F374712

General Info

Members Datasets Scaffolds Average Seq Length
267 145 534 125

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11885480|Ga0105240_118854801
Length 122
Sequence MRLFALRGANSVEANEASAILEGTSLLIRELMDRNALTTDAMVSCIFTLTDDLDAEFPALAARRLGLDRVPLLCAREIPVPGSMPRIVRLMLHYYAEDEEHEAKHVYLGDARRLRSDLEAAQ

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
62 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
63 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
64 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
65 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
84 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 0
Rhizoplane 12.36
Rhizosphere 76.4
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_11885480 3300009093 Unclassified 622
2 Ga0070691_10097595 3300005341 Bacteria 1456
3 Ga0070692_10198324 3300005345 Bacteria 1174
4 Ga0070671_100885924 3300005355 Bacteria 779
5 Ga0070667_100569300 3300005367 Bacteria 1042
6 Ga0070694_100125838 3300005444 Bacteria 1845
7 Ga0070694_101512908 3300005444 Bacteria 568
8 Ga0070708_102200124 3300005445 Bacteria 509
9 Ga0070707_101098972 3300005468 Bacteria 761
10 Ga0070697_100180874 3300005536 Unclassified 1787
11 Ga0070686_101089250 3300005544 Bacteria 659
12 Ga0070696_100039557 3300005546 Bacteria 3256
13 Ga0070704_100808679 3300005549 Bacteria 838
14 Ga0070704_101020632 3300005549 Unclassified 749
15 Ga0068854_101232608 3300005578 Bacteria 671
16 Ga0068866_10108658 3300005718 Bacteria 1543
17 Ga0081455_10245661 3300005937 Bacteria 1312
18 Ga0081455_10389953 3300005937 Bacteria 970
19 Ga0081455_10462909 3300005937 Bacteria 863
20 Ga0081538_10102577 3300005981 Bacteria 1434
21 Ga0081539_10086493 3300005985 Bacteria 1631
22 Ga0070717_10009050 3300006028 Bacteria 7474
23 Ga0070717_10010554 3300006028 Bacteria 6978
24 Ga0075365_10141815 3300006038 Bacteria 1668
25 Ga0075365_10176627 3300006038 Bacteria 1492
26 Ga0075365_10287043 3300006038 Bacteria 1158
27 Ga0075365_10351620 3300006038 Bacteria 1039
28 Ga0075365_10958566 3300006038 Bacteria 603
29 Ga0075363_100409723 3300006048 Bacteria 797
30 Ga0075364_10370868 3300006051 Unclassified 976
31 Ga0075367_10109559 3300006178 Bacteria 1694
32 Ga0075428_100373488 3300006844 Unclassified 1529
33 Ga0075428_101545193 3300006844 Unclassified 695
34 Ga0075428_101998945 3300006844 Bacteria 601
35 Ga0075430_100238704 3300006846 Bacteria 1506
36 Ga0075430_100486448 3300006846 Unclassified 1018
37 Ga0075431_100004220 3300006847 Bacteria 14076
38 Ga0075431_100192355 3300006847 Unclassified 2090
39 Ga0075434_100038290 3300006871 Bacteria 4749
40 Ga0075429_100004493 3300006880 Bacteria 11999
41 Ga0075429_100478407 3300006880 Unclassified 1091
42 Ga0075436_100446577 3300006914 Unclassified 941
43 Ga0075435_100031134 3300007076 Bacteria 4200
44 Ga0075435_100499704 3300007076 Unclassified 1051
45 Ga0075435_101444237 3300007076 Bacteria 603
46 Ga0111539_10063027 3300009094 Bacteria 4387
47 Ga0111539_10720370 3300009094 Bacteria 1161
48 Ga0105245_10326807 3300009098 Bacteria 1512
49 Ga0114129_10023002 3300009147 Bacteria 8842
50 Ga0114129_10036577 3300009147 Bacteria 6932
51 Ga0114129_10136263 3300009147 Bacteria 3368
52 Ga0114129_10145345 3300009147 Bacteria 3249
53 Ga0114129_10391977 3300009147 Bacteria 1832
54 Ga0105243_11726000 3300009148 Bacteria 655
55 Ga0105242_11633682 3300009176 Bacteria 679
56 Ga0105249_10094157 3300009553 Bacteria 2807
57 Ga0105249_11341710 3300009553 Bacteria 787
58 Ga0105033_105884 3300009986 Bacteria 1058
59 Ga0099796_10522731 3300010159 Unclassified 532
60 Ga0105239_10314267 3300010375 Bacteria 1766
61 Ga0105239_11737402 3300010375 Unclassified 722
62 Ga0105246_10980265 3300011119 Unclassified 764
63 Ga0157369_12012554 3300013105 Bacteria 586
64 Ga0157378_10437917 3300013297 Bacteria 1295
65 Ga0157379_10013884 3300014968 Bacteria 7060
66 Ga0213874_10143783 3300021377 Bacteria 827
67 Ga0213875_10000431 3300021388 Bacteria 36614
68 Ga0213875_10247501 3300021388 Unclassified 840
69 Ga0213875_10260614 3300021388 Bacteria 818
70 Ga0207646_11018184 3300025922 Bacteria 731
71 Ga0207687_10071668 3300025927 Bacteria 2476
72 Ga0207700_10147654 3300025928 Bacteria 1940
73 Ga0207700_10173145 3300025928 Bacteria 1802
74 Ga0207664_10108766 3300025929 Bacteria 2302
75 Ga0207706_10184856 3300025933 Bacteria 1830
76 Ga0207712_10069286 3300025961 Bacteria 2530
77 Ga0207712_10811450 3300025961 Bacteria 823
78 Ga0207708_11700151 3300026075 Bacteria 554
79 Ga0207702_10016706 3300026078 Bacteria 6074
80 Ga0207428_10037276 3300027907 Bacteria 3957
81 Ga0395899_0010673 3300037312 Bacteria 7039
82 Ga0395899_0373098 3300037312 Bacteria 950
83 Ga0395899_0374575 3300037312 Bacteria 947
84 Ga0395899_0421973 3300037312 Unclassified 879
85 Ga0395900_0007784 3300037418 Bacteria 11054
86 Ga0395900_0302224 3300037418 Bacteria 1586
87 Ga0395900_0312285 3300037418 Bacteria 1555
88 Ga0395900_0453730 3300037418 Bacteria 1238
89 Ga0395900_0468820 3300037418 Bacteria 1213
90 Ga0395898_0001796 3300037466 Bacteria 27829
91 Ga0395898_0002543 3300037466 Bacteria 21393
92 Ga0395898_0165102 3300037466 Bacteria 2118
93 Ga0395898_0185627 3300037466 Bacteria 1987
94 Ga0395898_0219420 3300037466 Bacteria 1814
95 Ga0395898_0304318 3300037466 Bacteria 1521
96 Ga0395898_0312628 3300037466 Bacteria 1499
97 Ga0395905_0011268 3300037471 Bacteria 8645
98 Ga0395905_0664194 3300037471 Bacteria 944
99 Ga0436364_0047066 3300037853 Bacteria 5845
100 Ga0436364_0172890 3300037853 Unclassified 2850
101 Ga0436364_0724727 3300037853 Bacteria 922
102 Ga0436364_0737248 3300037853 Bacteria 154680
103 Ga0395901_0009909 3300038443 Bacteria 9660
104 Ga0395901_0160498 3300038443 Bacteria 2361
105 Ga0395901_0199719 3300038443 Bacteria 2096
106 Ga0395901_0308914 3300038443 Bacteria 1638
107 Ga0395901_0586755 3300038443 Bacteria 1125
108 Ga0395901_1783885 3300038443 Bacteria 565
109 Ga0395901_1944303 3300038443 Bacteria 535
110 Ga0436365_1390441 3300039437 Unclassified 735
111 Ga0451789_0807592 3300041443 Unclassified 701
112 Ga0451797_0955955 3300041453 Bacteria 528
113 Ga0451841_0627283 3300041498 Bacteria 1174
114 Ga0451849_1321885 3300041505 Unclassified 801
115 Ga0451851_0320239 3300041507 Bacteria 560
116 Ga0466969_0002951 3300044656 Bacteria 9081
117 Ga0466969_0206727 3300044656 Bacteria 895
118 Ga0466969_0286064 3300044656 Bacteria 746
119 Ga0466969_0312393 3300044656 Bacteria 711
120 Ga0466972_0190620 3300044658 Unclassified 961
121 Ga0466965_0831100 3300044683 Bacteria 536
122 Ga0466965_0903044 3300044683 Bacteria 515
123 Ga0466966_0023569 3300044684 Bacteria 4028
124 Ga0466966_0696277 3300044684 Bacteria 612
125 Ga0466961_0008427 3300044693 Bacteria 6563
126 Ga0466961_0341997 3300044693 Bacteria 911
127 Ga0466963_0040759 3300044694 Bacteria 3044
128 Ga0466963_0313178 3300044694 Bacteria 1104
129 Ga0466963_0674804 3300044694 Bacteria 729
130 Ga0466964_0121832 3300044706 Bacteria 1177
131 Ga0466964_0133759 3300044706 Bacteria 1132
132 Ga0466971_0018300 3300044719 Bacteria 3103
133 Ga0466968_0098449 3300044735 Bacteria 1303
134 Ga0466970_0105071 3300044765 Bacteria 1540
135 Ga0466970_0123655 3300044765 Bacteria 1418
136 Ga0466970_0465398 3300044765 Bacteria 726
137 Ga0466957_0836488 3300044842 Bacteria 655
138 Ga0466960_0300869 3300044901 Bacteria 904
139 Ga0466959_0020578 3300045049 Bacteria 4862
140 Ga0466959_0252043 3300045049 Bacteria 1217
141 Ga0466959_0550026 3300045049 Bacteria 778
142 Ga0466959_0774045 3300045049 Bacteria 642
143 Ga0466958_0007950 3300045836 Bacteria 5861
144 Ga0466958_0011294 3300045836 Bacteria 5028
145 Ga0466958_0029611 3300045836 Bacteria 3249
146 Ga0466958_0037434 3300045836 Bacteria 2907
147 Ga0466958_0153425 3300045836 Bacteria 1453
148 Ga0466958_0354082 3300045836 Unclassified 945
149 Ga0466967_0318576 3300045976 Bacteria 1499
150 Ga0466967_1549636 3300045976 Bacteria 660
151 Ga0495664_0128848 3300046477 Bacteria 1532
152 Ga0495664_0220182 3300046477 Bacteria 1149
153 Ga0495628_0706610 3300046516 Bacteria 712
154 Ga0495637_0286669 3300046520 Bacteria 587
155 Ga0495644_0060539 3300046523 Bacteria 1423
156 Ga0495652_0209465 3300046529 Bacteria 1473
157 Ga0495640_0614679 3300046533 Bacteria 656
158 Ga0495609_0186192 3300046538 Bacteria 872
159 Ga0495670_0513339 3300046691 Unclassified 651
160 Ga0495604_0189567 3300047317 Bacteria 1434
161 Ga0495674_0605328 3300047319 Bacteria 868
162 Ga0495677_0162739 3300047445 Unclassified 862
163 Ga0496100_0142840 3300048903 Bacteria 1699
164 Ga0496100_0148450 3300048903 Bacteria 1669
165 Ga0496100_1359608 3300048903 Unclassified 561
166 Ga0496101_1241090 3300048904 Bacteria 583
167 Ga0496102_0325472 3300048905 Bacteria 1448
168 Ga0496102_0594259 3300048905 Bacteria 1030
169 Ga0496102_1035309 3300048905 Bacteria 741
170 Ga0496102_1434508 3300048905 Bacteria 609
171 Ga0496103_0512343 3300048906 Bacteria 767
172 Ga0496104_0943152 3300048907 Bacteria 767
173 Ga0496104_1607983 3300048907 Bacteria 552
174 Ga0496105_0536064 3300048908 Bacteria 915
175 Ga0496106_0070352 3300048909 Bacteria 2672
176 Ga0496106_0287354 3300048909 Bacteria 1318
177 Ga0496106_0573921 3300048909 Bacteria 904
178 Ga0496107_0046867 3300048910 Bacteria 3111
179 Ga0496107_0091574 3300048910 Bacteria 2222
180 Ga0496107_0322236 3300048910 Bacteria 1150
181 Ga0496108_0671999 3300048911 Unclassified 899
182 Ga0496109_0114527 3300048912 Bacteria 2508
183 Ga0496109_0124374 3300048912 Bacteria 2404
184 Ga0496109_0132202 3300048912 Bacteria 2330
185 Ga0496110_0110945 3300048913 Bacteria 2465
186 Ga0496110_1005037 3300048913 Bacteria 741
187 Ga0496111_0186213 3300048914 Bacteria 1543
188 Ga0496112_0851718 3300048915 Bacteria 835
189 Ga0496112_1850159 3300048915 Unclassified 515
190 Ga0496113_0058299 3300048916 Bacteria 2905
191 Ga0496113_0239069 3300048916 Bacteria 1449
192 Ga0496113_0640287 3300048916 Bacteria 850
193 Ga0496113_0909810 3300048916 Bacteria 696
194 Ga0496117_0412780 3300048920 Bacteria 678
195 Ga0501031_0041825 3300049568 Bacteria 2992
196 Ga0501031_0534856 3300049568 Unclassified 755
197 Ga0501031_0869444 3300049568 Bacteria 577
198 Ga0501036_0034867 3300049572 Bacteria 4257
199 Ga0501038_0171325 3300049574 Bacteria 1757
200 Ga0501039_0190360 3300049575 Bacteria 1613
201 Ga0501041_0034296 3300049577 Bacteria 3072
202 Ga0501041_0833492 3300049577 Unclassified 592
203 Ga0501042_0109395 3300049578 Bacteria 1990
204 Ga0501046_0176654 3300049580 Bacteria 1599
205 Ga0501048_0024067 3300049582 Bacteria 4447
206 Ga0501068_0575640 3300049584 Bacteria 733
207 Ga0501069_0110662 3300049585 Bacteria 1564
208 Ga0501070_0322654 3300049586 Bacteria 1256
209 Ga0501071_0035724 3300049587 Bacteria 3541
210 Ga0501072_0032899 3300049588 Bacteria 4061
211 Ga0501072_0272042 3300049588 Bacteria 1348
212 Ga0501072_0615379 3300049588 Unclassified 856
213 Ga0501072_1399635 3300049588 Bacteria 541
214 Ga0501075_0072303 3300049591 Bacteria 2607
215 Ga0501075_0082574 3300049591 Bacteria 2434
216 Ga0501075_0839631 3300049591 Bacteria 699
217 Ga0501075_1151070 3300049591 Bacteria 589
218 Ga0501076_0004141 3300049592 Bacteria 10260
219 Ga0501076_0383125 3300049592 Bacteria 1156
220 Ga0501076_0551139 3300049592 Bacteria 951
221 Ga0501077_0036162 3300049593 Bacteria 3145
222 Ga0501079_0187270 3300049741 Bacteria 1616
223 Ga0501079_0284126 3300049741 Unclassified 1294
224 Ga0501079_0313769 3300049741 Bacteria 1227
225 Ga0501079_0772981 3300049741 Bacteria 756
226 Ga0501079_0987387 3300049741 Bacteria 663
227 Ga0501080_0984717 3300049742 Bacteria 732
228 Ga0501081_0061194 3300049743 Bacteria 2610
229 Ga0501081_0235023 3300049743 Bacteria 1336
230 Ga0501035_0843327 3300049822 Bacteria 729
231 Ga0501045_0511621 3300049824 Bacteria 891
232 nmdc:mga03n38_260387_c1 3300050490 Bacteria 919
233 nmdc:mga00v17_371006_c1 3300050491 Bacteria 930
234 nmdc:mga00v17_494593_c1 3300050491 Unclassified 793
235 nmdc:mga00v17_67733_c1 3300050491 Bacteria 2206
236 nmdc:mga0yw44_335495_c1 3300050492 Bacteria 1016
237 nmdc:mga0yw44_412045_c1 3300050492 Bacteria 914
238 nmdc:mga0yw44_581725_c1 3300050492 Bacteria 760
239 nmdc:mga0yw44_94465_c1 3300050492 Bacteria 1895
240 nmdc:mga06z11_101724_c1 3300050494 Bacteria 1577
241 nmdc:mga05p37_108573_c1 3300050507 Bacteria 2374
242 nmdc:mga05p37_304215_c1 3300050507 Bacteria 1893
243 nmdc:mga05p37_412830_c1 3300050507 Bacteria 1573
244 nmdc:mga05p37_650272_c1 3300050507 Bacteria 1181
245 nmdc:mga09592_1594793_c1 3300050508 Bacteria 529
246 nmdc:mga09592_457255_c1 3300050508 Unclassified 1101
247 nmdc:mga0qj67_15605_c1 3300050509 Bacteria 5752
248 nmdc:mga06r32_627085_c1 3300050510 Bacteria 1045
249 nmdc:mga08y16_10720_c1 3300050511 Bacteria 9618
250 nmdc:mga08y16_1950558_c1 3300050511 Bacteria 537
251 nmdc:mga08y16_2045281_c1 3300050511 Bacteria 521
252 nmdc:mga0n895_844973_c1 3300050512 Bacteria 904
253 nmdc:mga0rr50_128444_c1 3300050513 Unclassified 1069
254 nmdc:mga0rr50_52077_c1 3300050513 Bacteria 3040
255 nmdc:mga0a205_15159_c2 3300050515 Bacteria 5310
256 nmdc:mga0a205_167629_c1 3300050515 Bacteria 2092
257 Ga0495601_0176220 3300053077 Bacteria 1398
258 Ga0495612_0614947 3300053078 Bacteria 503
259 Ga0501084_0071368 3300054114 Bacteria 2908
260 Ga0501082_0144594 3300060353 Bacteria 2064
261 Ga0501082_0364797 3300060353 Bacteria 1260
262 Ga0466962_0035890 3300061719 Bacteria 2372
263 Ga0530510_0015325 3300061734 Bacteria 5415
264 Ga0530510_0023926 3300061734 Bacteria 4356
265 Ga0530510_0161815 3300061734 Bacteria 1656
266 Ga0530510_0190672 3300061734 Bacteria 1522
267 Ga0530510_0724200 3300061734 Bacteria 758
268 Ga0105240_11885480
269 Ga0070691_10097595
270 Ga0070692_10198324
271 Ga0070671_100885924
272 Ga0070667_100569300
273 Ga0070694_100125838
274 Ga0070694_101512908
275 Ga0070708_102200124
276 Ga0070707_101098972
277 Ga0070697_100180874
278 Ga0070686_101089250
279 Ga0070696_100039557
280 Ga0070704_100808679
281 Ga0070704_101020632
282 Ga0068854_101232608
283 Ga0068866_10108658
284 Ga0081455_10245661
285 Ga0081455_10389953
286 Ga0081455_10462909
287 Ga0081538_10102577
288 Ga0081539_10086493
289 Ga0070717_10009050
290 Ga0070717_10010554
291 Ga0075365_10141815
292 Ga0075365_10176627
293 Ga0075365_10287043
294 Ga0075365_10351620
295 Ga0075365_10958566
296 Ga0075363_100409723
297 Ga0075364_10370868
298 Ga0075367_10109559
299 Ga0075428_100373488
300 Ga0075428_101545193
301 Ga0075428_101998945
302 Ga0075430_100238704
303 Ga0075430_100486448
304 Ga0075431_100004220
305 Ga0075431_100192355
306 Ga0075434_100038290
307 Ga0075429_100004493
308 Ga0075429_100478407
309 Ga0075436_100446577
310 Ga0075435_100031134
311 Ga0075435_100499704
312 Ga0075435_101444237
313 Ga0111539_10063027
314 Ga0111539_10720370
315 Ga0105245_10326807
316 Ga0114129_10023002
317 Ga0114129_10036577
318 Ga0114129_10136263
319 Ga0114129_10145345
320 Ga0114129_10391977
321 Ga0105243_11726000
322 Ga0105242_11633682
323 Ga0105249_10094157
324 Ga0105249_11341710
325 Ga0105033_105884
326 Ga0099796_10522731
327 Ga0105239_10314267
328 Ga0105239_11737402
329 Ga0105246_10980265
330 Ga0157369_12012554
331 Ga0157378_10437917
332 Ga0157379_10013884
333 Ga0213874_10143783
334 Ga0213875_10000431
335 Ga0213875_10247501
336 Ga0213875_10260614
337 Ga0207646_11018184
338 Ga0207687_10071668
339 Ga0207700_10147654
340 Ga0207700_10173145
341 Ga0207664_10108766
342 Ga0207706_10184856
343 Ga0207712_10069286
344 Ga0207712_10811450
345 Ga0207708_11700151
346 Ga0207702_10016706
347 Ga0207428_10037276
348 Ga0395899_0010673
349 Ga0395899_0373098
350 Ga0395899_0374575
351 Ga0395899_0421973
352 Ga0395900_0007784
353 Ga0395900_0302224
354 Ga0395900_0312285
355 Ga0395900_0453730
356 Ga0395900_0468820
357 Ga0395898_0001796
358 Ga0395898_0002543
359 Ga0395898_0165102
360 Ga0395898_0185627
361 Ga0395898_0219420
362 Ga0395898_0304318
363 Ga0395898_0312628
364 Ga0395905_0011268
365 Ga0395905_0664194
366 Ga0436364_0047066
367 Ga0436364_0172890
368 Ga0436364_0724727
369 Ga0436364_0737248
370 Ga0395901_0009909
371 Ga0395901_0160498
372 Ga0395901_0199719
373 Ga0395901_0308914
374 Ga0395901_0586755
375 Ga0395901_1783885
376 Ga0395901_1944303
377 Ga0436365_1390441
378 Ga0451789_0807592
379 Ga0451797_0955955
380 Ga0451841_0627283
381 Ga0451849_1321885
382 Ga0451851_0320239
383 Ga0466969_0002951
384 Ga0466969_0206727
385 Ga0466969_0286064
386 Ga0466969_0312393
387 Ga0466972_0190620
388 Ga0466965_0831100
389 Ga0466965_0903044
390 Ga0466966_0023569
391 Ga0466966_0696277
392 Ga0466961_0008427
393 Ga0466961_0341997
394 Ga0466963_0040759
395 Ga0466963_0313178
396 Ga0466963_0674804
397 Ga0466964_0121832
398 Ga0466964_0133759
399 Ga0466971_0018300
400 Ga0466968_0098449
401 Ga0466970_0105071
402 Ga0466970_0123655
403 Ga0466970_0465398
404 Ga0466957_0836488
405 Ga0466960_0300869
406 Ga0466959_0020578
407 Ga0466959_0252043
408 Ga0466959_0550026
409 Ga0466959_0774045
410 Ga0466958_0007950
411 Ga0466958_0011294
412 Ga0466958_0029611
413 Ga0466958_0037434
414 Ga0466958_0153425
415 Ga0466958_0354082
416 Ga0466967_0318576
417 Ga0466967_1549636
418 Ga0495664_0128848
419 Ga0495664_0220182
420 Ga0495628_0706610
421 Ga0495637_0286669
422 Ga0495644_0060539
423 Ga0495652_0209465
424 Ga0495640_0614679
425 Ga0495609_0186192
426 Ga0495670_0513339
427 Ga0495604_0189567
428 Ga0495674_0605328
429 Ga0495677_0162739
430 Ga0496100_0142840
431 Ga0496100_0148450
432 Ga0496100_1359608
433 Ga0496101_1241090
434 Ga0496102_0325472
435 Ga0496102_0594259
436 Ga0496102_1035309
437 Ga0496102_1434508
438 Ga0496103_0512343
439 Ga0496104_0943152
440 Ga0496104_1607983
441 Ga0496105_0536064
442 Ga0496106_0070352
443 Ga0496106_0287354
444 Ga0496106_0573921
445 Ga0496107_0046867
446 Ga0496107_0091574
447 Ga0496107_0322236
448 Ga0496108_0671999
449 Ga0496109_0114527
450 Ga0496109_0124374
451 Ga0496109_0132202
452 Ga0496110_0110945
453 Ga0496110_1005037
454 Ga0496111_0186213
455 Ga0496112_0851718
456 Ga0496112_1850159
457 Ga0496113_0058299
458 Ga0496113_0239069
459 Ga0496113_0640287
460 Ga0496113_0909810
461 Ga0496117_0412780
462 Ga0501031_0041825
463 Ga0501031_0534856
464 Ga0501031_0869444
465 Ga0501036_0034867
466 Ga0501038_0171325
467 Ga0501039_0190360
468 Ga0501041_0034296
469 Ga0501041_0833492
470 Ga0501042_0109395
471 Ga0501046_0176654
472 Ga0501048_0024067
473 Ga0501068_0575640
474 Ga0501069_0110662
475 Ga0501070_0322654
476 Ga0501071_0035724
477 Ga0501072_0032899
478 Ga0501072_0272042
479 Ga0501072_0615379
480 Ga0501072_1399635
481 Ga0501075_0072303
482 Ga0501075_0082574
483 Ga0501075_0839631
484 Ga0501075_1151070
485 Ga0501076_0004141
486 Ga0501076_0383125
487 Ga0501076_0551139
488 Ga0501077_0036162
489 Ga0501079_0187270
490 Ga0501079_0284126
491 Ga0501079_0313769
492 Ga0501079_0772981
493 Ga0501079_0987387
494 Ga0501080_0984717
495 Ga0501081_0061194
496 Ga0501081_0235023
497 Ga0501035_0843327
498 Ga0501045_0511621
499 nmdc:mga03n38_260387_c1
500 nmdc:mga00v17_371006_c1
501 nmdc:mga00v17_494593_c1
502 nmdc:mga00v17_67733_c1
503 nmdc:mga0yw44_335495_c1
504 nmdc:mga0yw44_412045_c1
505 nmdc:mga0yw44_581725_c1
506 nmdc:mga0yw44_94465_c1
507 nmdc:mga06z11_101724_c1
508 nmdc:mga05p37_108573_c1
509 nmdc:mga05p37_304215_c1
510 nmdc:mga05p37_412830_c1
511 nmdc:mga05p37_650272_c1
512 nmdc:mga09592_1594793_c1
513 nmdc:mga09592_457255_c1
514 nmdc:mga0qj67_15605_c1
515 nmdc:mga06r32_627085_c1
516 nmdc:mga08y16_10720_c1
517 nmdc:mga08y16_1950558_c1
518 nmdc:mga08y16_2045281_c1
519 nmdc:mga0n895_844973_c1
520 nmdc:mga0rr50_128444_c1
521 nmdc:mga0rr50_52077_c1
522 nmdc:mga0a205_15159_c2
523 nmdc:mga0a205_167629_c1
524 Ga0495601_0176220
525 Ga0495612_0614947
526 Ga0501084_0071368
527 Ga0501082_0144594
528 Ga0501082_0364797
529 Ga0466962_0035890
530 Ga0530510_0015325
531 Ga0530510_0023926
532 Ga0530510_0161815
533 Ga0530510_0190672
534 Ga0530510_0724200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07736

CM_1

Chorismate mutase type I

3

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zk7-assembly1.cif.gz_F crystal structure of rescued two-component self-assembling tetrahedral cage t33-31 0.9472 8 122
1com-assembly3.cif.gz_D the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction 0.9456 8 118
1fnj-assembly1.cif.gz_A crystal structure analysis of chorismate mutase mutant c88s/r90k 0.9426 8 120
1fnk-assembly1.cif.gz_A crystal structure analysis of chorismate mutase mutant c88k/r90s 0.9418 8 120
3zop-assembly1.cif.gz_A arg90cit chorismate mutase of bacillus subtilis at 1.6 a resolution 0.9384 8 120
ID Description Score Start End Superfamily
2chsI00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9468 8 118 3.30.1330.40
1ufyA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9366 8 123 3.30.1330.40
2chsI00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9148 8 118 3.30.1330.40
1xhoC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9036 10 118 3.30.1330.40
1ufyA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8922 8 123 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A6J4RHN8-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9825 8 127 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-A0A7V6X404-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9764 8 122 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-R7HT43-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9756 8 120 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-R5KA59-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9746 8 120 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-A0A3N5M496-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9744 12 122 GO:0004106
GO:0008652
GO:0009073
GO:0046417

Map