F374811

General Info

Members Datasets Scaffolds Average Seq Length
267 151 534 233

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10086602|Ga0207693_100866023
Length 266
Sequence MIEVWTWPTPNGHKVHITLEELELPYKVIPVNIGKGDQFKPEFLAITPNHRIPAIVDPDGPAGKRLTLFESAAIMIYLSEKTGGKLMPQDPVSRYKCFEWMMFQMGGVGPMFGQYNHFANYAVEKIPYAIERYTNEVARLHRALNKRLAEATWLAGDEYSLADIITFPWIRNPERRNIDLDDYPNVKRWHDAVAARPAVQRGVAVLPEYQRKGVGSRVMSELVARLPVWRILLVADREVQPFYRRLGFESYDDVMARLDRTRLFDR

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
77 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
151 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 2.25
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.75
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10086602 3300025915 Bacteria 2455
2 JGI25406J46586_10025195 3300003203 Bacteria 2313
3 Ga0058863_11416718 3300004799 Bacteria 728
4 Ga0070683_100563347 3300005329 Bacteria 1090
5 Ga0070683_100758205 3300005329 Bacteria 930
6 Ga0068868_100367271 3300005338 Bacteria 1236
7 Ga0070687_100248885 3300005343 Bacteria 1103
8 Ga0070709_10048202 3300005434 Bacteria 2658
9 Ga0070709_10061416 3300005434 Bacteria 2392
10 Ga0070709_10062442 3300005434 Bacteria 2375
11 Ga0070709_10514046 3300005434 Bacteria 911
12 Ga0070714_100043327 3300005435 Bacteria 3806
13 Ga0070714_100052864 3300005435 Bacteria 3465
14 Ga0070713_100002113 3300005436 Bacteria 12851
15 Ga0070713_100010600 3300005436 Bacteria 6666
16 Ga0070713_100109523 3300005436 Bacteria 2406
17 Ga0070713_100246314 3300005436 Bacteria 1629
18 Ga0070713_100286097 3300005436 Bacteria 1514
19 Ga0070710_10002515 3300005437 Bacteria 8696
20 Ga0070710_10052032 3300005437 Bacteria 2302
21 Ga0070711_100007874 3300005439 Bacteria 6494
22 Ga0070711_100020766 3300005439 Bacteria 4238
23 Ga0070708_100118149 3300005445 Bacteria 2443
24 Ga0070708_100280998 3300005445 Bacteria 1567
25 Ga0070678_100079075 3300005456 Bacteria 2486
26 Ga0070678_100339819 3300005456 Bacteria 1288
27 Ga0070681_10067315 3300005458 Bacteria 3550
28 Ga0070706_100189363 3300005467 Bacteria 1922
29 Ga0070706_100310675 3300005467 Bacteria 1470
30 Ga0070707_100009632 3300005468 Bacteria 8976
31 Ga0070707_100246710 3300005468 Bacteria 1738
32 Ga0070707_100265418 3300005468 Bacteria 1670
33 Ga0070698_100021924 3300005471 Bacteria 6688
34 Ga0070698_100048410 3300005471 Bacteria 4343
35 Ga0070698_100194298 3300005471 Bacteria 1966
36 Ga0070699_100217879 3300005518 Bacteria 1700
37 Ga0070679_100345018 3300005530 Bacteria 1437
38 Ga0070697_100399305 3300005536 Bacteria 1193
39 Ga0070697_100489560 3300005536 Bacteria 1075
40 Ga0070704_100018570 3300005549 Bacteria 4449
41 Ga0068855_100411292 3300005563 Bacteria 1481
42 Ga0068856_100199949 3300005614 Bacteria 2013
43 Ga0081539_10002623 3300005985 Bacteria 24577
44 Ga0070717_10042223 3300006028 Bacteria 3719
45 Ga0070717_10121530 3300006028 Bacteria 2238
46 Ga0070717_10163087 3300006028 Bacteria 1935
47 Ga0070717_10245116 3300006028 Bacteria 1581
48 Ga0070715_10067538 3300006163 Bacteria 1588
49 Ga0070716_100077526 3300006173 Bacteria 1973
50 Ga0070716_100226807 3300006173 Bacteria 1259
51 Ga0070716_100235972 3300006173 Bacteria 1237
52 Ga0070712_100715688 3300006175 Bacteria 855
53 Ga0075369_10096938 3300006186 Bacteria 1320
54 Ga0075435_100126859 3300007076 Bacteria 2133
55 Ga0099794_10032769 3300007265 Bacteria 2440
56 Ga0099795_10062879 3300007788 Bacteria 1382
57 Ga0099795_10078976 3300007788 Bacteria 1255
58 Ga0105240_10958441 3300009093 Bacteria 917
59 Ga0111539_10196519 3300009094 Bacteria 2353
60 Ga0105242_10239360 3300009176 Bacteria 1631
61 Ga0105248_10111590 3300009177 Bacteria 3084
62 Ga0105249_10694483 3300009553 Bacteria 1077
63 Ga0099796_10122497 3300010159 Bacteria 1000
64 Ga0157369_10000540 3300013105 Bacteria 49981
65 Ga0157374_10169409 3300013296 Bacteria 2129
66 Ga0163162_10572873 3300013306 Bacteria 1256
67 Ga0157372_11275427 3300013307 Bacteria 848
68 Ga0163163_10007274 3300014325 Bacteria 9764
69 Ga0182008_10007140 3300014497 Bacteria 6184
70 Ga0182008_10104124 3300014497 Bacteria 1404
71 Ga0157379_10127183 3300014968 Bacteria 2293
72 Ga0157376_10253761 3300014969 Bacteria 1644
73 Ga0206350_11179897 3300020080 Bacteria 928
74 Ga0213876_10246820 3300021384 Bacteria 949
75 Ga0213875_10000595 3300021388 Bacteria 29244
76 Ga0213875_10002155 3300021388 Bacteria 12011
77 Ga0213875_10002341 3300021388 Bacteria 11451
78 Ga0213875_10002599 3300021388 Bacteria 10730
79 Ga0213875_10020146 3300021388 Bacteria 3200
80 Ga0224712_10024521 3300022467 Bacteria 2108
81 Ga0224712_10178416 3300022467 Bacteria 956
82 Ga0207692_10017313 3300025898 Bacteria 3212
83 Ga0207680_10080667 3300025903 Bacteria 2044
84 Ga0207685_10022633 3300025905 Bacteria 2127
85 Ga0207699_10022268 3300025906 Bacteria 3431
86 Ga0207684_10099924 3300025910 Bacteria 2479
87 Ga0207684_10247610 3300025910 Bacteria 1538
88 Ga0207707_10056398 3300025912 Bacteria 3418
89 Ga0207693_10003669 3300025915 Bacteria 13106
90 Ga0207693_10004880 3300025915 Bacteria 11271
91 Ga0207693_10084683 3300025915 Bacteria 2484
92 Ga0207693_10116702 3300025915 Bacteria 2096
93 Ga0207693_10374658 3300025915 Bacteria 1113
94 Ga0207663_10013587 3300025916 Bacteria 4429
95 Ga0207663_10016591 3300025916 Bacteria 4088
96 Ga0207663_10052593 3300025916 Bacteria 2541
97 Ga0207663_10212874 3300025916 Bacteria 1402
98 Ga0207652_10367807 3300025921 Bacteria 1298
99 Ga0207646_10003603 3300025922 Bacteria 17364
100 Ga0207650_10208423 3300025925 Bacteria 1569
101 Ga0207700_10015355 3300025928 Bacteria 5049
102 Ga0207700_10040903 3300025928 Bacteria 3387
103 Ga0207700_10184355 3300025928 Bacteria 1750
104 Ga0207700_10242266 3300025928 Bacteria 1537
105 Ga0207700_10435124 3300025928 Bacteria 1154
106 Ga0207700_10572082 3300025928 Bacteria 1004
107 Ga0207664_10032336 3300025929 Bacteria 4008
108 Ga0207664_10272408 3300025929 Bacteria 1483
109 Ga0207644_10089580 3300025931 Bacteria 2290
110 Ga0207644_10277824 3300025931 Bacteria 1344
111 Ga0207665_10051260 3300025939 Bacteria 2777
112 Ga0207665_10118666 3300025939 Bacteria 1866
113 Ga0207691_10333739 3300025940 Bacteria 1299
114 Ga0207711_10131916 3300025941 Bacteria 2241
115 Ga0207679_10124079 3300025945 Bacteria 2061
116 Ga0207667_11022409 3300025949 Bacteria 813
117 Ga0207702_10306730 3300026078 Bacteria 1508
118 Ga0207702_10992170 3300026078 Bacteria 833
119 Ga0207683_10106082 3300026121 Bacteria 2512
120 Ga0207683_10176266 3300026121 Bacteria 1938
121 Ga0207683_10217250 3300026121 Bacteria 1741
122 Ga0209179_1011057 3300027512 Bacteria 1589
123 Ga0265338_10058162 3300028800 Bacteria 3415
124 Ga0265338_10329228 3300028800 Bacteria 1104
125 Ga0265340_10041408 3300031247 Bacteria 2265
126 Ga0265313_10126845 3300031595 Bacteria 1109
127 Ga0307412_10469375 3300031911 Bacteria 1041
128 Ga0373929_0031234 3300035085 Bacteria 1140
129 Ga0373952_0106358 3300035092 Bacteria 746
130 Ga0373953_0014610 3300035117 Bacteria 2828
131 Ga0373954_0000094 3300035118 Bacteria 30419
132 Ga0373957_0065724 3300035120 Bacteria 1412
133 Ga0373943_0132923 3300035170 Bacteria 1333
134 Ga0373955_0061106 3300035172 Bacteria 2080
135 Ga0373955_0074919 3300035172 Bacteria 1901
136 Ga0373955_0112794 3300035172 Bacteria 1573
137 Ga0373942_0084409 3300035207 Bacteria 948
138 Ga0373924_0052562 3300035410 Bacteria 1691
139 Ga0373931_0039881 3300035691 Bacteria 2461
140 Ga0373931_0123891 3300035691 Bacteria 1480
141 Ga0373935_0017796 3300035692 Bacteria 4317
142 Ga0373935_0316121 3300035692 Bacteria 1107
143 Ga0373927_0123299 3300035695 Bacteria 1691
144 Ga0373927_0399042 3300035695 Bacteria 907
145 Ga0373933_0004184 3300035724 Bacteria 7950
146 Ga0373933_0006984 3300035724 Bacteria 6155
147 Ga0373933_0050912 3300035724 Bacteria 2474
148 Ga0373933_0082337 3300035724 Bacteria 1975
149 Ga0373947_0020564 3300035725 Bacteria 3812
150 Ga0373947_0135662 3300035725 Bacteria 1574
151 Ga0373947_0287316 3300035725 Bacteria 1094
152 Ga0373937_0000449 3300036401 Bacteria 37990
153 Ga0373937_0016007 3300036401 Bacteria 6650
154 Ga0373937_0066386 3300036401 Bacteria 3322
155 Ga0373937_0079208 3300036401 Bacteria 3037
156 Ga0373937_0099814 3300036401 Bacteria 2693
157 Ga0373937_0116159 3300036401 Bacteria 2492
158 Ga0373925_0055188 3300037068 Bacteria 2973
159 Ga0373925_0081144 3300037068 Bacteria 2466
160 Ga0373925_0093788 3300037068 Bacteria 2298
161 Ga0436364_0023769 3300037853 Bacteria 1531
162 Ga0436364_0186546 3300037853 Bacteria 2284
163 Ga0436364_0203141 3300037853 Bacteria 48947
164 Ga0436364_0266271 3300037853 Bacteria 210347
165 Ga0436364_0614112 3300037853 Bacteria 3375
166 Ga0436364_0978760 3300037853 Bacteria 21391
167 Ga0436364_1000700 3300037853 Bacteria 1622
168 Ga0436364_1011833 3300037853 Bacteria 2218
169 Ga0436364_1296593 3300037853 Bacteria 1336
170 Ga0436364_1528058 3300037853 Bacteria 40650
171 Ga0436365_0024953 3300039437 Bacteria 1899
172 Ga0436365_0514628 3300039437 Bacteria 797
173 Ga0436365_0942922 3300039437 Bacteria 2498
174 Ga0436365_0995823 3300039437 Bacteria 755
175 Ga0436365_1109971 3300039437 Bacteria 1484
176 Ga0436365_1575974 3300039437 Bacteria 1225
177 Ga0436365_1613143 3300039437 Bacteria 814
178 Ga0436365_1780682 3300039437 Bacteria 1152
179 Ga0436360_0105352 3300039438 Bacteria 1901
180 Ga0436360_0196887 3300039438 Bacteria 1006
181 Ga0436360_0332096 3300039438 Bacteria 6960
182 Ga0436360_0388551 3300039438 Bacteria 8977
183 Ga0436360_0669824 3300039438 Bacteria 5067
184 Ga0436361_0090558 3300039447 Bacteria 2991
185 Ga0436361_0678580 3300039447 Bacteria 1051
186 Ga0436361_1051694 3300039447 Bacteria 2129
187 Ga0436363_0109331 3300039450 Bacteria 971
188 Ga0436363_0511588 3300039450 Bacteria 1394
189 Ga0436363_0764123 3300039450 Bacteria 761
190 Ga0436362_0520315 3300039453 Bacteria 1123
191 Ga0436362_1240455 3300039453 Bacteria 2727
192 Ga0466969_0000291 3300044656 Bacteria 27353
193 Ga0466973_0029113 3300044659 Bacteria 5292
194 Ga0466965_0003027 3300044683 Bacteria 7307
195 Ga0466966_0068426 3300044684 Bacteria 2229
196 Ga0466961_0068364 3300044693 Bacteria 2255
197 Ga0466963_0003635 3300044694 Bacteria 8860
198 Ga0466971_0001698 3300044719 Bacteria 9330
199 Ga0466957_0000285 3300044842 Bacteria 24680
200 Ga0466960_0343863 3300044901 Bacteria 849
201 Ga0466959_0004690 3300045049 Bacteria 9203
202 Ga0466958_0018332 3300045836 Bacteria 4061
203 Ga0466958_0144495 3300045836 Bacteria 1499
204 Ga0466967_0224619 3300045976 Bacteria 1786
205 Ga0495592_0193997 3300046454 Bacteria 1375
206 Ga0495592_0283540 3300046454 Bacteria 1083
207 Ga0495651_0030990 3300046462 Bacteria 4171
208 Ga0495651_0062026 3300046462 Bacteria 2861
209 Ga0495664_0002135 3300046477 Bacteria 10562
210 Ga0495608_0019557 3300046511 Bacteria 4660
211 Ga0495608_0269331 3300046511 Bacteria 1059
212 Ga0495628_0226839 3300046516 Bacteria 1401
213 Ga0495652_0033773 3300046529 Bacteria 4463
214 Ga0495640_0082800 3300046533 Bacteria 2130
215 Ga0495640_0181490 3300046533 Bacteria 1341
216 Ga0495640_0189450 3300046533 Bacteria 1308
217 Ga0495586_0043130 3300046535 Bacteria 2430
218 Ga0495586_0085936 3300046535 Bacteria 1733
219 Ga0495587_0012294 3300046536 Bacteria 5396
220 Ga0495667_0006413 3300046559 Bacteria 7979
221 Ga0495667_0026413 3300046559 Bacteria 3913
222 Ga0495667_0293618 3300046559 Bacteria 1030
223 Ga0495635_0031104 3300046663 Bacteria 3708
224 Ga0495635_0220016 3300046663 Bacteria 1284
225 Ga0495657_0086835 3300046675 Bacteria 2014
226 Ga0495658_0110537 3300046683 Bacteria 1652
227 Ga0495613_0369935 3300046689 Bacteria 982
228 Ga0495600_0020715 3300046809 Bacteria 4206
229 Ga0495600_0114597 3300046809 Bacteria 1755
230 Ga0495604_0113611 3300047317 Bacteria 1971
231 Ga0495604_0263272 3300047317 Bacteria 1171
232 Ga0495674_0142991 3300047319 Bacteria 2010
233 Ga0495674_0158998 3300047319 Bacteria 1891
234 Ga0495680_0040140 3300047322 Bacteria 3730
235 Ga0495680_0092794 3300047322 Bacteria 2261
236 Ga0495675_0021752 3300047444 Bacteria 4086
237 Ga0495684_0125739 3300047471 Bacteria 1929
238 Ga0495684_0354760 3300047471 Bacteria 1040
239 Ga0495684_0558175 3300047471 Bacteria 779
240 Ga0495602_0020952 3300048088 Bacteria 6446
241 Ga0495602_0216721 3300048088 Bacteria 1448
242 Ga0495602_0256672 3300048088 Bacteria 1299
243 Ga0496112_0412768 3300048915 Bacteria 1289
244 Ga0496113_0012780 3300048916 Bacteria 5657
245 Ga0496119_0011593 3300048922 Bacteria 7273
246 Ga0501031_0120102 3300049568 Bacteria 1717
247 Ga0501036_0123355 3300049572 Bacteria 2188
248 Ga0501048_0129596 3300049582 Bacteria 1784
249 Ga0501072_0065417 3300049588 Bacteria 2867
250 Ga0501045_0247757 3300049824 Bacteria 1326
251 nmdc:mga08y16_205520_c1 3300050511 Bacteria 2040
252 nmdc:mga08x19_196654_c1 3300050514 Bacteria 1381
253 nmdc:mga0sz30_61762_c1 3300050516 Bacteria 1601
254 Ga0495601_0000429 3300053077 Bacteria 22002
255 Ga0495601_0048231 3300053077 Bacteria 2682
256 Ga0495612_0001667 3300053078 Bacteria 9151
257 Ga0495595_0009044 3300053084 Bacteria 4114
258 Ga0495595_0120480 3300053084 Bacteria 1278
259 Ga0495619_0019026 3300053085 Bacteria 4362
260 Ga0495619_0070505 3300053085 Bacteria 2337
261 Ga0495619_0096845 3300053085 Bacteria 2004
262 Ga0590077_014242 3300059426 Bacteria 1656
263 Ga0587073_0031851 3300059492 Bacteria 1094
264 Ga0587088_020235 3300059508 Bacteria 1102
265 Ga0466962_0012761 3300061719 Bacteria 4042
266 2842776184 2842775625 Bacteria 5587290
267 2894775410 2894772417 Bacteria 5305674
268 Ga0207693_10086602
269 JGI25406J46586_10025195
270 Ga0058863_11416718
271 Ga0070683_100563347
272 Ga0070683_100758205
273 Ga0068868_100367271
274 Ga0070687_100248885
275 Ga0070709_10048202
276 Ga0070709_10061416
277 Ga0070709_10062442
278 Ga0070709_10514046
279 Ga0070714_100043327
280 Ga0070714_100052864
281 Ga0070713_100002113
282 Ga0070713_100010600
283 Ga0070713_100109523
284 Ga0070713_100246314
285 Ga0070713_100286097
286 Ga0070710_10002515
287 Ga0070710_10052032
288 Ga0070711_100007874
289 Ga0070711_100020766
290 Ga0070708_100118149
291 Ga0070708_100280998
292 Ga0070678_100079075
293 Ga0070678_100339819
294 Ga0070681_10067315
295 Ga0070706_100189363
296 Ga0070706_100310675
297 Ga0070707_100009632
298 Ga0070707_100246710
299 Ga0070707_100265418
300 Ga0070698_100021924
301 Ga0070698_100048410
302 Ga0070698_100194298
303 Ga0070699_100217879
304 Ga0070679_100345018
305 Ga0070697_100399305
306 Ga0070697_100489560
307 Ga0070704_100018570
308 Ga0068855_100411292
309 Ga0068856_100199949
310 Ga0081539_10002623
311 Ga0070717_10042223
312 Ga0070717_10121530
313 Ga0070717_10163087
314 Ga0070717_10245116
315 Ga0070715_10067538
316 Ga0070716_100077526
317 Ga0070716_100226807
318 Ga0070716_100235972
319 Ga0070712_100715688
320 Ga0075369_10096938
321 Ga0075435_100126859
322 Ga0099794_10032769
323 Ga0099795_10062879
324 Ga0099795_10078976
325 Ga0105240_10958441
326 Ga0111539_10196519
327 Ga0105242_10239360
328 Ga0105248_10111590
329 Ga0105249_10694483
330 Ga0099796_10122497
331 Ga0157369_10000540
332 Ga0157374_10169409
333 Ga0163162_10572873
334 Ga0157372_11275427
335 Ga0163163_10007274
336 Ga0182008_10007140
337 Ga0182008_10104124
338 Ga0157379_10127183
339 Ga0157376_10253761
340 Ga0206350_11179897
341 Ga0213876_10246820
342 Ga0213875_10000595
343 Ga0213875_10002155
344 Ga0213875_10002341
345 Ga0213875_10002599
346 Ga0213875_10020146
347 Ga0224712_10024521
348 Ga0224712_10178416
349 Ga0207692_10017313
350 Ga0207680_10080667
351 Ga0207685_10022633
352 Ga0207699_10022268
353 Ga0207684_10099924
354 Ga0207684_10247610
355 Ga0207707_10056398
356 Ga0207693_10003669
357 Ga0207693_10004880
358 Ga0207693_10084683
359 Ga0207693_10116702
360 Ga0207693_10374658
361 Ga0207663_10013587
362 Ga0207663_10016591
363 Ga0207663_10052593
364 Ga0207663_10212874
365 Ga0207652_10367807
366 Ga0207646_10003603
367 Ga0207650_10208423
368 Ga0207700_10015355
369 Ga0207700_10040903
370 Ga0207700_10184355
371 Ga0207700_10242266
372 Ga0207700_10435124
373 Ga0207700_10572082
374 Ga0207664_10032336
375 Ga0207664_10272408
376 Ga0207644_10089580
377 Ga0207644_10277824
378 Ga0207665_10051260
379 Ga0207665_10118666
380 Ga0207691_10333739
381 Ga0207711_10131916
382 Ga0207679_10124079
383 Ga0207667_11022409
384 Ga0207702_10306730
385 Ga0207702_10992170
386 Ga0207683_10106082
387 Ga0207683_10176266
388 Ga0207683_10217250
389 Ga0209179_1011057
390 Ga0265338_10058162
391 Ga0265338_10329228
392 Ga0265340_10041408
393 Ga0265313_10126845
394 Ga0307412_10469375
395 Ga0373929_0031234
396 Ga0373952_0106358
397 Ga0373953_0014610
398 Ga0373954_0000094
399 Ga0373957_0065724
400 Ga0373943_0132923
401 Ga0373955_0061106
402 Ga0373955_0074919
403 Ga0373955_0112794
404 Ga0373942_0084409
405 Ga0373924_0052562
406 Ga0373931_0039881
407 Ga0373931_0123891
408 Ga0373935_0017796
409 Ga0373935_0316121
410 Ga0373927_0123299
411 Ga0373927_0399042
412 Ga0373933_0004184
413 Ga0373933_0006984
414 Ga0373933_0050912
415 Ga0373933_0082337
416 Ga0373947_0020564
417 Ga0373947_0135662
418 Ga0373947_0287316
419 Ga0373937_0000449
420 Ga0373937_0016007
421 Ga0373937_0066386
422 Ga0373937_0079208
423 Ga0373937_0099814
424 Ga0373937_0116159
425 Ga0373925_0055188
426 Ga0373925_0081144
427 Ga0373925_0093788
428 Ga0436364_0023769
429 Ga0436364_0186546
430 Ga0436364_0203141
431 Ga0436364_0266271
432 Ga0436364_0614112
433 Ga0436364_0978760
434 Ga0436364_1000700
435 Ga0436364_1011833
436 Ga0436364_1296593
437 Ga0436364_1528058
438 Ga0436365_0024953
439 Ga0436365_0514628
440 Ga0436365_0942922
441 Ga0436365_0995823
442 Ga0436365_1109971
443 Ga0436365_1575974
444 Ga0436365_1613143
445 Ga0436365_1780682
446 Ga0436360_0105352
447 Ga0436360_0196887
448 Ga0436360_0332096
449 Ga0436360_0388551
450 Ga0436360_0669824
451 Ga0436361_0090558
452 Ga0436361_0678580
453 Ga0436361_1051694
454 Ga0436363_0109331
455 Ga0436363_0511588
456 Ga0436363_0764123
457 Ga0436362_0520315
458 Ga0436362_1240455
459 Ga0466969_0000291
460 Ga0466973_0029113
461 Ga0466965_0003027
462 Ga0466966_0068426
463 Ga0466961_0068364
464 Ga0466963_0003635
465 Ga0466971_0001698
466 Ga0466957_0000285
467 Ga0466960_0343863
468 Ga0466959_0004690
469 Ga0466958_0018332
470 Ga0466958_0144495
471 Ga0466967_0224619
472 Ga0495592_0193997
473 Ga0495592_0283540
474 Ga0495651_0030990
475 Ga0495651_0062026
476 Ga0495664_0002135
477 Ga0495608_0019557
478 Ga0495608_0269331
479 Ga0495628_0226839
480 Ga0495652_0033773
481 Ga0495640_0082800
482 Ga0495640_0181490
483 Ga0495640_0189450
484 Ga0495586_0043130
485 Ga0495586_0085936
486 Ga0495587_0012294
487 Ga0495667_0006413
488 Ga0495667_0026413
489 Ga0495667_0293618
490 Ga0495635_0031104
491 Ga0495635_0220016
492 Ga0495657_0086835
493 Ga0495658_0110537
494 Ga0495613_0369935
495 Ga0495600_0020715
496 Ga0495600_0114597
497 Ga0495604_0113611
498 Ga0495604_0263272
499 Ga0495674_0142991
500 Ga0495674_0158998
501 Ga0495680_0040140
502 Ga0495680_0092794
503 Ga0495675_0021752
504 Ga0495684_0125739
505 Ga0495684_0354760
506 Ga0495684_0558175
507 Ga0495602_0020952
508 Ga0495602_0216721
509 Ga0495602_0256672
510 Ga0496112_0412768
511 Ga0496113_0012780
512 Ga0496119_0011593
513 Ga0501031_0120102
514 Ga0501036_0123355
515 Ga0501048_0129596
516 Ga0501072_0065417
517 Ga0501045_0247757
518 nmdc:mga08y16_205520_c1
519 nmdc:mga08x19_196654_c1
520 nmdc:mga0sz30_61762_c1
521 Ga0495601_0000429
522 Ga0495601_0048231
523 Ga0495612_0001667
524 Ga0495595_0009044
525 Ga0495595_0120480
526 Ga0495619_0019026
527 Ga0495619_0070505
528 Ga0495619_0096845
529 Ga0590077_014242
530 Ga0587073_0031851
531 Ga0587088_020235
532 Ga0466962_0012761
533 2842776184
534 2894775410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

125

197

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

80

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

9

81

0.95

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

127

192

0.92

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

169

248

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

6

86

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

115

201

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

185

250

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9218 3 167
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9144 1 165
4mf7-assembly1.cif.gz_A-2 crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290 0.9063 2 164
4ivf-assembly4.cif.gz_H crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit 0.8981 2 167
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.8957 1 166
ID Description Score Start End Superfamily
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9715 2 83 3.40.30.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.971 3 85 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9681 1 83 3.40.30.10
4mf6A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9633 2 84 3.40.30.10
af_Q5AFB4_1_94_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9522 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A523FIZ1-F1-model_v4 Glutathione S-transferase family protein 0.9928 1 71 GO:0016740
AF-A0A537VTC3-F1-model_v4 GST N-terminal domain-containing protein 0.9894 2 68
AF-A0A4V2B1N5-F1-model_v4 Glutathione S-transferase family protein 0.9835 1 86 GO:0016740
AF-A0A382M8K8-F1-model_v4 GST N-terminal domain-containing protein 0.9791 1 85
AF-A0A6L8ANP3-F1-model_v4 deleted 0.979 1 80

Map