_100016464
323 Ga0070707_100139548
324 Ga0070707_100269234
325 Ga0070698_100007906
326 Ga0070698_100027904
327 Ga0070698_100036747
328 Ga0070698_100134805
329 Ga0070698_100235100
330 Ga0070698_100258653
331 Ga0070699_100005638
332 Ga0070699_100120667
333 Ga0070699_100197072
334 Ga0070699_100264697
335 Ga0070699_100491043
336 Ga0070699_100758236
337 Ga0070699_100799883
338 Ga0070679_100048723
339 Ga0070684_100657423
340 Ga0070684_102011204
341 Ga0070697_100001510
342 Ga0070697_100021591
343 Ga0070697_100362683
344 Ga0070697_100746447
345 Ga0070697_100777594
346 Ga0070697_101063857
347 Ga0070697_101078663
348 Ga0070695_100780111
349 Ga0068855_100944600
350 Ga0068855_102244328
351 Ga0070664_100024821
352 Ga0068857_100000277
353 Ga0068857_100681059
354 Ga0068856_101254359
355 Ga0068859_100340699
356 Ga0068859_100718309
357 Ga0068864_100019820
358 Ga0068864_101050227
359 Ga0068863_101636823
360 Ga0068858_100131656
361 Ga0068858_100206485
362 Ga0068858_100711935
363 Ga0068860_101075806
364 Ga0068862_100321634
365 Ga0068862_102164488
366 Ga0081538_10014088
367 Ga0081540_1000118
368 Ga0081540_1000162
369 Ga0081540_1000379
370 Ga0070717_10004234
371 Ga0070717_10033562
372 Ga0070717_10162064
373 Ga0070717_10585235
374 Ga0070717_10943570
375 Ga0070716_100093480
376 Ga0070712_100027037
377 Ga0075430_101363649
378 Ga0075431_100008684
379 Ga0075433_10243461
380 Ga0075433_10710757
381 Ga0075429_101614747
382 Ga0075436_100182140
383 Ga0075436_100197993
384 Ga0097620_100340711
385 Ga0097620_100718399
386 Ga0075435_100013076
387 Ga0075435_101301146
388 Ga0099794_10024113
389 Ga0099794_10127983
390 Ga0099794_10780202
391 Ga0111539_10683066
392 Ga0105245_10475906
393 Ga0114129_12150422
394 Ga0114129_13190771
395 Ga0105241_10267205
396 Ga0105248_10994107
397 Ga0105237_10942175
398 Ga0105237_11334866
399 Ga0105249_13193520
400 Ga0105239_10178077
401 Ga0105246_11764050
402 Ga0157374_10314234
403 Ga0157378_11162765
404 Ga0163162_10074862
405 Ga0163162_10247014
406 Ga0163162_11133090
407 Ga0163162_12616349
408 Ga0157372_10976295
409 Ga0157372_11328101
410 Ga0157375_12271466
411 Ga0163163_10002035
412 Ga0163163_11203808
413 Ga0157380_12095208
414 Ga0157377_10210007
415 Ga0157379_10021494
416 Ga0157379_11361715
417 Ga0206350_11067893
418 Ga0207647_10012591
419 Ga0207647_10079277
420 Ga0207699_11472142
421 Ga0207645_10788111
422 Ga0207684_10000062
423 Ga0207684_10003305
424 Ga0207684_10008565
425 Ga0207684_10042228
426 Ga0207684_10073291
427 Ga0207684_11581776
428 Ga0207707_10040386
429 Ga0207707_10097287
430 Ga0207707_10183034
431 Ga0207671_11220284
432 Ga0207693_10038892
433 Ga0207663_10433854
434 Ga0207663_10490426
435 Ga0207660_10030428
436 Ga0207660_10064685
437 Ga0207657_10120572
438 Ga0207649_10269737
439 Ga0207652_10168508
440 Ga0207646_10000353
441 Ga0207646_10001038
442 Ga0207646_10242480
443 Ga0207646_10279369
444 Ga0207650_10000005
445 Ga0207700_10664481
446 Ga0207690_10107080
447 Ga0207706_10021793
448 Ga0207670_11163272
449 Ga0207665_10195540
450 Ga0207665_10702651
451 Ga0207661_10663957
452 Ga0207679_10125244
453 Ga0207667_10688552
454 Ga0207677_11282128
455 Ga0207703_10255283
456 Ga0207703_10419461
457 Ga0207639_10377984
458 Ga0207678_10456418
459 Ga0207702_11299445
460 Ga0207641_12452201
461 Ga0207676_10314254
462 Ga0207676_11576505
463 Ga0207674_10001205
464 Ga0207674_10568700
465 Ga0207675_100787167
466 Ga0209588_1040803
467 Ga0268264_11031692
468 Ga0373926_0057312
469 Ga0373944_0055072
470 Ga0373945_0000048
471 Ga0373953_0506227
472 Ga0373954_0029125
473 Ga0373943_0111465
474 Ga0373946_0045730
475 Ga0373924_0000166
476 Ga0373924_0313553
477 Ga0373935_0143128
478 Ga0373937_0240522
479 Ga0373937_0644013
480 Ga0373925_0305658
481 Ga0395900_0547510
482 Ga0395900_0973337
483 Ga0395900_1021473
484 Ga0395898_0432723
485 Ga0395898_1067657
486 Ga0395905_0011494
487 Ga0395905_0014666
488 Ga0395905_0366443
489 Ga0395901_0178485
490 Ga0395901_0367282
491 Ga0395901_0414051
492 Ga0395901_0596972
493 Ga0439448_0303413
494 Ga0451577_0043121
495 Ga0453683_0006803
496 Ga0453683_0071915
497 Ga0453683_0980499
498 Ga0453684_0007315
499 Ga0451576_0039479
500 Ga0466958_0291389
501 Ga0495583_0223575
502 Ga0495609_0048568
503 Ga0495645_0382858
504 Ga0495645_0658410
505 Ga0495623_0630308
506 Ga0495613_0025164
507 Ga0496100_1617550
508 Ga0496105_0880371
509 Ga0496106_0272157
510 Ga0496108_0579849
511 Ga0496109_0037118
512 Ga0496109_0522562
513 Ga0496110_0349058
514 Ga0496112_0022021
515 Ga0496112_0334649
516 Ga0501076_0316485
517 nmdc:mga05p37_1042645_c1
518 nmdc:mga05p37_120889_c2
519 nmdc:mga09592_1356651_c1
520 nmdc:mga09592_913031_c1
521 nmdc:mga06r32_719934_c1
522 nmdc:mga0n895_1094005_c1
523 nmdc:mga0rr50_1057908_c1
524 nmdc:mga0rr50_1227049_c1
525 nmdc:mga08x19_15148_c1
526 nmdc:mga0a205_24947_c1
527 nmdc:mga0a205_368518_c2
528 nmdc:mga0a205_504975_c1
529 nmdc:mga0a205_5075_c1
530 Ga0495595_0726881
531 Ga0587073_0094150
532 Ga0587091_017191
533 Ga0587094_028133
534 Ga0587128_005965
535 Ga0587128_020858
536 Ga0587114_038923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20120

DUF6510

Family of unknown function (DUF6510)

4

90

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3st1-assembly1.cif.gz_A crystal structure of necrosis and ethylene inducing protein 2 from the causal agent of cocoa's witches broom disease 0.7895 53 79
3f0w-assembly1.cif.gz_A human numb-like protein, phosphotyrosine interaction domain 0.7847 38 69
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7393 44 74
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.7217 42 79
7xfr-assembly1.cif.gz_C-2 crystal structure of wipi2b in complex with the second site of atg16l1 0.6204 45 74
ID Description Score Start End Superfamily
af_Q9P6N1_87_324_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8724 44 70 2.130.10.10
af_A0A1D6HJ01_1_116_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8508 44 72 2.40.70.10
af_Q4E258_345_641_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8384 45 72 2.130.10.10
af_K7V4L9_96_266_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8292 44 73 2.130.10.10
af_Q4CYC8_31_284_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8243 40 70 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V6I699-F1-model_v4 Uncharacterized protein 0.9835 9 88
AF-A0A2V6I699-F1-model_v4 Uncharacterized protein 0.9485 9 88
AF-A0A0S8AGB9-F1-model_v4 Uncharacterized protein 0.9327 44 77
AF-A0A5F0D7I1-F1-model_v4 deleted 0.9304 21 88
AF-A0A166SJ39-F1-model_v4 Small CPxCG-related zinc finger protein 0.9301 30 69

Map