F374849

General Info

Members Datasets Scaffolds Average Seq Length
267 170 265 205

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10518042|Ga0207648_105180422
Length 227
Sequence MTNIQPESLYIKVVEITKNFLGPAAERFITRQIKIHLKKDPQDLTKEDILSLSSYLEVKDFALLAPQATNNTWYPYSFLSPPSQNEPWLSSALSLLKDLLSDIYSKGISPGNIYFAGFSQGACLTLEFVTRNANKYGGVVAFTGGLIGDKIIEENYQGDFLGTPIFIGTSDPDPHVPVERANASSNILKRMNASVTLKVYPNMGHTISQDEIENANRLVFRAQSVNQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
159 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
160 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
161 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
166 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
167 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.38
Metatranscriptomes 4.87
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0
Rhizoplane 0.75
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1250759 2162886007 Bacteria 3341
2 JGI24739J22299_10010821 3300001989 Bacteria 3378
3 JGI25406J46586_10000523 3300003203 Bacteria 17970
4 JGI25153J46596_10013593 3300003215 Bacteria 3431
5 rootL2_10112206 3300003322 Unclassified 4129
6 JGI25160J50197_1005105 3300003354 Bacteria 5527
7 Ga0055526_1005751 3300003771 Bacteria 6997
8 Ga0055526_1007606 3300003771 Bacteria 5591
9 Ga0055528_1000552 3300003790 Bacteria 28584
10 Ga0055530_10026555 3300003791 Bacteria 1598
11 Ga0055543_1014787 3300004625 Bacteria 1514
12 Ga0065165_1000010 3300005262 Bacteria 323737
13 Ga0065714_10220971 3300005288 Bacteria 841
14 Ga0065704_10070319 3300005289 Bacteria 33341
15 Ga0065712_10076407 3300005290 Bacteria 3666
16 Ga0070658_10059847 3300005327 Bacteria 3101
17 Ga0070676_10032586 3300005328 Bacteria 2986
18 Ga0070683_100051742 3300005329 Unclassified 3804
19 Ga0070683_100133726 3300005329 Unclassified 2348
20 Ga0070683_100547074 3300005329 Bacteria 1107
21 Ga0070683_100709075 3300005329 Bacteria 964
22 Ga0070670_100048430 3300005331 Bacteria 3657
23 Ga0070670_100077630 3300005331 Bacteria 2853
24 Ga0068869_100074459 3300005334 Bacteria 2520
25 Ga0070666_10053360 3300005335 Unclassified 2726
26 Ga0070682_100008873 3300005337 Bacteria 5677
27 Ga0068868_100011227 3300005338 Bacteria 6522
28 Ga0068868_100249656 3300005338 Bacteria 1493
29 Ga0070660_100004013 3300005339 Bacteria 10161
30 Ga0070661_100098851 3300005344 Bacteria 2167
31 Ga0070661_100117820 3300005344 Unclassified 1987
32 Ga0070668_100054074 3300005347 Bacteria 3096
33 Ga0070675_100107646 3300005354 Bacteria 2354
34 Ga0070675_100424631 3300005354 Bacteria 1189
35 Ga0070675_100608852 3300005354 Bacteria 991
36 Ga0070671_100069619 3300005355 Bacteria 2935
37 Ga0070671_100089368 3300005355 Bacteria 2579
38 Ga0070673_100033176 3300005364 Bacteria 3895
39 Ga0070688_100054783 3300005365 Bacteria 2499
40 Ga0070688_100284787 3300005365 Bacteria 1189
41 Ga0070659_100057998 3300005366 Bacteria 3054
42 Ga0070667_100091058 3300005367 Bacteria 2622
43 Ga0070667_100136328 3300005367 Bacteria 2146
44 Ga0070663_100146529 3300005455 Bacteria 1807
45 Ga0070663_100169376 3300005455 Bacteria 1687
46 Ga0070662_100023263 3300005457 Bacteria 4255
47 Ga0070662_100050966 3300005457 Bacteria 2987
48 Ga0070681_10358834 3300005458 Bacteria 1368
49 Ga0070681_10489556 3300005458 Bacteria 1143
50 Ga0068867_100557249 3300005459 Bacteria 994
51 Ga0070679_100040918 3300005530 Bacteria 4612
52 Ga0070679_100713412 3300005530 Bacteria 946
53 Ga0070684_100017886 3300005535 Bacteria 5826
54 Ga0070684_100056318 3300005535 Unclassified 3431
55 Ga0070684_100142302 3300005535 Unclassified 2169
56 Ga0068853_100143834 3300005539 Bacteria 2142
57 Ga0068853_100332869 3300005539 Bacteria 1409
58 Ga0070672_100145310 3300005543 Bacteria 1959
59 Ga0070672_100838039 3300005543 Bacteria 810
60 Ga0070665_100175833 3300005548 Bacteria 2141
61 Ga0068855_100443779 3300005563 Bacteria 1417
62 Ga0068855_100452132 3300005563 Bacteria 1401
63 Ga0070664_100011375 3300005564 Bacteria 7218
64 Ga0070664_100031724 3300005564 Bacteria 4417
65 Ga0070664_100165549 3300005564 Bacteria 1959
66 Ga0068857_100123456 3300005577 Bacteria 2333
67 Ga0068857_100142868 3300005577 Bacteria 2164
68 Ga0068856_100004590 3300005614 Bacteria 13736
69 Ga0068852_100015024 3300005616 Bacteria 5986
70 Ga0068852_100182256 3300005616 Bacteria 1975
71 Ga0068852_100689671 3300005616 Bacteria 1031
72 Ga0068864_100085665 3300005618 Bacteria 2770
73 Ga0068864_100118010 3300005618 Unclassified 2369
74 Ga0068861_100007481 3300005719 Bacteria 7487
75 Ga0068861_100049670 3300005719 Bacteria 3177
76 Ga0068851_10011899 3300005834 Bacteria 4092
77 Ga0068863_100381703 3300005841 Bacteria 1376
78 Ga0068858_100335835 3300005842 Bacteria 1446
79 Ga0081539_10000382 3300005985 Bacteria 96235
80 Ga0081539_10001000 3300005985 Bacteria 52492
81 Ga0075366_10113661 3300006195 Unclassified 1630
82 Ga0097621_100011133 3300006237 Bacteria 6618
83 Ga0068871_100112256 3300006358 Bacteria 2293
84 Ga0068871_100219477 3300006358 Bacteria 1647
85 Ga0068871_100747138 3300006358 Bacteria 899
86 Ga0068865_100385983 3300006881 Bacteria 1143
87 Ga0111539_10668201 3300009094 Bacteria 1210
88 Ga0111539_11578223 3300009094 Bacteria 761
89 Ga0105242_10220873 3300009176 Bacteria 1693
90 Ga0105237_10119444 3300009545 Unclassified 2630
91 Ga0105249_10100942 3300009553 Bacteria 2713
92 Ga0105239_10455797 3300010375 Bacteria 1451
93 Ga0105246_10238193 3300011119 Bacteria 1437
94 Ga0157373_10001845 3300013100 Bacteria 16096
95 Ga0157373_10007137 3300013100 Bacteria 8332
96 Ga0157373_10154105 3300013100 Bacteria 1617
97 Ga0157373_10401812 3300013100 Bacteria 982
98 Ga0157371_10001500 3300013102 Bacteria 24148
99 Ga0157371_10002731 3300013102 Bacteria 16625
100 Ga0157371_10030570 3300013102 Unclassified 3885
101 Ga0157371_10130613 3300013102 Bacteria 1787
102 Ga0157371_10182729 3300013102 Bacteria 1500
103 Ga0157371_10209867 3300013102 Bacteria 1397
104 Ga0157371_10237728 3300013102 Bacteria 1310
105 Ga0157370_10000821 3300013104 Bacteria 39240
106 Ga0157370_10147563 3300013104 Bacteria 2190
107 Ga0157370_10821987 3300013104 Unclassified 845
108 Ga0157369_10028156 3300013105 Bacteria 6220
109 Ga0157374_10022147 3300013296 Bacteria 5665
110 Ga0157374_10025442 3300013296 Bacteria 5315
111 Ga0157374_10586259 3300013296 Bacteria 1124
112 Ga0157378_10168488 3300013297 Bacteria 2052
113 Ga0163162_10254359 3300013306 Bacteria 1888
114 Ga0163162_10300982 3300013306 Bacteria 1736
115 Ga0163162_10387142 3300013306 Bacteria 1531
116 Ga0163162_10571371 3300013306 Bacteria 1258
117 Ga0163162_10823877 3300013306 Bacteria 1044
118 Ga0163162_10973140 3300013306 Bacteria 959
119 Ga0163162_11004488 3300013306 Bacteria 943
120 Ga0157372_10010808 3300013307 Bacteria 9717
121 Ga0157372_10083383 3300013307 Bacteria 3621
122 Ga0157372_10114563 3300013307 Bacteria 3090
123 Ga0157372_10261204 3300013307 Bacteria 2011
124 Ga0157372_10327550 3300013307 Bacteria 1783
125 Ga0157372_10398987 3300013307 Bacteria 1603
126 Ga0157372_10476325 3300013307 Bacteria 1455
127 Ga0157372_10617329 3300013307 Unclassified 1264
128 Ga0157372_10915040 3300013307 Bacteria 1017
129 Ga0157375_10198196 3300013308 Bacteria 2163
130 Ga0157375_11132171 3300013308 Bacteria 917
131 Ga0157375_11257192 3300013308 Bacteria 869
132 Ga0163163_10157836 3300014325 Bacteria 2313
133 Ga0157380_10014544 3300014326 Bacteria 5759
134 Ga0157380_10192948 3300014326 Bacteria 1800
135 Ga0182008_10005884 3300014497 Bacteria 6929
136 Ga0182008_10128971 3300014497 Bacteria 1260
137 Ga0157379_10213916 3300014968 Bacteria 1746
138 Ga0157376_10019671 3300014969 Bacteria 5209
139 Ga0157376_10282054 3300014969 Bacteria 1565
140 Ga0157376_10643252 3300014969 Bacteria 1060
141 Ga0182006_1012445 3300015261 Bacteria 3720
142 Ga0182007_10004566 3300015262 Bacteria 6257
143 Ga0209673_1000082 3300025273 Bacteria 219716
144 Ga0209675_1034839 3300025291 Bacteria 1153
145 Ga0209564_1002462 3300025295 Bacteria 14529
146 Ga0209564_1002552 3300025295 Bacteria 14011
147 Ga0209758_1002720 3300025297 Bacteria 17416
148 Ga0209758_1006497 3300025297 Bacteria 8361
149 Ga0209050_1000389 3300025298 Bacteria 82517
150 Ga0207426_1002006 3300025302 Bacteria 14373
151 Ga0209257_1006346 3300025304 Bacteria 7683
152 Ga0207656_10006093 3300025321 Bacteria 4316
153 Ga0207680_10129451 3300025903 Unclassified 1662
154 Ga0207680_10578785 3300025903 Bacteria 802
155 Ga0207647_10166062 3300025904 Bacteria 1286
156 Ga0207645_10042168 3300025907 Bacteria 2920
157 Ga0207705_10206120 3300025909 Bacteria 1491
158 Ga0207695_10255264 3300025913 Bacteria 1652
159 Ga0207671_10285013 3300025914 Bacteria 1303
160 Ga0207660_10018955 3300025917 Unclassified 4595
161 Ga0207657_10004306 3300025919 Bacteria 15087
162 Ga0207657_10076708 3300025919 Bacteria 2819
163 Ga0207652_10346509 3300025921 Bacteria 1341
164 Ga0207652_10621261 3300025921 Bacteria 968
165 Ga0207646_10425534 3300025922 Bacteria 1198
166 Ga0207650_10408709 3300025925 Bacteria 1125
167 Ga0207659_10345539 3300025926 Bacteria 1233
168 Ga0207644_10680552 3300025931 Bacteria 857
169 Ga0207644_10702858 3300025931 Bacteria 843
170 Ga0207690_10513570 3300025932 Bacteria 970
171 Ga0207706_10012755 3300025933 Bacteria 7649
172 Ga0207669_10316285 3300025937 Bacteria 1193
173 Ga0207704_10088793 3300025938 Bacteria 2024
174 Ga0207704_10106581 3300025938 Bacteria 1883
175 Ga0207691_10040616 3300025940 Unclassified 4297
176 Ga0207689_10219677 3300025942 Bacteria 1570
177 Ga0207661_10008761 3300025944 Bacteria 7236
178 Ga0207661_10158817 3300025944 Unclassified 1960
179 Ga0207661_10397108 3300025944 Bacteria 1250
180 Ga0207679_10156324 3300025945 Unclassified 1862
181 Ga0207679_10363071 3300025945 Bacteria 1265
182 Ga0207667_10578188 3300025949 Bacteria 1134
183 Ga0207651_10007741 3300025960 Bacteria 5742
184 Ga0207651_10079366 3300025960 Bacteria 2358
185 Ga0207668_10010633 3300025972 Bacteria 5567
186 Ga0207658_10016809 3300025986 Bacteria 5034
187 Ga0207658_10483327 3300025986 Bacteria 1101
188 Ga0207677_10044342 3300026023 Bacteria 2963
189 Ga0207677_10266002 3300026023 Bacteria 1400
190 Ga0207677_10713826 3300026023 Bacteria 891
191 Ga0207703_10035122 3300026035 Bacteria 3983
192 Ga0207639_10104138 3300026041 Bacteria 2300
193 Ga0207639_10291773 3300026041 Bacteria 1438
194 Ga0207678_10139740 3300026067 Bacteria 2067
195 Ga0207678_10703562 3300026067 Unclassified 889
196 Ga0207678_10840392 3300026067 Bacteria 811
197 Ga0207702_10193230 3300026078 Bacteria 1882
198 Ga0207641_10437953 3300026088 Bacteria 1261
199 Ga0207648_10518042 3300026089 Bacteria 1092
200 Ga0207676_10065300 3300026095 Bacteria 2897
201 Ga0207674_10147316 3300026116 Bacteria 2312
202 Ga0207675_100013096 3300026118 Bacteria 7739
203 Ga0207675_100182549 3300026118 Unclassified 2010
204 Ga0207675_100618655 3300026118 Unclassified 1087
205 Ga0207698_10404018 3300026142 Bacteria 1306
206 Ga0207698_10667129 3300026142 Bacteria 1032
207 Ga0209995_1018428 3300027471 Bacteria 1151
208 Ga0209974_10194935 3300027876 Bacteria 746
209 Ga0268264_10371752 3300028381 Bacteria 1366
210 Ga0307513_10255876 3300031456 Bacteria 1544
211 Ga0307412_10000009 3300031911 Bacteria 445987
212 Ga0307414_10000976 3300032004 Bacteria 14591
213 Ga0395900_0608776 3300037418 Bacteria 1032
214 Ga0395900_0622757 3300037418 Bacteria 1018
215 Ga0395905_0087590 3300037471 Bacteria 2919
216 Ga0395905_0177823 3300037471 Bacteria 1997
217 Ga0451791_0208598 3300041451 Bacteria 843
218 Ga0451798_0769819 3300041458 Bacteria 943
219 Ga0451853_4046297 3300041512 Unclassified 653
220 Ga0439433_0085656 3300041999 Bacteria 770
221 Ga0439449_0002155 3300042007 Bacteria 7733
222 Ga0439457_002577 3300042014 Bacteria 5133
223 Ga0439457_003498 3300042014 Bacteria 4266
224 Ga0453684_0660008 3300044712 Unclassified 1140
225 Ga0466957_0001781 3300044842 Bacteria 11334
226 Ga0466959_0072479 3300045049 Bacteria 2493
227 Ga0451576_0321148 3300045051 Unclassified 1620
228 Ga0495636_0019647 3300047318 Bacteria 2717
229 Ga0501306_000881 3300049127 Bacteria 2575
230 Ga0501306_003317 3300049127 Bacteria 1727
231 Ga0501308_009745 3300049128 Bacteria 1055
232 Ga0501310_023058 3300049130 Bacteria 790
233 Ga0501304_008218 3300049160 Bacteria 876
234 Ga0501305_017855 3300049161 Bacteria 1022
235 Ga0501305_023935 3300049161 Bacteria 917
236 Ga0501307_005980 3300049162 Bacteria 1299
237 Ga0501307_011226 3300049162 Bacteria 1049
238 Ga0501298_024958 3300049521 Bacteria 1142
239 Ga0501312_000514 3300049528 Bacteria 3169
240 Ga0501312_022427 3300049528 Bacteria 946
241 Ga0501314_002740 3300049530 Unclassified 1381
242 Ga0501315_001413 3300049531 Bacteria 2051
243 Ga0501034_0159707 3300049571 Bacteria 2226
244 Ga0501034_0475072 3300049571 Bacteria 1166
245 Ga0501037_0734186 3300049573 Bacteria 655
246 Ga0501043_0201262 3300049579 Bacteria 1546
247 Ga0501047_0067673 3300049581 Bacteria 3441
248 Ga0501047_0346204 3300049581 Bacteria 1323
249 Ga0501048_0373408 3300049582 Bacteria 1018
250 Ga0501048_0728629 3300049582 Bacteria 712
251 Ga0501250_008175 3300049680 Bacteria 1148
252 Ga0501253_073126 3300049683 Unclassified 761
253 Ga0501257_024085 3300049686 Bacteria 1445
254 Ga0501245_031873 3300049708 Bacteria 875
255 Ga0501044_0064935 3300049823 Bacteria 3723
256 Ga0501044_0151138 3300049823 Unclassified 2304
257 nmdc:mga0k408_26234_c1 3300050493 Bacteria 3302
258 nmdc:mga0k408_402388_c1 3300050493 Bacteria 815
259 Ga0500644_0037218 3300053088 Bacteria 1589
260 Ga0500583_0000004 3300053092 Bacteria 174723
261 Ga0500651_0000309 3300053093 Bacteria 28089
262 Ga0500650_0207048 3300053098 Bacteria 892
263 Ga0500618_000001 3300053125 Bacteria 538477
264 Ga0500637_0035535 3300053178 Bacteria 2794
265 Ga0500611_000018 3300053727 Bacteria 111023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10425534 Ga0207646_104255342 168
2 3300049571 Ga0501034_0475072 Ga0501034_0475072_568_1149 182
3 3300049573 Ga0501037_0734186 Ga0501037_0734186_45_626 182
4 3300037471 Ga0395905_0087590 Ga0395905_0087590_1351_1989 183
5 3300049161 Ga0501305_023935 Ga0501305_023935_329_886 185
6 3300005338 Ga0068868_100011227 Ga0068868_1000112275 186
7 3300005364 Ga0070673_100033176 Ga0070673_1000331765 186
8 3300005834 Ga0068851_10011899 Ga0068851_100118992 186
9 3300006358 Ga0068871_100112256 Ga0068871_1001122562 186
10 3300025321 Ga0207656_10006093 Ga0207656_100060933 186
11 3300025907 Ga0207645_10042168 Ga0207645_100421682 186
12 3300025940 Ga0207691_10040616 Ga0207691_100406168 186
13 3300025960 Ga0207651_10007741 Ga0207651_100077419 186
14 3300025972 Ga0207668_10010633 Ga0207668_100106332 186
15 3300025986 Ga0207658_10016809 Ga0207658_100168098 186
16 3300026035 Ga0207703_10035122 Ga0207703_100351222 186
17 3300041512 Ga0451853_4046297 Ga0451853_4046297_24_584 186
18 3300049686 Ga0501257_024085 Ga0501257_024085_625_1242 187
19 3300037418 Ga0395900_0608776 Ga0395900_0608776_303_938 192
20 3300037471 Ga0395905_0177823 Ga0395905_0177823_1230_1865 192
21 3300053727 Ga0500611_000018 Ga0500611_000018_49255_49875 192
22 3300005329 Ga0070683_100051742 Ga0070683_1000517425 193
23 3300005344 Ga0070661_100117820 Ga0070661_1001178201 193
24 3300005367 Ga0070667_100091058 Ga0070667_1000910582 193
25 3300005535 Ga0070684_100142302 Ga0070684_1001423023 193
26 3300005564 Ga0070664_100011375 Ga0070664_1000113759 193
27 3300006195 Ga0075366_10113661 Ga0075366_101136612 193
28 3300009094 Ga0111539_11578223 Ga0111539_115782231 193
29 3300013306 Ga0163162_10387142 Ga0163162_103871422 193
30 3300025903 Ga0207680_10578785 Ga0207680_105787851 193
31 3300025931 Ga0207644_10680552 Ga0207644_106805521 193
32 3300025944 Ga0207661_10008761 Ga0207661_100087611 193
33 3300025945 Ga0207679_10156324 Ga0207679_101563242 193
34 3300026118 Ga0207675_100182549 Ga0207675_1001825493 193
35 3300049130 Ga0501310_023058 Ga0501310_023058_29_664 193
36 3300049521 Ga0501298_024958 Ga0501298_024958_273_908 193
37 3300049528 Ga0501312_022427 Ga0501312_022427_75_710 193
38 3300049530 Ga0501314_002740 Ga0501314_002740_735_1370 193
39 3300049531 Ga0501315_001413 Ga0501315_001413_552_1187 193
40 3300049708 Ga0501245_031873 Ga0501245_031873_212_847 193
41 3300053178 Ga0500637_0035535 Ga0500637_0035535_854_1474 193
42 3300005354 Ga0070675_100608852 Ga0070675_1006088522 194
43 3300005543 Ga0070672_100838039 Ga0070672_1008380392 194
44 3300005616 Ga0068852_100182256 Ga0068852_1001822562 194
45 3300005985 Ga0081539_10001000 Ga0081539_1000100034 194
46 3300013104 Ga0157370_10821987 Ga0157370_108219871 194
47 3300025960 Ga0207651_10079366 Ga0207651_100793662 194
48 3300026067 Ga0207678_10840392 Ga0207678_108403922 194
49 3300026142 Ga0207698_10404018 Ga0207698_104040182 194
50 3300047318 Ga0495636_0019647 Ga0495636_0019647_1110_1727 194
51 3300049579 Ga0501043_0201262 Ga0501043_0201262_126_743 194
52 3300049581 Ga0501047_0346204 Ga0501047_0346204_427_1044 194
53 3300049582 Ga0501048_0728629 Ga0501048_0728629_34_651 194
54 3300049680 Ga0501250_008175 Ga0501250_008175_31_669 194
55 3300049683 Ga0501253_073126 Ga0501253_073126_50_688 194
56 3300049823 Ga0501044_0151138 Ga0501044_0151138_1050_1667 194
57 3300005329 Ga0070683_100547074 Ga0070683_1005470741 195
58 3300005458 Ga0070681_10358834 Ga0070681_103588342 195
59 3300005564 Ga0070664_100165549 Ga0070664_1001655493 195
60 3300005719 Ga0068861_100007481 Ga0068861_1000074812 195
61 3300009545 Ga0105237_10119444 Ga0105237_101194443 195
62 3300013100 Ga0157373_10401812 Ga0157373_104018121 195
63 3300013296 Ga0157374_10022147 Ga0157374_100221471 195
64 3300014497 Ga0182008_10005884 Ga0182008_100058844 195
65 3300015262 Ga0182007_10004566 Ga0182007_100045667 195
66 3300025914 Ga0207671_10285013 Ga0207671_102850132 195
67 3300025919 Ga0207657_10076708 Ga0207657_100767082 195
68 3300025925 Ga0207650_10408709 Ga0207650_104087092 195
69 3300026041 Ga0207639_10104138 Ga0207639_101041382 195
70 3300026118 Ga0207675_100013096 Ga0207675_1000130961 195
71 3300041999 Ga0439433_0085656 Ga0439433_0085656_93_728 195
72 3300042007 Ga0439449_0002155 Ga0439449_0002155_6768_7403 195
73 3300042014 Ga0439457_003498 Ga0439457_003498_2913_3548 195
74 3300044842 Ga0466957_0001781 Ga0466957_0001781_4448_5083 195
75 3300005719 Ga0068861_100049670 Ga0068861_1000496703 196
76 3300013307 Ga0157372_10327550 Ga0157372_103275502 196
77 3300013307 Ga0157372_10617329 Ga0157372_106173291 196
78 3300013308 Ga0157375_11132171 Ga0157375_111321711 196
79 3300026067 Ga0207678_10703562 Ga0207678_107035621 196
80 3300045049 Ga0466959_0072479 Ga0466959_0072479_1827_2462 196
81 3300005355 Ga0070671_100089368 Ga0070671_1000893682 197
82 3300013102 Ga0157371_10002731 Ga0157371_100027313 197
83 3300013307 Ga0157372_10261204 Ga0157372_102612043 197
84 3300013307 Ga0157372_10476325 Ga0157372_104763252 197
85 3300042014 Ga0439457_002577 Ga0439457_002577_1418_2053 197
86 3300044712 Ga0453684_0660008 Ga0453684_0660008_146_775 197
87 3300045051 Ga0451576_0321148 Ga0451576_0321148_534_1163 197
88 3300003322 rootL2_10112206 rootL2_101122062 198
89 3300005577 Ga0068857_100142868 Ga0068857_1001428682 198
90 3300026116 Ga0207674_10147316 Ga0207674_101473162 198
91 iso_pu_bacteria 2929154850 2929159064 200
92 iso_pu_bacteria 2738541278 2738727475 202
93 3300005458 Ga0070681_10489556 Ga0070681_104895562 205
94 3300005530 Ga0070679_100713412 Ga0070679_1007134122 205
95 3300013100 Ga0157373_10007137 Ga0157373_100071372 205
96 3300025921 Ga0207652_10621261 Ga0207652_106212612 205
97 3300027471 Ga0209995_1018428 Ga0209995_10184282 205
98 3300027876 Ga0209974_10194935 Ga0209974_101949351 205
99 3300049127 Ga0501306_003317 Ga0501306_003317_504_1121 205
100 3300049128 Ga0501308_009745 Ga0501308_009745_335_952 205
101 3300049160 Ga0501304_008218 Ga0501304_008218_149_766 205
102 3300049161 Ga0501305_017855 Ga0501305_017855_368_985 205
103 3300049528 Ga0501312_000514 Ga0501312_000514_1872_2489 205
104 3300001989 JGI24739J22299_10010821 JGI24739J22299_100108215 206
105 3300003215 JGI25153J46596_10013593 JGI25153J46596_100135932 206
106 3300003354 JGI25160J50197_1005105 JGI25160J50197_10051055 206
107 3300003771 Ga0055526_1005751 Ga0055526_10057513 206
108 3300003771 Ga0055526_1007606 Ga0055526_10076064 206
109 3300003790 Ga0055528_1000552 Ga0055528_10005528 206
110 3300003791 Ga0055530_10026555 Ga0055530_100265552 206
111 3300004625 Ga0055543_1014787 Ga0055543_10147871 206
112 3300005262 Ga0065165_1000010 Ga0065165_1000010192 206
113 3300005329 Ga0070683_100133726 Ga0070683_1001337262 206
114 3300005354 Ga0070675_100424631 Ga0070675_1004246311 206
115 3300005535 Ga0070684_100056318 Ga0070684_1000563183 206
116 3300005618 Ga0068864_100118010 Ga0068864_1001180102 206
117 3300006358 Ga0068871_100747138 Ga0068871_1007471382 206
118 3300013100 Ga0157373_10154105 Ga0157373_101541052 206
119 3300013102 Ga0157371_10182729 Ga0157371_101827292 206
120 3300013306 Ga0163162_10254359 Ga0163162_102543592 206
121 3300013306 Ga0163162_10571371 Ga0163162_105713712 206
122 3300013306 Ga0163162_10823877 Ga0163162_108238772 206
123 3300013306 Ga0163162_11004488 Ga0163162_110044881 206
124 3300013307 Ga0157372_10915040 Ga0157372_109150402 206
125 3300013308 Ga0157375_11257192 Ga0157375_112571922 206
126 3300014326 Ga0157380_10192948 Ga0157380_101929482 206
127 3300014497 Ga0182008_10128971 Ga0182008_101289712 206
128 3300025273 Ga0209673_1000082 Ga0209673_1000082164 206
129 3300025291 Ga0209675_1034839 Ga0209675_10348392 206
130 3300025295 Ga0209564_1002462 Ga0209564_100246211 206
131 3300025295 Ga0209564_1002552 Ga0209564_10025522 206
132 3300025297 Ga0209758_1002720 Ga0209758_100272010 206
133 3300025297 Ga0209758_1006497 Ga0209758_10064977 206
134 3300025298 Ga0209050_1000389 Ga0209050_100038960 206
135 3300025302 Ga0207426_1002006 Ga0207426_10020062 206
136 3300025304 Ga0209257_1006346 Ga0209257_10063466 206
137 3300025944 Ga0207661_10158817 Ga0207661_101588172 206
138 3300026023 Ga0207677_10713826 Ga0207677_107138261 206
139 3300049127 Ga0501306_000881 Ga0501306_000881_1637_2257 206
140 3300050493 nmdc:mga0k408_26234_c1 nmdc:mga0k408_26234_c1_1809_2429 206
141 3300050493 nmdc:mga0k408_402388_c1 nmdc:mga0k408_402388_c1_14_634 206
142 3300053088 Ga0500644_0037218 Ga0500644_0037218_750_1370 206
143 3300053098 Ga0500650_0207048 Ga0500650_0207048_99_719 206
144 3300003203 JGI25406J46586_10000523 JGI25406J46586_100005235 207
145 3300005288 Ga0065714_10220971 Ga0065714_102209712 207
146 3300005290 Ga0065712_10076407 Ga0065712_100764072 207
147 3300005327 Ga0070658_10059847 Ga0070658_100598474 207
148 3300005328 Ga0070676_10032586 Ga0070676_100325863 207
149 3300005329 Ga0070683_100709075 Ga0070683_1007090751 207
150 3300005331 Ga0070670_100048430 Ga0070670_1000484305 207
151 3300005334 Ga0068869_100074459 Ga0068869_1000744593 207
152 3300005335 Ga0070666_10053360 Ga0070666_100533602 207
153 3300005337 Ga0070682_100008873 Ga0070682_1000088732 207
154 3300005338 Ga0068868_100249656 Ga0068868_1002496562 207
155 3300005339 Ga0070660_100004013 Ga0070660_1000040135 207
156 3300005344 Ga0070661_100098851 Ga0070661_1000988513 207
157 3300005347 Ga0070668_100054074 Ga0070668_1000540742 207
158 3300005354 Ga0070675_100107646 Ga0070675_1001076463 207
159 3300005355 Ga0070671_100069619 Ga0070671_1000696195 207
160 3300005365 Ga0070688_100054783 Ga0070688_1000547834 207
161 3300005365 Ga0070688_100284787 Ga0070688_1002847872 207
162 3300005366 Ga0070659_100057998 Ga0070659_1000579982 207
163 3300005367 Ga0070667_100136328 Ga0070667_1001363281 207
164 3300005455 Ga0070663_100146529 Ga0070663_1001465292 207
165 3300005455 Ga0070663_100169376 Ga0070663_1001693762 207
166 3300005457 Ga0070662_100023263 Ga0070662_1000232636 207
167 3300005457 Ga0070662_100050966 Ga0070662_1000509665 207
168 3300005459 Ga0068867_100557249 Ga0068867_1005572492 207
169 3300005530 Ga0070679_100040918 Ga0070679_1000409185 207
170 3300005535 Ga0070684_100017886 Ga0070684_1000178861 207
171 3300005539 Ga0068853_100143834 Ga0068853_1001438343 207
172 3300005539 Ga0068853_100332869 Ga0068853_1003328692 207
173 3300005543 Ga0070672_100145310 Ga0070672_1001453102 207
174 3300005548 Ga0070665_100175833 Ga0070665_1001758332 207
175 3300005563 Ga0068855_100443779 Ga0068855_1004437792 207
176 3300005563 Ga0068855_100452132 Ga0068855_1004521322 207
177 3300005564 Ga0070664_100031724 Ga0070664_1000317241 207
178 3300005577 Ga0068857_100123456 Ga0068857_1001234564 207
179 3300005614 Ga0068856_100004590 Ga0068856_1000045908 207
180 3300005616 Ga0068852_100015024 Ga0068852_1000150241 207
181 3300005616 Ga0068852_100689671 Ga0068852_1006896711 207
182 3300005618 Ga0068864_100085665 Ga0068864_1000856655 207
183 3300005841 Ga0068863_100381703 Ga0068863_1003817032 207
184 3300005842 Ga0068858_100335835 Ga0068858_1003358352 207
185 3300005985 Ga0081539_10000382 Ga0081539_1000038226 207
186 3300006237 Ga0097621_100011133 Ga0097621_1000111338 207
187 3300006358 Ga0068871_100219477 Ga0068871_1002194772 207
188 3300006881 Ga0068865_100385983 Ga0068865_1003859831 207
189 3300009094 Ga0111539_10668201 Ga0111539_106682012 207
190 3300009176 Ga0105242_10220873 Ga0105242_102208732 207
191 3300009553 Ga0105249_10100942 Ga0105249_101009423 207
192 3300010375 Ga0105239_10455797 Ga0105239_104557972 207
193 3300011119 Ga0105246_10238193 Ga0105246_102381932 207
194 3300013100 Ga0157373_10001845 Ga0157373_100018459 207
195 3300013102 Ga0157371_10130613 Ga0157371_101306133 207
196 3300013102 Ga0157371_10209867 Ga0157371_102098672 207
197 3300013102 Ga0157371_10237728 Ga0157371_102377282 207
198 3300013104 Ga0157370_10147563 Ga0157370_101475632 207
199 3300013105 Ga0157369_10028156 Ga0157369_100281562 207
200 3300013296 Ga0157374_10025442 Ga0157374_100254425 207
201 3300013296 Ga0157374_10586259 Ga0157374_105862592 207
202 3300013297 Ga0157378_10168488 Ga0157378_101684882 207
203 3300013306 Ga0163162_10300982 Ga0163162_103009822 207
204 3300013306 Ga0163162_10973140 Ga0163162_109731402 207
205 3300013307 Ga0157372_10010808 Ga0157372_1001080810 207
206 3300013307 Ga0157372_10083383 Ga0157372_100833832 207
207 3300013307 Ga0157372_10114563 Ga0157372_101145634 207
208 3300013307 Ga0157372_10398987 Ga0157372_103989872 207
209 3300013308 Ga0157375_10198196 Ga0157375_101981961 207
210 3300014325 Ga0163163_10157836 Ga0163163_101578363 207
211 3300014326 Ga0157380_10014544 Ga0157380_100145446 207
212 3300014968 Ga0157379_10213916 Ga0157379_102139162 207
213 3300014969 Ga0157376_10019671 Ga0157376_100196716 207
214 3300014969 Ga0157376_10282054 Ga0157376_102820542 207
215 3300014969 Ga0157376_10643252 Ga0157376_106432521 207
216 3300025903 Ga0207680_10129451 Ga0207680_101294512 207
217 3300025904 Ga0207647_10166062 Ga0207647_101660621 207
218 3300025909 Ga0207705_10206120 Ga0207705_102061202 207
219 3300025917 Ga0207660_10018955 Ga0207660_100189553 207
220 3300025919 Ga0207657_10004306 Ga0207657_100043067 207
221 3300025921 Ga0207652_10346509 Ga0207652_103465092 207
222 3300025926 Ga0207659_10345539 Ga0207659_103455391 207
223 3300025931 Ga0207644_10702858 Ga0207644_107028582 207
224 3300025932 Ga0207690_10513570 Ga0207690_105135701 207
225 3300025933 Ga0207706_10012755 Ga0207706_100127552 207
226 3300025937 Ga0207669_10316285 Ga0207669_103162853 207
227 3300025938 Ga0207704_10088793 Ga0207704_100887932 207
228 3300025938 Ga0207704_10106581 Ga0207704_101065812 207
229 3300025942 Ga0207689_10219677 Ga0207689_102196772 207
230 3300025944 Ga0207661_10397108 Ga0207661_103971082 207
231 3300025945 Ga0207679_10363071 Ga0207679_103630711 207
232 3300025949 Ga0207667_10578188 Ga0207667_105781881 207
233 3300025986 Ga0207658_10483327 Ga0207658_104833271 207
234 3300026023 Ga0207677_10044342 Ga0207677_100443422 207
235 3300026023 Ga0207677_10266002 Ga0207677_102660022 207
236 3300026041 Ga0207639_10291773 Ga0207639_102917732 207
237 3300026067 Ga0207678_10139740 Ga0207678_101397403 207
238 3300026078 Ga0207702_10193230 Ga0207702_101932302 207
239 3300026088 Ga0207641_10437953 Ga0207641_104379532 207
240 3300026089 Ga0207648_10518042 Ga0207648_105180422 207
241 3300026095 Ga0207676_10065300 Ga0207676_100653002 207
242 3300026118 Ga0207675_100618655 Ga0207675_1006186552 207
243 3300026142 Ga0207698_10667129 Ga0207698_106671291 207
244 3300028381 Ga0268264_10371752 Ga0268264_103717522 207
245 3300031456 Ga0307513_10255876 Ga0307513_102558762 207
246 3300041451 Ga0451791_0208598 Ga0451791_0208598_48_671 207
247 3300041458 Ga0451798_0769819 Ga0451798_0769819_136_759 207
248 3300049162 Ga0501307_005980 Ga0501307_005980_593_1216 207
249 3300049162 Ga0501307_011226 Ga0501307_011226_126_749 207
250 3300049571 Ga0501034_0159707 Ga0501034_0159707_226_849 207
251 3300049581 Ga0501047_0067673 Ga0501047_0067673_1027_1650 207
252 3300049582 Ga0501048_0373408 Ga0501048_0373408_306_929 207
253 3300049823 Ga0501044_0064935 Ga0501044_0064935_888_1511 207
254 3300013102 Ga0157371_10030570 Ga0157371_100305703 208
255 3300053125 Ga0500618_000001 Ga0500618_000001_493828_494454 208
256 2162886007 SwRhRL2b_contig_1250759 SwRhRL2b_0157.00008290 209
257 3300005289 Ga0065704_10070319 Ga0065704_100703194 209
258 3300005331 Ga0070670_100077630 Ga0070670_1000776302 209
259 3300013102 Ga0157371_10001500 Ga0157371_1000150015 209
260 3300013104 Ga0157370_10000821 Ga0157370_1000082121 209
261 3300015261 Ga0182006_1012445 Ga0182006_10124452 209
262 3300025913 Ga0207695_10255264 Ga0207695_102552643 209
263 3300031911 Ga0307412_10000009 Ga0307412_10000009205 209
264 3300032004 Ga0307414_10000976 Ga0307414_1000097610 209
265 3300037418 Ga0395900_0622757 Ga0395900_0622757_315_956 209
266 3300053092 Ga0500583_0000004 Ga0500583_0000004_11076_11705 209
267 3300053093 Ga0500651_0000309 Ga0500651_0000309_6812_7441 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

60

219

0.95

PF01738

DLH

Dienelactone hydrolase family

87

223

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0c-assembly2.cif.gz_B crystal structure of phospholipase/carboxylesterase from dyadobacter fermentans dsm 18053 0.992 1 205
6bje-assembly1.cif.gz_A crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.8488 5 207
3cn7-assembly3.cif.gz_C crystal structure analysis of the carboxylesterase pa3859 from pseudomonas aeruginosa pao1- monoclinic crystal form 0.8456 8 209
4fhz-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase at 2.0 angstrom resolution 0.8411 1 209
6avw-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 l63a 0.8411 18 205
ID Description Score Start End Superfamily
4h0cB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9939 2 205 3.40.50.1820
4h0cB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9697 2 205 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8477 6 205 3.40.50.1820
3cn7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8456 8 209 3.40.50.1820
af_O95372_1_231_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8453 7 207 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A520HRT6-F1-model_v4 Phospholipase 0.9959 93 205 GO:0005737
GO:0008474
GO:0052689
AF-A0A519WDD1-F1-model_v4 Phospholipase 0.9952 1 176 GO:0016787
AF-A0A2P8G8S6-F1-model_v4 Phospholipase/carboxylesterase 0.9943 1 205 GO:0016787
AF-A0A1G6WXL7-F1-model_v4 Phospholipase/carboxylesterase 0.9941 1 205 GO:0016787
AF-A0A1H5IX45-F1-model_v4 Phospholipase/carboxylesterase 0.9934 3 207 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.13 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map