F374859

General Info

Members Datasets Scaffolds Average Seq Length
267 170 534 146

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10086111|Ga0307515_100861113
Length 159
Sequence MSAALPGTAPTAVARVAVPASMSDDDAELLTLAQELLARVWRDGRHEVASAVRTADGAVHTGVHLEGSCRRSSICAEGVALGAARGAYPGERPLEVTSVVSVQIKPAGRFRVIAPCGVCRELISDYSPDATVWITTVEENEVVPVRALDLLPDKSRRAW

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
41 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
42 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
132 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
133 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
137 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
138 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
139 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
140 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
141 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
142 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
143 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
144 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
145 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
146 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
147 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
148 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
149 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
150 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
155 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
156 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
157 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
163 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
164 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
165 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
166 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
167 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
168 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
169 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
170 2904162308 Paenibacillus sp. AD87 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0.75
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.6
Nodule 0
Rhizoplane 1.87
Rhizosphere 47.19
Stem 0
Stem Tuber 0
Unclassified 4.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10086111 3300028794 Bacteria 4010
2 rootH2_10184133 3300003320 Bacteria 1924
3 rootH1_10224365 3300003323 Bacteria 1346
4 Ga0065707_10082250 3300005295 Bacteria 18278
5 Ga0070666_11038116 3300005335 Bacteria 608
6 Ga0070665_100099237 3300005548 Bacteria 2916
7 Ga0070665_100391550 3300005548 Bacteria 1397
8 Ga0068855_100056566 3300005563 Bacteria 4602
9 Ga0068855_102260060 3300005563 Bacteria 545
10 Ga0068854_100499770 3300005578 Bacteria 1024
11 Ga0068859_100065537 3300005617 Bacteria 3666
12 Ga0068864_102572862 3300005618 Unclassified 515
13 Ga0068858_100000643 3300005842 Bacteria 36390
14 Ga0068862_100099398 3300005844 Bacteria 2543
15 Ga0068862_100318996 3300005844 Bacteria 1434
16 Ga0075365_10026123 3300006038 Bacteria 3704
17 Ga0097621_100849540 3300006237 Bacteria 848
18 Ga0097620_100065536 3300006931 Bacteria 3666
19 Ga0105240_10020918 3300009093 Bacteria 8713
20 Ga0105240_10054662 3300009093 Bacteria 5003
21 Ga0105247_10554917 3300009101 Bacteria 845
22 Ga0105247_10703554 3300009101 Unclassified 761
23 Ga0105243_10922332 3300009148 Bacteria 870
24 Ga0105237_10028058 3300009545 Bacteria 5735
25 Ga0105237_10028366 3300009545 Bacteria 5702
26 Ga0105238_10324457 3300009551 Bacteria 1526
27 Ga0105238_10732507 3300009551 Bacteria 1002
28 Ga0105239_11117964 3300010375 Bacteria 907
29 Ga0163162_12934140 3300013306 Unclassified 548
30 Ga0157372_10640843 3300013307 Bacteria 1238
31 Ga0163163_10599296 3300014325 Bacteria 1165
32 Ga0157379_10087286 3300014968 Bacteria 2797
33 Ga0157379_10379741 3300014968 Bacteria 1296
34 Ga0157379_10719436 3300014968 Bacteria 938
35 Ga0213874_10014564 3300021377 Bacteria 2058
36 Ga0213875_10032591 3300021388 Bacteria 2461
37 Ga0207642_10618509 3300025899 Unclassified 676
38 Ga0207695_10041242 3300025913 Bacteria 4941
39 Ga0207671_10837327 3300025914 Bacteria 729
40 Ga0207660_11433521 3300025917 Bacteria 559
41 Ga0207694_10345368 3300025924 Bacteria 1231
42 Ga0207694_11579407 3300025924 Bacteria 553
43 Ga0207706_11246232 3300025933 Unclassified 616
44 Ga0207667_10022670 3300025949 Bacteria 6927
45 Ga0207640_10287471 3300025981 Bacteria 1295
46 Ga0207703_10000405 3300026035 Bacteria 46259
47 Ga0207675_100563023 3300026118 Bacteria 1140
48 Ga0268266_10092524 3300028379 Bacteria 2653
49 Ga0268266_10135087 3300028379 Bacteria 2208
50 Ga0268265_10180940 3300028380 Bacteria 1811
51 Ga0268265_10531015 3300028380 Bacteria 1114
52 Ga0307517_10006217 3300028786 Bacteria 17769
53 Ga0307517_10008495 3300028786 Bacteria 14733
54 Ga0307517_10349246 3300028786 Bacteria 804
55 Ga0307515_10000050 3300028794 Bacteria 275624
56 Ga0307515_10002012 3300028794 Bacteria 44962
57 Ga0307515_10016906 3300028794 Bacteria 13334
58 Ga0307515_10021810 3300028794 Bacteria 11330
59 Ga0307515_10062687 3300028794 Bacteria 5243
60 Ga0307515_10170468 3300028794 Bacteria 2172
61 Ga0307515_10196454 3300028794 Bacteria 1908
62 Ga0307515_10545393 3300028794 Bacteria 769
63 Ga0307511_10008874 3300030521 Bacteria 10036
64 Ga0307511_10122906 3300030521 Bacteria 1596
65 Ga0307511_10153216 3300030521 Bacteria 1316
66 Ga0307512_10002540 3300030522 Bacteria 22823
67 Ga0307512_10004641 3300030522 Bacteria 14912
68 Ga0307512_10021507 3300030522 Bacteria 5815
69 Ga0307512_10122517 3300030522 Bacteria 1664
70 Ga0307512_10191570 3300030522 Bacteria 1127
71 Ga0307513_10017479 3300031456 Bacteria 8599
72 Ga0307513_10018771 3300031456 Bacteria 8254
73 Ga0307513_10021537 3300031456 Bacteria 7607
74 Ga0307513_10108919 3300031456 Bacteria 2769
75 Ga0307513_10427103 3300031456 Bacteria 1054
76 Ga0307509_10010182 3300031507 Bacteria 11566
77 Ga0307509_10013025 3300031507 Bacteria 9874
78 Ga0307509_10038701 3300031507 Bacteria 5201
79 Ga0307508_10001903 3300031616 Bacteria 22898
80 Ga0307508_10071928 3300031616 Bacteria 3033
81 Ga0307508_10192008 3300031616 Bacteria 1643
82 Ga0307508_10278988 3300031616 Bacteria 1264
83 Ga0307508_10299444 3300031616 Bacteria 1201
84 Ga0307514_10004798 3300031649 Bacteria 12322
85 Ga0307514_10125548 3300031649 Bacteria 1778
86 Ga0307516_10000012 3300031730 Bacteria 224120
87 Ga0307516_10160215 3300031730 Bacteria 2001
88 Ga0307516_10221264 3300031730 Bacteria 1602
89 Ga0307516_10232695 3300031730 Bacteria 1545
90 Ga0307516_10361356 3300031730 Bacteria 1116
91 Ga0307516_10684872 3300031730 Bacteria 681
92 Ga0307518_10033576 3300031838 Bacteria 3723
93 Ga0307518_10158317 3300031838 Bacteria 1559
94 Ga0307518_10569916 3300031838 Bacteria 553
95 Ga0307410_10901277 3300031852 Bacteria 757
96 Ga0307407_10370091 3300031903 Bacteria 1020
97 Ga0307407_10386255 3300031903 Bacteria 1001
98 Ga0307416_103559107 3300032002 Bacteria 521
99 Ga0316593_10353195 3300032168 Unclassified 563
100 Ga0307507_10007542 3300033179 Bacteria 15706
101 Ga0307507_10042282 3300033179 Bacteria 4546
102 Ga0307507_10233124 3300033179 Bacteria 1217
103 Ga0307510_10000018 3300033180 Bacteria 192986
104 Ga0307510_10017748 3300033180 Bacteria 8386
105 Ga0307510_10024254 3300033180 Bacteria 7011
106 Ga0307510_10056741 3300033180 Bacteria 4073
107 Ga0307510_10208517 3300033180 Bacteria 1479
108 Ga0307510_10366928 3300033180 Bacteria 887
109 Ga0316587_1095073 3300033529 Unclassified 571
110 Ga0373932_0172068 3300035112 Bacteria 755
111 Ga0373936_0004796 3300035113 Bacteria 5106
112 Ga0373939_0082568 3300035114 Bacteria 1070
113 Ga0316574_0166731 3300035398 Bacteria 1419
114 Ga0316582_0308419 3300036647 Unclassified 1088
115 Ga0373925_0000186 3300037068 Bacteria 68187
116 Ga0436364_0800777 3300037853 Bacteria 3199
117 Ga0436363_1108685 3300039450 Bacteria 2259
118 Ga0451807_1979995 3300041486 Bacteria 878
119 Ga0466966_0031005 3300044684 Bacteria 3468
120 Ga0466957_0626345 3300044842 Unclassified 755
121 Ga0466959_0096415 3300045049 Bacteria 2120
122 Ga0466959_0112660 3300045049 Bacteria 1940
123 Ga0466959_0169646 3300045049 Bacteria 1531
124 Ga0495617_022234 3300046452 Bacteria 2144
125 Ga0495592_0364260 3300046454 Bacteria 923
126 Ga0495629_0022558 3300046459 Bacteria 4487
127 Ga0495629_0040788 3300046459 Bacteria 3265
128 Ga0495629_0322411 3300046459 Bacteria 1056
129 Ga0495638_0028601 3300046460 Bacteria 3598
130 Ga0495638_0122706 3300046460 Bacteria 1534
131 Ga0495651_0076482 3300046462 Bacteria 2535
132 Ga0495582_0332123 3300046473 Bacteria 875
133 Ga0495662_0001510 3300046476 Bacteria 11545
134 Ga0495664_0000614 3300046477 Bacteria 18114
135 Ga0495585_0008893 3300046492 Bacteria 6058
136 Ga0495594_0023931 3300046499 Bacteria 3277
137 Ga0495594_0192091 3300046499 Bacteria 1163
138 Ga0495583_0050653 3300046506 Bacteria 1897
139 Ga0495618_0004597 3300046514 Bacteria 8452
140 Ga0495630_0112779 3300046517 Bacteria 2059
141 Ga0495632_0028072 3300046519 Bacteria 2940
142 Ga0495632_0038367 3300046519 Bacteria 2426
143 Ga0495632_0053577 3300046519 Bacteria 1981
144 Ga0495643_0130498 3300046522 Bacteria 1262
145 Ga0495648_0115756 3300046524 Bacteria 1450
146 Ga0495666_0056111 3300046526 Bacteria 1887
147 Ga0495587_0079331 3300046536 Bacteria 1903
148 Ga0495645_0044072 3300046543 Bacteria 3254
149 Ga0495622_0012515 3300046557 Bacteria 3929
150 Ga0495656_0152290 3300046615 Bacteria 1118
151 Ga0495611_0058215 3300046648 Bacteria 1752
152 Ga0495625_0013947 3300046660 Bacteria 6435
153 Ga0495625_0506159 3300046660 Bacteria 738
154 Ga0495635_0001842 3300046663 Bacteria 14345
155 Ga0495588_0010972 3300046674 Bacteria 4238
156 Ga0495657_0010840 3300046675 Bacteria 6842
157 Ga0495599_0105797 3300046678 Bacteria 1753
158 Ga0495646_0013060 3300046680 Bacteria 5278
159 Ga0495613_0010067 3300046689 Bacteria 7024
160 Ga0495671_0004957 3300046692 Bacteria 7850
161 Ga0495671_0172619 3300046692 Bacteria 1051
162 Ga0495649_0058495 3300046694 Bacteria 2077
163 Ga0495600_0000913 3300046809 Bacteria 15830
164 Ga0495660_0002076 3300046810 Bacteria 12987
165 Ga0495581_0041737 3300047315 Bacteria 2655
166 Ga0495604_0001660 3300047317 Bacteria 18304
167 Ga0495636_0171776 3300047318 Bacteria 980
168 Ga0495674_0090774 3300047319 Bacteria 2610
169 Ga0495674_0348323 3300047319 Archaea 1203
170 Ga0495672_0154241 3300047320 Bacteria 1188
171 Ga0495676_0146974 3300047321 Bacteria 1682
172 Ga0495683_0001634 3300047323 Bacteria 14433
173 Ga0495683_0034776 3300047323 Bacteria 2562
174 Ga0495687_004352 3300047443 Bacteria 9633
175 Ga0495687_007680 3300047443 Bacteria 6302
176 Ga0495687_058186 3300047443 Bacteria 1604
177 Ga0495687_073278 3300047443 Bacteria 1365
178 Ga0495675_0504913 3300047444 Bacteria 694
179 Ga0495685_000698 3300047447 Bacteria 10268
180 Ga0495685_050670 3300047447 Bacteria 1409
181 Ga0495681_0007869 3300047470 Bacteria 6741
182 Ga0495684_0062720 3300047471 Bacteria 2827
183 Ga0495593_0000431 3300047673 Bacteria 23408
184 Ga0495602_0560484 3300048088 Bacteria 790
185 Ga0495614_0014310 3300048089 Bacteria 3474
186 Ga0496102_0105159 3300048905 Bacteria 2626
187 Ga0496106_0596296 3300048909 Bacteria 885
188 Ga0496107_0728779 3300048910 Bacteria 728
189 Ga0496113_1164971 3300048916 Bacteria 603
190 Ga0496116_0019449 3300048919 Bacteria 5200
191 Ga0496117_0000024 3300048920 Bacteria 418750
192 Ga0496118_0000014 3300048921 Bacteria 561628
193 Ga0496119_0011835 3300048922 Bacteria 7165
194 Ga0496119_0024663 3300048922 Bacteria 4223
195 Ga0496120_0000115 3300048923 Bacteria 136364
196 Ga0496120_0036104 3300048923 Bacteria 2945
197 Ga0496120_0088587 3300048923 Bacteria 1658
198 Ga0496121_0009580 3300048924 Bacteria 11095
199 Ga0496121_0047179 3300048924 Bacteria 3678
200 Ga0496121_0278844 3300048924 Bacteria 1145
201 Ga0496122_0278422 3300048925 Bacteria 916
202 Ga0496124_0005549 3300048927 Bacteria 14132
203 Ga0496125_0000409 3300048928 Bacteria 80451
204 Ga0496125_0091297 3300048928 Bacteria 2282
205 Ga0496126_0020940 3300048929 Bacteria 6400
206 Ga0496126_0211916 3300048929 Bacteria 1631
207 nmdc:mga0yw44_24671_c1 3300050492 Bacteria 3406
208 Ga0500610_0195252 3300053079 Bacteria 980
209 Ga0495655_0041436 3300053083 Bacteria 1177
210 Ga0500578_0270694 3300053086 Bacteria 1016
211 Ga0500644_0014891 3300053088 Bacteria 2205
212 Ga0500644_0030710 3300053088 Bacteria 1702
213 Ga0500644_0052786 3300053088 Bacteria 1401
214 Ga0500646_0000552 3300053090 Bacteria 10900
215 Ga0500646_0194752 3300053090 Bacteria 693
216 Ga0500583_0001187 3300053092 Bacteria 7453
217 Ga0500583_0100703 3300053092 Bacteria 1415
218 Ga0500583_0106333 3300053092 Bacteria 1379
219 Ga0500583_0135257 3300053092 Bacteria 1223
220 Ga0500583_0230102 3300053092 Bacteria 918
221 Ga0500651_0120112 3300053093 Bacteria 1596
222 Ga0500640_021505 3300053095 Bacteria 2784
223 Ga0500650_0131746 3300053098 Bacteria 1162
224 Ga0500654_062857 3300053099 Bacteria 1883
225 Ga0500660_073532 3300053100 Bacteria 1593
226 Ga0500553_127824 3300053101 Bacteria 1032
227 Ga0500556_0184857 3300053104 Unclassified 823
228 Ga0500560_000319 3300053107 Bacteria 6166
229 Ga0500569_019331 3300053109 Bacteria 1771
230 Ga0500572_139747 3300053111 Bacteria 789
231 Ga0500591_044356 3300053115 Bacteria 2105
232 Ga0500614_099423 3300053123 Bacteria 837
233 Ga0500617_052740 3300053124 Bacteria 1811
234 Ga0500652_012393 3300053131 Bacteria 2989
235 Ga0500652_174404 3300053131 Bacteria 884
236 Ga0500658_0284760 3300053134 Bacteria 760
237 Ga0500561_0023376 3300053137 Bacteria 1480
238 Ga0500568_0005671 3300053139 Bacteria 6409
239 Ga0500568_0188376 3300053139 Bacteria 757
240 Ga0500579_067736 3300053143 Bacteria 2079
241 Ga0500579_151001 3300053143 Bacteria 1013
242 Ga0500579_279550 3300053143 Bacteria 512
243 Ga0500588_0014810 3300053146 Bacteria 1984
244 Ga0500589_246106 3300053147 Bacteria 659
245 Ga0500600_0069443 3300053149 Bacteria 1936
246 Ga0500600_0076288 3300053149 Bacteria 1824
247 Ga0500600_0248072 3300053149 Bacteria 799
248 Ga0500616_0000049 3300053153 Bacteria 303396
249 Ga0500616_0000131 3300053153 Bacteria 131881
250 Ga0500616_0067890 3300053153 Bacteria 1827
251 Ga0500616_0125109 3300053153 Bacteria 1222
252 Ga0500616_0278776 3300053153 Bacteria 702
253 Ga0500622_0024179 3300053156 Bacteria 3213
254 Ga0500633_0006229 3300053160 Bacteria 2908
255 Ga0500633_0331041 3300053160 Unclassified 557
256 Ga0500637_0049315 3300053178 Bacteria 2396
257 Ga0500637_0082152 3300053178 Bacteria 1862
258 Ga0500611_121843 3300053727 Unclassified 695
259 Ga0500656_001872 3300053732 Bacteria 1857
260 Ga0500656_005195 3300053732 Bacteria 1279
261 Ga0500587_002368 3300053739 Bacteria 2678
262 2734971612 2734482000 Bacteria 5525167
263 2821116187 2821111986 Bacteria 6894338
264 2857469524 2857465823 Bacteria 6772595
265 2857595088 2857591370 Bacteria 6569758
266 2885530556 2885526491 Bacteria 7164189
267 2904166106 2904162308 Bacteria 7086713
268 Ga0307515_10086111
269 rootH2_10184133
270 rootH1_10224365
271 Ga0065707_10082250
272 Ga0070666_11038116
273 Ga0070665_100099237
274 Ga0070665_100391550
275 Ga0068855_100056566
276 Ga0068855_102260060
277 Ga0068854_100499770
278 Ga0068859_100065537
279 Ga0068864_102572862
280 Ga0068858_100000643
281 Ga0068862_100099398
282 Ga0068862_100318996
283 Ga0075365_10026123
284 Ga0097621_100849540
285 Ga0097620_100065536
286 Ga0105240_10020918
287 Ga0105240_10054662
288 Ga0105247_10554917
289 Ga0105247_10703554
290 Ga0105243_10922332
291 Ga0105237_10028058
292 Ga0105237_10028366
293 Ga0105238_10324457
294 Ga0105238_10732507
295 Ga0105239_11117964
296 Ga0163162_12934140
297 Ga0157372_10640843
298 Ga0163163_10599296
299 Ga0157379_10087286
300 Ga0157379_10379741
301 Ga0157379_10719436
302 Ga0213874_10014564
303 Ga0213875_10032591
304 Ga0207642_10618509
305 Ga0207695_10041242
306 Ga0207671_10837327
307 Ga0207660_11433521
308 Ga0207694_10345368
309 Ga0207694_11579407
310 Ga0207706_11246232
311 Ga0207667_10022670
312 Ga0207640_10287471
313 Ga0207703_10000405
314 Ga0207675_100563023
315 Ga0268266_10092524
316 Ga0268266_10135087
317 Ga0268265_10180940
318 Ga0268265_10531015
319 Ga0307517_10006217
320 Ga0307517_10008495
321 Ga0307517_10349246
322 Ga0307515_10000050
323 Ga0307515_10002012
324 Ga0307515_10016906
325 Ga0307515_10021810
326 Ga0307515_10062687
327 Ga0307515_10170468
328 Ga0307515_10196454
329 Ga0307515_10545393
330 Ga0307511_10008874
331 Ga0307511_10122906
332 Ga0307511_10153216
333 Ga0307512_10002540
334 Ga0307512_10004641
335 Ga0307512_10021507
336 Ga0307512_10122517
337 Ga0307512_10191570
338 Ga0307513_10017479
339 Ga0307513_10018771
340 Ga0307513_10021537
341 Ga0307513_10108919
342 Ga0307513_10427103
343 Ga0307509_10010182
344 Ga0307509_10013025
345 Ga0307509_10038701
346 Ga0307508_10001903
347 Ga0307508_10071928
348 Ga0307508_10192008
349 Ga0307508_10278988
350 Ga0307508_10299444
351 Ga0307514_10004798
352 Ga0307514_10125548
353 Ga0307516_10000012
354 Ga0307516_10160215
355 Ga0307516_10221264
356 Ga0307516_10232695
357 Ga0307516_10361356
358 Ga0307516_10684872
359 Ga0307518_10033576
360 Ga0307518_10158317
361 Ga0307518_10569916
362 Ga0307410_10901277
363 Ga0307407_10370091
364 Ga0307407_10386255
365 Ga0307416_103559107
366 Ga0316593_10353195
367 Ga0307507_10007542
368 Ga0307507_10042282
369 Ga0307507_10233124
370 Ga0307510_10000018
371 Ga0307510_10017748
372 Ga0307510_10024254
373 Ga0307510_10056741
374 Ga0307510_10208517
375 Ga0307510_10366928
376 Ga0316587_1095073
377 Ga0373932_0172068
378 Ga0373936_0004796
379 Ga0373939_0082568
380 Ga0316574_0166731
381 Ga0316582_0308419
382 Ga0373925_0000186
383 Ga0436364_0800777
384 Ga0436363_1108685
385 Ga0451807_1979995
386 Ga0466966_0031005
387 Ga0466957_0626345
388 Ga0466959_0096415
389 Ga0466959_0112660
390 Ga0466959_0169646
391 Ga0495617_022234
392 Ga0495592_0364260
393 Ga0495629_0022558
394 Ga0495629_0040788
395 Ga0495629_0322411
396 Ga0495638_0028601
397 Ga0495638_0122706
398 Ga0495651_0076482
399 Ga0495582_0332123
400 Ga0495662_0001510
401 Ga0495664_0000614
402 Ga0495585_0008893
403 Ga0495594_0023931
404 Ga0495594_0192091
405 Ga0495583_0050653
406 Ga0495618_0004597
407 Ga0495630_0112779
408 Ga0495632_0028072
409 Ga0495632_0038367
410 Ga0495632_0053577
411 Ga0495643_0130498
412 Ga0495648_0115756
413 Ga0495666_0056111
414 Ga0495587_0079331
415 Ga0495645_0044072
416 Ga0495622_0012515
417 Ga0495656_0152290
418 Ga0495611_0058215
419 Ga0495625_0013947
420 Ga0495625_0506159
421 Ga0495635_0001842
422 Ga0495588_0010972
423 Ga0495657_0010840
424 Ga0495599_0105797
425 Ga0495646_0013060
426 Ga0495613_0010067
427 Ga0495671_0004957
428 Ga0495671_0172619
429 Ga0495649_0058495
430 Ga0495600_0000913
431 Ga0495660_0002076
432 Ga0495581_0041737
433 Ga0495604_0001660
434 Ga0495636_0171776
435 Ga0495674_0090774
436 Ga0495674_0348323
437 Ga0495672_0154241
438 Ga0495676_0146974
439 Ga0495683_0001634
440 Ga0495683_0034776
441 Ga0495687_004352
442 Ga0495687_007680
443 Ga0495687_058186
444 Ga0495687_073278
445 Ga0495675_0504913
446 Ga0495685_000698
447 Ga0495685_050670
448 Ga0495681_0007869
449 Ga0495684_0062720
450 Ga0495593_0000431
451 Ga0495602_0560484
452 Ga0495614_0014310
453 Ga0496102_0105159
454 Ga0496106_0596296
455 Ga0496107_0728779
456 Ga0496113_1164971
457 Ga0496116_0019449
458 Ga0496117_0000024
459 Ga0496118_0000014
460 Ga0496119_0011835
461 Ga0496119_0024663
462 Ga0496120_0000115
463 Ga0496120_0036104
464 Ga0496120_0088587
465 Ga0496121_0009580
466 Ga0496121_0047179
467 Ga0496121_0278844
468 Ga0496122_0278422
469 Ga0496124_0005549
470 Ga0496125_0000409
471 Ga0496125_0091297
472 Ga0496126_0020940
473 Ga0496126_0211916
474 nmdc:mga0yw44_24671_c1
475 Ga0500610_0195252
476 Ga0495655_0041436
477 Ga0500578_0270694
478 Ga0500644_0014891
479 Ga0500644_0030710
480 Ga0500644_0052786
481 Ga0500646_0000552
482 Ga0500646_0194752
483 Ga0500583_0001187
484 Ga0500583_0100703
485 Ga0500583_0106333
486 Ga0500583_0135257
487 Ga0500583_0230102
488 Ga0500651_0120112
489 Ga0500640_021505
490 Ga0500650_0131746
491 Ga0500654_062857
492 Ga0500660_073532
493 Ga0500553_127824
494 Ga0500556_0184857
495 Ga0500560_000319
496 Ga0500569_019331
497 Ga0500572_139747
498 Ga0500591_044356
499 Ga0500614_099423
500 Ga0500617_052740
501 Ga0500652_012393
502 Ga0500652_174404
503 Ga0500658_0284760
504 Ga0500561_0023376
505 Ga0500568_0005671
506 Ga0500568_0188376
507 Ga0500579_067736
508 Ga0500579_151001
509 Ga0500579_279550
510 Ga0500588_0014810
511 Ga0500589_246106
512 Ga0500600_0069443
513 Ga0500600_0076288
514 Ga0500600_0248072
515 Ga0500616_0000049
516 Ga0500616_0000131
517 Ga0500616_0067890
518 Ga0500616_0125109
519 Ga0500616_0278776
520 Ga0500622_0024179
521 Ga0500633_0006229
522 Ga0500633_0331041
523 Ga0500637_0049315
524 Ga0500637_0082152
525 Ga0500611_121843
526 Ga0500656_001872
527 Ga0500656_005195
528 Ga0500587_002368
529 2734971612
530 2821116187
531 2857469524
532 2857595088
533 2885530556
534 2904166106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

23

135

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z3j-assembly1.cif.gz_D crystal structure of blasticidin s deaminase (bsd) r90k mutant 0.8698 15 146
2z3g-assembly1.cif.gz_B crystal structure of blasticidin s deaminase (bsd) 0.8688 15 148
2z3i-assembly1.cif.gz_D crystal structure of blasticidin s deaminase (bsd) mutant e56q complexed with substrate 0.867 15 146
2z3j-assembly1.cif.gz_D crystal structure of blasticidin s deaminase (bsd) r90k mutant 0.8633 15 146
2z3g-assembly1.cif.gz_B crystal structure of blasticidin s deaminase (bsd) 0.8563 15 148
ID Description Score Start End Superfamily
2z3iA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8691 15 146 3.40.140.10
3b8fA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8449 18 145 3.40.140.10
4wigA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8383 16 148 3.40.140.10
2z3iA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8312 15 146 3.40.140.10
4wigA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8139 16 148 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A3N4U0X4-F1-model_v4 deleted 0.9597 4 150
AF-A0A7G1NWV2-F1-model_v4 Cytidine deaminase 0.9534 6 150 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A3N4U0X4-F1-model_v4 deleted 0.941 4 150
AF-A0A1N7DUP9-F1-model_v4 Cytidine deaminase 0.9337 15 150 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A1N7DUP9-F1-model_v4 Cytidine deaminase 0.9269 15 150 GO:0004126
GO:0005829
GO:0008270
GO:0009972

Map