F374778

General Info

Members Datasets Scaffolds Average Seq Length
267 155 534 179

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10506534|Ga0157379_105065342
Length 193
Sequence MRDVGGSLSGKRTDRDDEADTDVFRKAMQDVKPIKQRPRAPAAKRKPPARARFTAADRALVLVESLQGFAEGDIGDLGDEISFRRDGVQDRVMRKLKRGEYRVEDVCDLHGLRVDEAKEALRGFLADALARRLQCVRIIHGKGKGSGPKGPVIKTAVNMILRKTGPVLAFTSARRIDGGTGAINVLLGAAPVS

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
106 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
107 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
110 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
111 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 3.75
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10506534 3300014968 Bacteria 1119
2 rootL2_10043182 3300003322 Bacteria 3849
3 rootL2_10124002 3300003322 Bacteria 2466
4 rootH1_10141922 3300003323 Bacteria 4727
5 rootH1_10173439 3300003323 Bacteria 1001
6 Ga0065707_10083655 3300005295 Bacteria 8530
7 Ga0070676_10028207 3300005328 Bacteria 3188
8 Ga0070690_100294325 3300005330 Bacteria 1162
9 Ga0070670_100249701 3300005331 Bacteria 1545
10 Ga0070677_10004374 3300005333 Bacteria 4607
11 Ga0068869_100040903 3300005334 Bacteria 3316
12 Ga0068869_100063907 3300005334 Bacteria 2706
13 Ga0068869_100377020 3300005334 Bacteria 1162
14 Ga0070682_100031880 3300005337 Bacteria 3191
15 Ga0070682_100039277 3300005337 Bacteria 2908
16 Ga0070682_100875889 3300005337 Unclassified 736
17 Ga0070689_100030472 3300005340 Bacteria 4095
18 Ga0070689_100071085 3300005340 Bacteria 2718
19 Ga0070687_100411091 3300005343 Bacteria 890
20 Ga0070661_100331956 3300005344 Bacteria 1189
21 Ga0070675_100007236 3300005354 Bacteria 8558
22 Ga0070675_100008342 3300005354 Bacteria 8040
23 Ga0070675_100047252 3300005354 Bacteria 3527
24 Ga0070675_100155774 3300005354 Bacteria 1961
25 Ga0070674_100025937 3300005356 Bacteria 3822
26 Ga0070674_100263311 3300005356 Unclassified 1359
27 Ga0070673_100048361 3300005364 Bacteria 3315
28 Ga0070673_100064411 3300005364 Bacteria 2920
29 Ga0070688_100076929 3300005365 Bacteria 2149
30 Ga0070688_100906409 3300005365 Unclassified 696
31 Ga0070667_100529757 3300005367 Bacteria 1081
32 Ga0070701_10167208 3300005438 Bacteria 1278
33 Ga0070705_100092783 3300005440 Bacteria 1886
34 Ga0070700_100058414 3300005441 Bacteria 2423
35 Ga0070700_100072865 3300005441 Bacteria 2197
36 Ga0070700_100531682 3300005441 Bacteria 910
37 Ga0070694_100047356 3300005444 Bacteria 2889
38 Ga0070663_100188799 3300005455 Bacteria 1603
39 Ga0070678_100039897 3300005456 Bacteria 3317
40 Ga0070678_101405586 3300005456 Bacteria 652
41 Ga0070662_101201612 3300005457 Unclassified 652
42 Ga0068867_100061477 3300005459 Bacteria 2788
43 Ga0068867_100703649 3300005459 Bacteria 892
44 Ga0070685_10278573 3300005466 Bacteria 1119
45 Ga0070672_100001531 3300005543 Bacteria 14316
46 Ga0070672_100027182 3300005543 Bacteria 4266
47 Ga0070672_100029581 3300005543 Bacteria 4109
48 Ga0070672_101187427 3300005543 Unclassified 680
49 Ga0070686_100145413 3300005544 Bacteria 1655
50 Ga0070665_100006355 3300005548 Bacteria 12055
51 Ga0070665_100997475 3300005548 Bacteria 850
52 Ga0070665_101479370 3300005548 Unclassified 688
53 Ga0070664_100036052 3300005564 Bacteria 4154
54 Ga0070702_100629107 3300005615 Unclassified 809
55 Ga0068859_100222995 3300005617 Bacteria 1973
56 Ga0068859_100468289 3300005617 Bacteria 1356
57 Ga0068864_100044569 3300005618 Bacteria 3803
58 Ga0068866_10141231 3300005718 Bacteria 1382
59 Ga0068861_100010697 3300005719 Bacteria 6375
60 Ga0068861_100027679 3300005719 Bacteria 4132
61 Ga0068861_100075777 3300005719 Bacteria 2619
62 Ga0068861_100653161 3300005719 Bacteria 972
63 Ga0068870_10015507 3300005840 Bacteria 3617
64 Ga0068870_10026078 3300005840 Bacteria 2910
65 Ga0068870_10086083 3300005840 Bacteria 1748
66 Ga0068863_100044855 3300005841 Bacteria 4196
67 Ga0068863_100328128 3300005841 Bacteria 1487
68 Ga0068858_100328066 3300005842 Bacteria 1463
69 Ga0068858_100911037 3300005842 Bacteria 860
70 Ga0068860_100120077 3300005843 Bacteria 2517
71 Ga0068862_100057319 3300005844 Bacteria 3340
72 Ga0068862_100189916 3300005844 Bacteria 1848
73 Ga0081455_10013269 3300005937 Bacteria 8159
74 Ga0070715_10135710 3300006163 Bacteria 1189
75 Ga0097621_100093977 3300006237 Bacteria 2513
76 Ga0097621_100155636 3300006237 Bacteria 1962
77 Ga0097621_100281231 3300006237 Bacteria 1465
78 Ga0068871_100141518 3300006358 Unclassified 2046
79 Ga0068871_100280537 3300006358 Bacteria 1457
80 Ga0068871_100356145 3300006358 Bacteria 1295
81 Ga0068871_100716642 3300006358 Bacteria 917
82 Ga0075428_100005173 3300006844 Bacteria 14483
83 Ga0075428_100544132 3300006844 Bacteria 1241
84 Ga0075428_101369391 3300006844 Bacteria 743
85 Ga0075430_100014341 3300006846 Bacteria 6755
86 Ga0075431_100006554 3300006847 Bacteria 11567
87 Ga0075429_100002923 3300006880 Bacteria 14492
88 Ga0068865_100040839 3300006881 Bacteria 3154
89 Ga0068865_100333627 3300006881 Bacteria 1223
90 Ga0097620_100222981 3300006931 Bacteria 1973
91 Ga0097620_100468300 3300006931 Bacteria 1356
92 Ga0111539_10036178 3300009094 Bacteria 5972
93 Ga0111539_10175405 3300009094 Bacteria 2504
94 Ga0105248_10345279 3300009177 Bacteria 1676
95 Ga0163162_10164586 3300013306 Bacteria 2341
96 Ga0163162_11288160 3300013306 Bacteria 830
97 Ga0157375_10008479 3300013308 Bacteria 9004
98 Ga0157375_10692621 3300013308 Bacteria 1173
99 Ga0163163_10614844 3300014325 Bacteria 1150
100 Ga0163163_11921367 3300014325 Bacteria 652
101 Ga0157380_10000575 3300014326 Bacteria 22595
102 Ga0157380_10004418 3300014326 Bacteria 9744
103 Ga0157380_10027505 3300014326 Bacteria 4325
104 Ga0157380_10107966 3300014326 Unclassified 2332
105 Ga0157376_10152785 3300014969 Bacteria 2084
106 Ga0157376_10606122 3300014969 Bacteria 1090
107 Ga0157376_10689825 3300014969 Bacteria 1025
108 Ga0163161_10470027 3300017792 Bacteria 1019
109 Ga0207682_10006605 3300025893 Bacteria 4665
110 Ga0207682_10007100 3300025893 Bacteria 4485
111 Ga0207688_10255856 3300025901 Bacteria 1062
112 Ga0207688_10562218 3300025901 Bacteria 717
113 Ga0207645_10393315 3300025907 Bacteria 932
114 Ga0207643_10007564 3300025908 Bacteria 5832
115 Ga0207643_10220813 3300025908 Bacteria 1160
116 Ga0207649_10154460 3300025920 Bacteria 1584
117 Ga0207681_10786640 3300025923 Bacteria 794
118 Ga0207659_10029399 3300025926 Bacteria 3745
119 Ga0207659_10031598 3300025926 Bacteria 3626
120 Ga0207659_10094904 3300025926 Bacteria 2236
121 Ga0207659_10240974 3300025926 Bacteria 1463
122 Ga0207644_10226897 3300025931 Bacteria 1483
123 Ga0207706_10158259 3300025933 Bacteria 1992
124 Ga0207670_10027950 3300025936 Bacteria 3574
125 Ga0207670_10110295 3300025936 Bacteria 1982
126 Ga0207669_10410989 3300025937 Bacteria 1062
127 Ga0207704_10045984 3300025938 Bacteria 2597
128 Ga0207691_10004515 3300025940 Bacteria 13461
129 Ga0207691_10020312 3300025940 Bacteria 6279
130 Ga0207691_10053785 3300025940 Bacteria 3674
131 Ga0207691_10062483 3300025940 Bacteria 3379
132 Ga0207691_10566501 3300025940 Unclassified 963
133 Ga0207689_10055118 3300025942 Bacteria 3273
134 Ga0207689_10088908 3300025942 Bacteria 2537
135 Ga0207651_10192115 3300025960 Bacteria 1629
136 Ga0207712_10473208 3300025961 Unclassified 1066
137 Ga0207668_10207459 3300025972 Bacteria 1565
138 Ga0207668_10653636 3300025972 Bacteria 920
139 Ga0207658_10842652 3300025986 Bacteria 833
140 Ga0207658_11276521 3300025986 Bacteria 671
141 Ga0207678_10199270 3300026067 Bacteria 1711
142 Ga0207708_10015585 3300026075 Bacteria 5700
143 Ga0207708_10043140 3300026075 Bacteria 3437
144 Ga0207708_10064272 3300026075 Bacteria 2803
145 Ga0207708_10378847 3300026075 Bacteria 1166
146 Ga0207708_11236441 3300026075 Bacteria 653
147 Ga0207641_10034571 3300026088 Bacteria 4206
148 Ga0207641_10092089 3300026088 Bacteria 2654
149 Ga0207641_11037042 3300026088 Bacteria 818
150 Ga0207648_10053437 3300026089 Bacteria 3531
151 Ga0207648_10320090 3300026089 Bacteria 1394
152 Ga0207648_10378193 3300026089 Bacteria 1280
153 Ga0207648_10646763 3300026089 Bacteria 977
154 Ga0207674_10209214 3300026116 Bacteria 1900
155 Ga0207675_100003037 3300026118 Bacteria 16455
156 Ga0207675_100009822 3300026118 Bacteria 8959
157 Ga0207675_100081610 3300026118 Bacteria 3032
158 Ga0207675_100121864 3300026118 Bacteria 2468
159 Ga0207675_100385769 3300026118 Bacteria 1378
160 Ga0207683_10071357 3300026121 Bacteria 3070
161 Ga0207683_10110253 3300026121 Bacteria 2464
162 Ga0207683_10217584 3300026121 Bacteria 1740
163 Ga0207428_10005193 3300027907 Bacteria 12178
164 Ga0268266_10107922 3300028379 Bacteria 2462
165 Ga0268266_10292141 3300028379 Bacteria 1518
166 Ga0268265_10076765 3300028380 Bacteria 2622
167 Ga0268265_10128595 3300028380 Bacteria 2101
168 Ga0268264_10081895 3300028381 Bacteria 2760
169 Ga0268264_10656021 3300028381 Bacteria 1039
170 Ga0307513_10025969 3300031456 Bacteria 6765
171 Ga0307513_10040153 3300031456 Bacteria 5176
172 Ga0307513_10043850 3300031456 Bacteria 4907
173 Ga0307513_10048960 3300031456 Bacteria 4581
174 Ga0307513_10807075 3300031456 Bacteria 644
175 Ga0307509_10130001 3300031507 Bacteria 2476
176 Ga0316576_10125284 3300031727 Bacteria 1930
177 Ga0307405_10250169 3300031731 Bacteria 1318
178 Ga0307413_10000236 3300031824 Bacteria 16461
179 Ga0307413_10217597 3300031824 Bacteria 1392
180 Ga0307410_10004632 3300031852 Bacteria 7140
181 Ga0307410_10059375 3300031852 Bacteria 2611
182 Ga0307407_10015002 3300031903 Bacteria 3812
183 Ga0307409_100008951 3300031995 Bacteria 6115
184 Ga0307409_100357673 3300031995 Bacteria 1380
185 Ga0307409_100440988 3300031995 Bacteria 1254
186 Ga0307416_100029600 3300032002 Bacteria 4094
187 Ga0307416_100181080 3300032002 Bacteria 1975
188 Ga0307416_101972300 3300032002 Bacteria 687
189 Ga0307411_10002545 3300032005 Bacteria 8126
190 Ga0307415_100038982 3300032126 Bacteria 3136
191 Ga0307415_100162152 3300032126 Bacteria 1734
192 Ga0373936_0168451 3300035113 Bacteria 957
193 Ga0373936_0224666 3300035113 Bacteria 834
194 Ga0373955_0247597 3300035172 Bacteria 1068
195 Ga0373924_0135257 3300035410 Bacteria 1074
196 Ga0373937_0383803 3300036401 Bacteria 1332
197 Ga0316584_0092605 3300036712 Bacteria 2263
198 Ga0451787_095973 3300041441 Bacteria 674
199 Ga0451789_0521675 3300041443 Bacteria 1390
200 Ga0451791_0278632 3300041451 Bacteria 1946
201 Ga0451791_0871780 3300041451 Bacteria 1701
202 Ga0451793_0028779 3300041452 Bacteria 747
203 Ga0451797_0175191 3300041453 Bacteria 1281
204 Ga0451802_0474533 3300041460 Bacteria 3862
205 Ga0451804_1092896 3300041463 Bacteria 1741
206 Ga0451807_1993342 3300041486 Bacteria 1182
207 Ga0451837_0439949 3300041494 Bacteria 1133
208 Ga0495590_0039930 3300046457 Bacteria 1637
209 Ga0495590_0058464 3300046457 Bacteria 1348
210 Ga0495638_0003354 3300046460 Bacteria 12631
211 Ga0495638_0007371 3300046460 Bacteria 7895
212 Ga0495638_0039436 3300046460 Bacteria 2998
213 Ga0495616_0036629 3300046513 Bacteria 2530
214 Ga0495620_0133845 3300046515 Unclassified 972
215 Ga0495632_0059241 3300046519 Bacteria 1864
216 Ga0495632_0153792 3300046519 Bacteria 1062
217 Ga0495632_0411144 3300046519 Bacteria 590
218 Ga0495648_0410255 3300046524 Bacteria 603
219 Ga0495621_0031290 3300046539 Bacteria 1825
220 Ga0495668_0012003 3300046616 Bacteria 5157
221 Ga0495668_0326084 3300046616 Bacteria 842
222 Ga0495625_0004159 3300046660 Bacteria 13794
223 Ga0495625_0007883 3300046660 Bacteria 9173
224 Ga0495625_0079184 3300046660 Bacteria 2292
225 Ga0495649_0008566 3300046694 Bacteria 6143
226 Ga0495649_0181795 3300046694 Bacteria 1097
227 Ga0495686_0124605 3300047472 Bacteria 1533
228 Ga0496114_0309920 3300048917 Bacteria 1394
229 Ga0496118_0074720 3300048921 Unclassified 2421
230 Ga0496121_0079988 3300048924 Bacteria 2593
231 Ga0495678_036926 3300049459 Bacteria 1990
232 Ga0501031_0321350 3300049568 Bacteria 1003
233 Ga0501038_0234702 3300049574 Bacteria 1458
234 Ga0501038_0495600 3300049574 Bacteria 935
235 Ga0501042_0480234 3300049578 Bacteria 902
236 Ga0501067_0033936 3300049583 Bacteria 2832
237 Ga0501068_0000376 3300049584 Bacteria 22423
238 Ga0501068_0272000 3300049584 Bacteria 1082
239 Ga0501069_0035118 3300049585 Bacteria 2761
240 Ga0501069_0102069 3300049585 Bacteria 1629
241 Ga0501070_0019537 3300049586 Bacteria 5682
242 Ga0501071_0012945 3300049587 Bacteria 5674
243 Ga0501072_1114859 3300049588 Bacteria 614
244 Ga0501073_0001698 3300049589 Bacteria 16319
245 Ga0501073_0164053 3300049589 Bacteria 1539
246 Ga0501074_0003150 3300049590 Bacteria 11635
247 Ga0501075_0019219 3300049591 Bacteria 4955
248 Ga0501076_0007467 3300049592 Bacteria 7960
249 Ga0501076_0183846 3300049592 Bacteria 1705
250 Ga0501077_0007920 3300049593 Bacteria 6565
251 Ga0501077_0332667 3300049593 Bacteria 969
252 Ga0501079_0000274 3300049741 Bacteria 31680
253 Ga0501080_0001597 3300049742 Bacteria 19232
254 Ga0501081_0497213 3300049743 Bacteria 909
255 Ga0501083_0006786 3300049744 Bacteria 8125
256 nmdc:mga05p37_1495653_c1 3300050507 Bacteria 673
257 nmdc:mga05p37_15811_c1 3300050507 Bacteria 9075
258 nmdc:mga09592_11728_c1 3300050508 Bacteria 7128
259 nmdc:mga0qj67_57690_c1 3300050509 Bacteria 3078
260 nmdc:mga06r32_23_c1 3300050510 Bacteria 93533
261 nmdc:mga08y16_30116_c1 3300050511 Bacteria 5713
262 nmdc:mga08y16_3809_c1 3300050511 Bacteria 15686
263 nmdc:mga08y16_424130_c1 3300050511 Bacteria 1359
264 Ga0500637_0174475 3300053178 Bacteria 1234
265 Ga0501084_0003685 3300054114 Bacteria 12441
266 Ga0501082_0027051 3300060353 Bacteria 4942
267 Ga0530510_0953975 3300061734 Bacteria 656
268 Ga0157379_10506534
269 rootL2_10043182
270 rootL2_10124002
271 rootH1_10141922
272 rootH1_10173439
273 Ga0065707_10083655
274 Ga0070676_10028207
275 Ga0070690_100294325
276 Ga0070670_100249701
277 Ga0070677_10004374
278 Ga0068869_100040903
279 Ga0068869_100063907
280 Ga0068869_100377020
281 Ga0070682_100031880
282 Ga0070682_100039277
283 Ga0070682_100875889
284 Ga0070689_100030472
285 Ga0070689_100071085
286 Ga0070687_100411091
287 Ga0070661_100331956
288 Ga0070675_100007236
289 Ga0070675_100008342
290 Ga0070675_100047252
291 Ga0070675_100155774
292 Ga0070674_100025937
293 Ga0070674_100263311
294 Ga0070673_100048361
295 Ga0070673_100064411
296 Ga0070688_100076929
297 Ga0070688_100906409
298 Ga0070667_100529757
299 Ga0070701_10167208
300 Ga0070705_100092783
301 Ga0070700_100058414
302 Ga0070700_100072865
303 Ga0070700_100531682
304 Ga0070694_100047356
305 Ga0070663_100188799
306 Ga0070678_100039897
307 Ga0070678_101405586
308 Ga0070662_101201612
309 Ga0068867_100061477
310 Ga0068867_100703649
311 Ga0070685_10278573
312 Ga0070672_100001531
313 Ga0070672_100027182
314 Ga0070672_100029581
315 Ga0070672_101187427
316 Ga0070686_100145413
317 Ga0070665_100006355
318 Ga0070665_100997475
319 Ga0070665_101479370
320 Ga0070664_100036052
321 Ga0070702_100629107
322 Ga0068859_100222995
323 Ga0068859_100468289
324 Ga0068864_100044569
325 Ga0068866_10141231
326 Ga0068861_100010697
327 Ga0068861_100027679
328 Ga0068861_100075777
329 Ga0068861_100653161
330 Ga0068870_10015507
331 Ga0068870_10026078
332 Ga0068870_10086083
333 Ga0068863_100044855
334 Ga0068863_100328128
335 Ga0068858_100328066
336 Ga0068858_100911037
337 Ga0068860_100120077
338 Ga0068862_100057319
339 Ga0068862_100189916
340 Ga0081455_10013269
341 Ga0070715_10135710
342 Ga0097621_100093977
343 Ga0097621_100155636
344 Ga0097621_100281231
345 Ga0068871_100141518
346 Ga0068871_100280537
347 Ga0068871_100356145
348 Ga0068871_100716642
349 Ga0075428_100005173
350 Ga0075428_100544132
351 Ga0075428_101369391
352 Ga0075430_100014341
353 Ga0075431_100006554
354 Ga0075429_100002923
355 Ga0068865_100040839
356 Ga0068865_100333627
357 Ga0097620_100222981
358 Ga0097620_100468300
359 Ga0111539_10036178
360 Ga0111539_10175405
361 Ga0105248_10345279
362 Ga0163162_10164586
363 Ga0163162_11288160
364 Ga0157375_10008479
365 Ga0157375_10692621
366 Ga0163163_10614844
367 Ga0163163_11921367
368 Ga0157380_10000575
369 Ga0157380_10004418
370 Ga0157380_10027505
371 Ga0157380_10107966
372 Ga0157376_10152785
373 Ga0157376_10606122
374 Ga0157376_10689825
375 Ga0163161_10470027
376 Ga0207682_10006605
377 Ga0207682_10007100
378 Ga0207688_10255856
379 Ga0207688_10562218
380 Ga0207645_10393315
381 Ga0207643_10007564
382 Ga0207643_10220813
383 Ga0207649_10154460
384 Ga0207681_10786640
385 Ga0207659_10029399
386 Ga0207659_10031598
387 Ga0207659_10094904
388 Ga0207659_10240974
389 Ga0207644_10226897
390 Ga0207706_10158259
391 Ga0207670_10027950
392 Ga0207670_10110295
393 Ga0207669_10410989
394 Ga0207704_10045984
395 Ga0207691_10004515
396 Ga0207691_10020312
397 Ga0207691_10053785
398 Ga0207691_10062483
399 Ga0207691_10566501
400 Ga0207689_10055118
401 Ga0207689_10088908
402 Ga0207651_10192115
403 Ga0207712_10473208
404 Ga0207668_10207459
405 Ga0207668_10653636
406 Ga0207658_10842652
407 Ga0207658_11276521
408 Ga0207678_10199270
409 Ga0207708_10015585
410 Ga0207708_10043140
411 Ga0207708_10064272
412 Ga0207708_10378847
413 Ga0207708_11236441
414 Ga0207641_10034571
415 Ga0207641_10092089
416 Ga0207641_11037042
417 Ga0207648_10053437
418 Ga0207648_10320090
419 Ga0207648_10378193
420 Ga0207648_10646763
421 Ga0207674_10209214
422 Ga0207675_100003037
423 Ga0207675_100009822
424 Ga0207675_100081610
425 Ga0207675_100121864
426 Ga0207675_100385769
427 Ga0207683_10071357
428 Ga0207683_10110253
429 Ga0207683_10217584
430 Ga0207428_10005193
431 Ga0268266_10107922
432 Ga0268266_10292141
433 Ga0268265_10076765
434 Ga0268265_10128595
435 Ga0268264_10081895
436 Ga0268264_10656021
437 Ga0307513_10025969
438 Ga0307513_10040153
439 Ga0307513_10043850
440 Ga0307513_10048960
441 Ga0307513_10807075
442 Ga0307509_10130001
443 Ga0316576_10125284
444 Ga0307405_10250169
445 Ga0307413_10000236
446 Ga0307413_10217597
447 Ga0307410_10004632
448 Ga0307410_10059375
449 Ga0307407_10015002
450 Ga0307409_100008951
451 Ga0307409_100357673
452 Ga0307409_100440988
453 Ga0307416_100029600
454 Ga0307416_100181080
455 Ga0307416_101972300
456 Ga0307411_10002545
457 Ga0307415_100038982
458 Ga0307415_100162152
459 Ga0373936_0168451
460 Ga0373936_0224666
461 Ga0373955_0247597
462 Ga0373924_0135257
463 Ga0373937_0383803
464 Ga0316584_0092605
465 Ga0451787_095973
466 Ga0451789_0521675
467 Ga0451791_0278632
468 Ga0451791_0871780
469 Ga0451793_0028779
470 Ga0451797_0175191
471 Ga0451802_0474533
472 Ga0451804_1092896
473 Ga0451807_1993342
474 Ga0451837_0439949
475 Ga0495590_0039930
476 Ga0495590_0058464
477 Ga0495638_0003354
478 Ga0495638_0007371
479 Ga0495638_0039436
480 Ga0495616_0036629
481 Ga0495620_0133845
482 Ga0495632_0059241
483 Ga0495632_0153792
484 Ga0495632_0411144
485 Ga0495648_0410255
486 Ga0495621_0031290
487 Ga0495668_0012003
488 Ga0495668_0326084
489 Ga0495625_0004159
490 Ga0495625_0007883
491 Ga0495625_0079184
492 Ga0495649_0008566
493 Ga0495649_0181795
494 Ga0495686_0124605
495 Ga0496114_0309920
496 Ga0496118_0074720
497 Ga0496121_0079988
498 Ga0495678_036926
499 Ga0501031_0321350
500 Ga0501038_0234702
501 Ga0501038_0495600
502 Ga0501042_0480234
503 Ga0501067_0033936
504 Ga0501068_0000376
505 Ga0501068_0272000
506 Ga0501069_0035118
507 Ga0501069_0102069
508 Ga0501070_0019537
509 Ga0501071_0012945
510 Ga0501072_1114859
511 Ga0501073_0001698
512 Ga0501073_0164053
513 Ga0501074_0003150
514 Ga0501075_0019219
515 Ga0501076_0007467
516 Ga0501076_0183846
517 Ga0501077_0007920
518 Ga0501077_0332667
519 Ga0501079_0000274
520 Ga0501080_0001597
521 Ga0501081_0497213
522 Ga0501083_0006786
523 nmdc:mga05p37_1495653_c1
524 nmdc:mga05p37_15811_c1
525 nmdc:mga09592_11728_c1
526 nmdc:mga0qj67_57690_c1
527 nmdc:mga06r32_23_c1
528 nmdc:mga08y16_30116_c1
529 nmdc:mga08y16_3809_c1
530 nmdc:mga08y16_424130_c1
531 Ga0500637_0174475
532 Ga0501084_0003685
533 Ga0501082_0027051
534 Ga0530510_0953975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01713

Smr

Smr domain

107

188

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zqe-assembly1.cif.gz_A crystal structure of the smr domain of thermus thermophilus muts2 0.9144 81 163
4od6-assembly1.cif.gz_A structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked 0.8826 78 164
2zqe-assembly1.cif.gz_A crystal structure of the smr domain of thermus thermophilus muts2 0.8709 81 163
4od6-assembly1.cif.gz_A structure of smr domain of muts2 from deinococcus radiodurans, mn2+ soaked 0.8627 78 164
3qd7-assembly1.cif.gz_X crystal structure of ydal, a stand-alone small muts-related protein from escherichia coli 0.8333 56 164
ID Description Score Start End Superfamily
2zqeA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9144 81 163 3.30.1370.110
af_P0A8B2_49_176_3.30.1370.110 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9016 56 164 3.30.1370.110
2zqeA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8709 81 163 3.30.1370.110
af_Q59Z54_97_175_3.30.1370.110 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8457 82 164 3.30.1370.110
3qd7X00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.8333 56 164 3.30.1370.110
ID Description Score Start End GO Terms
AF-A0A832J3M2-F1-model_v4 DNA mismatch repair protein MutS 0.9444 58 166
AF-W0DWE0-F1-model_v4 DNA mismatch repair protein MutS 0.9275 57 166
AF-A0A2N6CHA6-F1-model_v4 DNA mismatch repair protein MutS 0.9265 58 163
AF-A0A4Q6CVB0-F1-model_v4 deleted 0.9255 56 168
AF-A0A1Y5DUJ4-F1-model_v4 DNA mismatch repair protein MutS 0.9245 56 168 GO:0004520

Map