F374643

General Info

Members Datasets Scaffolds Average Seq Length
267 161 266 207

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100000021|Ga0068854_10000002155
Length 243
Sequence MNTLQIKSEPKSFVKRTLHKKYGGGVLHRQTIYNRTRPMTSQRETLLNLIATHSFKLGDFTLASGQKSDYYIDCRTTTLHAEGGRLSGLVFYELIRERFPQAEAVGGLTMGADPLVSNTASASAWYALQQGQDPANPATKLLQGFLVRKSEKTHGTGRRIEGFLKPGAAVVIVDDVCTTGGSTITAIEAARESGMNVIGILCLVDREQGGRANIEAAAKGAPFISVFTASDVRAAHLALKDIR

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
161 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 7.12
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000458 3300000546 Bacteria 7166
2 rootL2_10108404 3300003322 Bacteria 2817
3 Ga0070658_10000007 3300005327 Bacteria 349444
4 Ga0070658_10036319 3300005327 Bacteria 3972
5 Ga0070658_10072349 3300005327 Bacteria 2825
6 Ga0070658_10079589 3300005327 Bacteria 2691
7 Ga0070658_10132797 3300005327 Bacteria 2075
8 Ga0070658_10157909 3300005327 Bacteria 1901
9 Ga0070658_10178834 3300005327 Bacteria 1785
10 Ga0070683_100652593 3300005329 Unclassified 1007
11 Ga0070680_100026305 3300005336 Bacteria 4653
12 Ga0070682_100396077 3300005337 Bacteria 1043
13 Ga0070660_100055675 3300005339 Bacteria 3057
14 Ga0070660_100128162 3300005339 Bacteria 2029
15 Ga0070661_100052544 3300005344 Bacteria 2983
16 Ga0070671_100080369 3300005355 Bacteria 2726
17 Ga0070671_100117989 3300005355 Bacteria 2232
18 Ga0070659_100065273 3300005366 Bacteria 2883
19 Ga0070714_101562904 3300005435 Bacteria 644
20 Ga0070710_10630671 3300005437 Bacteria 749
21 Ga0070663_100079177 3300005455 Bacteria 2410
22 Ga0070663_100165104 3300005455 Bacteria 1707
23 Ga0070681_10045065 3300005458 Bacteria 4414
24 Ga0070681_10882990 3300005458 Unclassified 812
25 Ga0070679_100055245 3300005530 Bacteria 3954
26 Ga0068853_100000027 3300005539 Bacteria 127120
27 Ga0070665_100018986 3300005548 Bacteria 6896
28 Ga0070665_100030811 3300005548 Bacteria 5398
29 Ga0070665_100037855 3300005548 Bacteria 4849
30 Ga0070665_100118195 3300005548 Bacteria 2653
31 Ga0070665_100173366 3300005548 Bacteria 2158
32 Ga0068855_100043770 3300005563 Bacteria 5301
33 Ga0068855_100052360 3300005563 Bacteria 4806
34 Ga0068855_100112310 3300005563 Bacteria 3127
35 Ga0070664_100610000 3300005564 Bacteria 1012
36 Ga0068857_100109552 3300005577 Bacteria 2481
37 Ga0068854_100000021 3300005578 Bacteria 130648
38 Ga0068854_100065160 3300005578 Bacteria 2648
39 Ga0068856_100049616 3300005614 Bacteria 4137
40 Ga0068856_100306233 3300005614 Bacteria 1607
41 Ga0068858_100044316 3300005842 Bacteria 4124
42 Ga0081540_1031181 3300005983 Bacteria 2936
43 Ga0070717_10287480 3300006028 Unclassified 1459
44 Ga0105240_10079154 3300009093 Bacteria 4045
45 Ga0105240_10174634 3300009093 Bacteria 2541
46 Ga0105240_10232922 3300009093 Bacteria 2139
47 Ga0105240_10373966 3300009093 Bacteria 1610
48 Ga0105240_10783252 3300009093 Bacteria 1034
49 Ga0105240_11140558 3300009093 Unclassified 828
50 Ga0105245_10558392 3300009098 Bacteria 1167
51 Ga0105248_10000024 3300009177 Bacteria 263817
52 Ga0105248_10006467 3300009177 Bacteria 12854
53 Ga0105248_10103260 3300009177 Bacteria 3213
54 Ga0105248_10119787 3300009177 Bacteria 2969
55 Ga0105248_10811412 3300009177 Bacteria 1056
56 Ga0105248_11158878 3300009177 Bacteria 874
57 Ga0105237_10017262 3300009545 Bacteria 7484
58 Ga0105237_10144415 3300009545 Bacteria 2374
59 Ga0105238_10095943 3300009551 Bacteria 2952
60 Ga0105238_10437761 3300009551 Bacteria 1303
61 Ga0157370_10181848 3300013104 Bacteria 1954
62 Ga0157369_10026085 3300013105 Bacteria 6483
63 Ga0157369_10026444 3300013105 Bacteria 6435
64 Ga0157369_10033542 3300013105 Bacteria 5641
65 Ga0157369_10332765 3300013105 Bacteria 1578
66 Ga0157369_10476880 3300013105 Bacteria 1291
67 Ga0157374_10181179 3300013296 Bacteria 2058
68 Ga0157374_10310703 3300013296 Bacteria 1561
69 Ga0157374_10557855 3300013296 Bacteria 1153
70 Ga0157378_10084096 3300013297 Bacteria 2881
71 Ga0157378_10369755 3300013297 Unclassified 1405
72 Ga0163162_10002032 3300013306 Bacteria 19036
73 Ga0163162_10174241 3300013306 Bacteria 2276
74 Ga0157372_10131190 3300013307 Bacteria 2883
75 Ga0157375_10973489 3300013308 Bacteria 989
76 Ga0163163_10013587 3300014325 Bacteria 7457
77 Ga0163163_10208876 3300014325 Bacteria 2001
78 Ga0157379_10037485 3300014968 Bacteria 4323
79 Ga0157379_10159104 3300014968 Unclassified 2038
80 Ga0157379_10175079 3300014968 Bacteria 1937
81 Ga0157376_10002633 3300014969 Bacteria 12203
82 Ga0157376_10005999 3300014969 Bacteria 8537
83 Ga0157376_10136350 3300014969 Bacteria 2196
84 Ga0213872_10123079 3300021361 Bacteria 1146
85 Ga0213871_10007466 3300021441 Bacteria 2366
86 Ga0213871_10019602 3300021441 Bacteria 1667
87 Ga0209233_1001575 3300025261 Bacteria 8923
88 Ga0207680_10170150 3300025903 Bacteria 1467
89 Ga0207647_10018112 3300025904 Bacteria 4773
90 Ga0207705_10000013 3300025909 Bacteria 451680
91 Ga0207705_10002388 3300025909 Bacteria 14511
92 Ga0207705_10044307 3300025909 Bacteria 3197
93 Ga0207705_10075419 3300025909 Bacteria 2449
94 Ga0207705_10081348 3300025909 Bacteria 2361
95 Ga0207705_10122848 3300025909 Bacteria 1928
96 Ga0207705_10430833 3300025909 Bacteria 1022
97 Ga0207707_10018246 3300025912 Bacteria 6116
98 Ga0207707_10748524 3300025912 Unclassified 817
99 Ga0207695_10034523 3300025913 Bacteria 5499
100 Ga0207695_10064447 3300025913 Bacteria 3773
101 Ga0207695_10070182 3300025913 Bacteria 3583
102 Ga0207695_10292563 3300025913 Bacteria 1521
103 Ga0207671_10362674 3300025914 Bacteria 1150
104 Ga0207657_10001554 3300025919 Bacteria 24621
105 Ga0207657_10005268 3300025919 Bacteria 13548
106 Ga0207657_10207395 3300025919 Bacteria 1574
107 Ga0207657_10529590 3300025919 Bacteria 922
108 Ga0207652_10022218 3300025921 Bacteria 5244
109 Ga0207694_10011596 3300025924 Bacteria 6651
110 Ga0207644_10126607 3300025931 Bacteria 1950
111 Ga0207644_10314382 3300025931 Bacteria 1265
112 Ga0207690_10008299 3300025932 Bacteria 6160
113 Ga0207711_10000007 3300025941 Bacteria 759410
114 Ga0207711_10000018 3300025941 Bacteria 431036
115 Ga0207711_10043785 3300025941 Bacteria 3820
116 Ga0207711_10111045 3300025941 Bacteria 2439
117 Ga0207661_10040290 3300025944 Bacteria 3671
118 Ga0207679_10179567 3300025945 Bacteria 1750
119 Ga0207667_10007958 3300025949 Bacteria 12648
120 Ga0207667_10018770 3300025949 Bacteria 7744
121 Ga0207667_10034192 3300025949 Bacteria 5460
122 Ga0207667_10286106 3300025949 Bacteria 1684
123 Ga0207640_10000007 3300025981 Bacteria 303287
124 Ga0207640_10013549 3300025981 Bacteria 4679
125 Ga0207703_10032234 3300026035 Bacteria 4147
126 Ga0207639_10000036 3300026041 Bacteria 148421
127 Ga0207639_10028132 3300026041 Bacteria 4101
128 Ga0207678_10001807 3300026067 Bacteria 19591
129 Ga0207678_10023375 3300026067 Bacteria 5405
130 Ga0207678_10269350 3300026067 Bacteria 1460
131 Ga0207702_10224250 3300026078 Bacteria 1753
132 Ga0207641_10254253 3300026088 Bacteria 1642
133 Ga0207674_10001390 3300026116 Bacteria 31168
134 Ga0268266_10002041 3300028379 Bacteria 22418
135 Ga0268266_10054103 3300028379 Bacteria 3449
136 Ga0268266_10065318 3300028379 Bacteria 3146
137 Ga0265338_10007591 3300028800 Bacteria 13398
138 Ga0265338_10460983 3300028800 Bacteria 899
139 Ga0265330_10002227 3300031235 Bacteria 10683
140 Ga0265325_10000859 3300031241 Bacteria 21901
141 Ga0265339_10076518 3300031249 Bacteria 1775
142 Ga0265313_10020841 3300031595 Bacteria 3602
143 Ga0265313_10025001 3300031595 Bacteria 3175
144 Ga0265313_10140895 3300031595 Bacteria 1037
145 Ga0265314_10019716 3300031711 Bacteria 5217
146 Ga0265342_10010169 3300031712 Bacteria 6551
147 Ga0265342_10017781 3300031712 Bacteria 4617
148 Ga0307510_10040393 3300033180 Bacteria 5122
149 Ga0307510_10096075 3300033180 Bacteria 2781
150 Ga0307510_10096936 3300033180 Bacteria 2762
151 Ga0373953_0212318 3300035117 Unclassified 838
152 Ga0436360_0096904 3300039438 Bacteria 2536
153 Ga0436360_0156801 3300039438 Bacteria 1958
154 Ga0436360_1014516 3300039438 Bacteria 2807
155 Ga0436361_0398402 3300039447 Bacteria 7007
156 Ga0436361_0539690 3300039447 Bacteria 30745
157 Ga0451577_0000290 3300042876 Bacteria 97706
158 Ga0453683_0067348 3300044673 Bacteria 2238
159 Ga0453683_0121270 3300044673 Bacteria 1646
160 Ga0453684_0000104 3300044712 Bacteria 365431
161 Ga0451576_0013580 3300045051 Bacteria 9104
162 Ga0495629_0008172 3300046459 Bacteria 7697
163 Ga0495629_0545622 3300046459 Bacteria 778
164 Ga0495638_0296288 3300046460 Bacteria 873
165 Ga0495651_0079552 3300046462 Bacteria 2477
166 Ga0495650_0000022 3300046471 Bacteria 530747
167 Ga0495650_0010525 3300046471 Bacteria 5153
168 Ga0495580_0087072 3300046472 Bacteria 2176
169 Ga0495639_0003332 3300046475 Bacteria 6964
170 Ga0495662_0033051 3300046476 Bacteria 2500
171 Ga0495664_0007697 3300046477 Bacteria 5991
172 Ga0495594_0001550 3300046499 Bacteria 11933
173 Ga0495594_0031242 3300046499 Bacteria 2886
174 Ga0495594_0031863 3300046499 Bacteria 2860
175 Ga0495596_0050065 3300046500 Bacteria 1637
176 Ga0495583_0042874 3300046506 Bacteria 2110
177 Ga0495583_0114403 3300046506 Bacteria 1141
178 Ga0495606_0042098 3300046507 Bacteria 3058
179 Ga0495643_0044157 3300046522 Bacteria 2423
180 Ga0495644_0000085 3300046523 Bacteria 46343
181 Ga0495642_0064479 3300046528 Bacteria 1524
182 Ga0495652_0246693 3300046529 Bacteria 1325
183 Ga0495665_0044332 3300046531 Bacteria 2363
184 Ga0495640_0007805 3300046533 Bacteria 8419
185 Ga0495586_0008223 3300046535 Bacteria 5560
186 Ga0495587_0084862 3300046536 Bacteria 1834
187 Ga0495609_0022911 3300046538 Bacteria 2876
188 Ga0495645_0015464 3300046543 Bacteria 5427
189 Ga0495645_0131788 3300046543 Bacteria 1751
190 Ga0495668_0090127 3300046616 Bacteria 1680
191 Ga0495634_0006074 3300046642 Bacteria 9209
192 Ga0495625_0000276 3300046660 Bacteria 79774
193 Ga0495625_0047468 3300046660 Bacteria 3096
194 Ga0495625_0197476 3300046660 Bacteria 1330
195 Ga0495661_0029625 3300046665 Bacteria 3492
196 Ga0495588_0093408 3300046674 Bacteria 1577
197 Ga0495599_0061229 3300046678 Bacteria 2352
198 Ga0495623_0308997 3300046679 Bacteria 871
199 Ga0495646_0002767 3300046680 Bacteria 10850
200 Ga0495669_0005400 3300046684 Bacteria 5330
201 Ga0495613_0004952 3300046689 Bacteria 9999
202 Ga0495670_0207671 3300046691 Bacteria 1038
203 Ga0495649_0176784 3300046694 Bacteria 1115
204 Ga0495600_0002830 3300046809 Bacteria 10093
205 Ga0495674_0011508 3300047319 Bacteria 8346
206 Ga0495672_0002247 3300047320 Bacteria 17973
207 Ga0495676_0002715 3300047321 Bacteria 15874
208 Ga0495680_0302821 3300047322 Bacteria 1122
209 Ga0495687_016849 3300047443 Bacteria 3665
210 Ga0495686_0000035 3300047472 Bacteria 314930
211 Ga0495686_0002787 3300047472 Bacteria 15931
212 Ga0495686_0005939 3300047472 Bacteria 9500
213 Ga0495686_0007028 3300047472 Bacteria 8499
214 Ga0495686_0025520 3300047472 Bacteria 3873
215 Ga0495614_0000939 3300048089 Bacteria 12404
216 Ga0496101_0014816 3300048904 Bacteria 5246
217 Ga0496102_0048809 3300048905 Bacteria 3849
218 Ga0496103_0095726 3300048906 Bacteria 1876
219 Ga0496104_0000076 3300048907 Bacteria 102010
220 Ga0496104_0018863 3300048907 Bacteria 6300
221 Ga0496104_0138229 3300048907 Bacteria 2341
222 Ga0496104_0621073 3300048907 Bacteria 990
223 Ga0496105_0070214 3300048908 Unclassified 2895
224 Ga0496105_0143535 3300048908 Bacteria 1964
225 Ga0496108_0379438 3300048911 Bacteria 1234
226 Ga0496109_0137061 3300048912 Bacteria 2287
227 Ga0496110_0104565 3300048913 Bacteria 2540
228 Ga0496111_0487755 3300048914 Bacteria 907
229 Ga0496112_0037508 3300048915 Bacteria 4729
230 Ga0496112_0553872 3300048915 Bacteria 1084
231 Ga0496113_0070242 3300048916 Bacteria 2661
232 Ga0496115_0106245 3300048918 Bacteria 2304
233 Ga0496115_0131544 3300048918 Bacteria 2062
234 Ga0496115_0134595 3300048918 Unclassified 2038
235 Ga0496120_0260333 3300048923 Bacteria 810
236 Ga0496121_0146910 3300048924 Bacteria 1741
237 Ga0496126_0000010 3300048929 Bacteria 744888
238 Ga0496126_0000042 3300048929 Bacteria 340121
239 Ga0496126_0000245 3300048929 Bacteria 116888
240 Ga0496126_0002019 3300048929 Bacteria 28695
241 Ga0496126_0037465 3300048929 Bacteria 4525
242 Ga0495682_0047545 3300049460 Bacteria 1565
243 Ga0501031_0139959 3300049568 Bacteria 1581
244 Ga0501032_0000563 3300049569 Bacteria 30073
245 Ga0501034_0373203 3300049571 Bacteria 1352
246 Ga0501036_0000595 3300049572 Bacteria 26224
247 Ga0501037_0009272 3300049573 Bacteria 7216
248 Ga0501038_0014533 3300049574 Bacteria 7174
249 Ga0501039_0036028 3300049575 Bacteria 3817
250 Ga0501043_0007443 3300049579 Bacteria 8693
251 Ga0501046_0000259 3300049580 Bacteria 53817
252 Ga0501047_0011353 3300049581 Bacteria 8433
253 Ga0501047_0049024 3300049581 Bacteria 4078
254 Ga0501048_0367725 3300049582 Bacteria 1026
255 Ga0501068_0023172 3300049584 Bacteria 3637
256 Ga0501070_0070655 3300049586 Bacteria 2891
257 Ga0501073_0032948 3300049589 Bacteria 3692
258 Ga0501080_0707184 3300049742 Bacteria 888
259 Ga0501035_0147720 3300049822 Bacteria 2041
260 Ga0501044_0050534 3300049823 Bacteria 4289
261 Ga0501044_0075606 3300049823 Bacteria 3419
262 Ga0501044_0695519 3300049823 Bacteria 902
263 Ga0500651_0000005 3300053093 Bacteria 384761
264 Ga0500595_000004 3300053119 Bacteria 410922
265 Ga0500655_019675 3300053133 Bacteria 1258
266 Ga0500661_002268 3300055283 Bacteria 3636

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10476880 Ga0157369_104768801 185
2 3300046459 Ga0495629_0008172 Ga0495629_0008172_2756_3364 193
3 3300046499 Ga0495594_0031863 Ga0495594_0031863_1538_2146 193
4 3300046531 Ga0495665_0044332 Ga0495665_0044332_169_768 193
5 iso_pu_bacteria 2884215851 2884216137 193
6 3300005327 Ga0070658_10072349 Ga0070658_100723492 195
7 3300005336 Ga0070680_100026305 Ga0070680_1000263052 195
8 3300005344 Ga0070661_100052544 Ga0070661_1000525442 195
9 3300005458 Ga0070681_10045065 Ga0070681_100450654 195
10 3300005530 Ga0070679_100055245 Ga0070679_1000552452 195
11 3300005563 Ga0068855_100112310 Ga0068855_1001123101 195
12 3300005577 Ga0068857_100109552 Ga0068857_1001095522 195
13 3300005578 Ga0068854_100065160 Ga0068854_1000651602 195
14 3300009093 Ga0105240_10079154 Ga0105240_100791543 195
15 3300009545 Ga0105237_10017262 Ga0105237_100172626 195
16 3300009551 Ga0105238_10095943 Ga0105238_100959432 195
17 3300013105 Ga0157369_10026444 Ga0157369_100264445 195
18 3300013307 Ga0157372_10131190 Ga0157372_101311902 195
19 3300025261 Ga0209233_1001575 Ga0209233_10015757 195
20 3300025909 Ga0207705_10002388 Ga0207705_1000238810 195
21 3300025912 Ga0207707_10018246 Ga0207707_100182462 195
22 3300025913 Ga0207695_10064447 Ga0207695_100644472 195
23 3300025919 Ga0207657_10001554 Ga0207657_1000155422 195
24 3300025921 Ga0207652_10022218 Ga0207652_100222182 195
25 3300025944 Ga0207661_10040290 Ga0207661_100402902 195
26 3300025949 Ga0207667_10034192 Ga0207667_100341922 195
27 3300025981 Ga0207640_10013549 Ga0207640_100135493 195
28 3300026041 Ga0207639_10028132 Ga0207639_100281322 195
29 3300026067 Ga0207678_10001807 Ga0207678_1000180716 195
30 3300026116 Ga0207674_10001390 Ga0207674_1000139024 195
31 3300047472 Ga0495686_0000035 Ga0495686_0000035_249227_249835 195
32 3300047472 Ga0495686_0002787 Ga0495686_0002787_3446_4099 195
33 3300047472 Ga0495686_0007028 Ga0495686_0007028_70_678 195
34 3300047472 Ga0495686_0025520 Ga0495686_0025520_936_1544 195
35 3300048929 Ga0496126_0000042 Ga0496126_0000042_1715_2323 195
36 3300003322 rootL2_10108404 rootL2_101084043 196
37 3300025903 Ga0207680_10170150 Ga0207680_101701501 196
38 3300046507 Ga0495606_0042098 Ga0495606_0042098_2029_2625 196
39 3300046522 Ga0495643_0044157 Ga0495643_0044157_1706_2302 196
40 3300046543 Ga0495645_0131788 Ga0495645_0131788_434_1081 196
41 3300046694 Ga0495649_0176784 Ga0495649_0176784_451_1047 196
42 3300047443 Ga0495687_016849 Ga0495687_016849_808_1404 196
43 3300005327 Ga0070658_10000007 Ga0070658_10000007220 197
44 3300005327 Ga0070658_10079589 Ga0070658_100795892 197
45 3300005327 Ga0070658_10132797 Ga0070658_101327972 197
46 3300005327 Ga0070658_10178834 Ga0070658_101788343 197
47 3300005339 Ga0070660_100055675 Ga0070660_1000556752 197
48 3300005366 Ga0070659_100065273 Ga0070659_1000652732 197
49 3300005539 Ga0068853_100000027 Ga0068853_10000002780 197
50 3300005548 Ga0070665_100037855 Ga0070665_1000378556 197
51 3300005548 Ga0070665_100118195 Ga0070665_1001181954 197
52 3300005563 Ga0068855_100043770 Ga0068855_1000437703 197
53 3300005614 Ga0068856_100306233 Ga0068856_1003062332 197
54 3300009177 Ga0105248_10103260 Ga0105248_101032603 197
55 3300013104 Ga0157370_10181848 Ga0157370_101818481 197
56 3300013105 Ga0157369_10033542 Ga0157369_100335422 197
57 3300025909 Ga0207705_10000013 Ga0207705_10000013155 197
58 3300025909 Ga0207705_10044307 Ga0207705_100443072 197
59 3300025909 Ga0207705_10075419 Ga0207705_100754192 197
60 3300025909 Ga0207705_10430833 Ga0207705_104308331 197
61 3300025919 Ga0207657_10005268 Ga0207657_100052682 197
62 3300025919 Ga0207657_10207395 Ga0207657_102073952 197
63 3300025932 Ga0207690_10008299 Ga0207690_100082992 197
64 3300025941 Ga0207711_10111045 Ga0207711_101110452 197
65 3300025949 Ga0207667_10007958 Ga0207667_100079582 197
66 3300025949 Ga0207667_10018770 Ga0207667_100187703 197
67 3300026041 Ga0207639_10000036 Ga0207639_10000036104 197
68 3300026067 Ga0207678_10023375 Ga0207678_100233753 197
69 3300026078 Ga0207702_10224250 Ga0207702_102242502 197
70 3300028379 Ga0268266_10002041 Ga0268266_1000204118 197
71 3300028800 Ga0265338_10460983 Ga0265338_104609831 197
72 3300033180 Ga0307510_10096936 Ga0307510_100969362 197
73 3300046660 Ga0495625_0000276 Ga0495625_0000276_48221_48823 197
74 3300047320 Ga0495672_0002247 Ga0495672_0002247_15211_15804 197
75 3300047472 Ga0495686_0005939 Ga0495686_0005939_6428_7036 197
76 3300048929 Ga0496126_0000010 Ga0496126_0000010_100387_101058 197
77 3300049460 Ga0495682_0047545 Ga0495682_0047545_198_860 197
78 3300049568 Ga0501031_0139959 Ga0501031_0139959_224_835 197
79 3300049569 Ga0501032_0000563 Ga0501032_0000563_591_1202 197
80 3300049571 Ga0501034_0373203 Ga0501034_0373203_508_1119 197
81 3300049572 Ga0501036_0000595 Ga0501036_0000595_24848_25459 197
82 3300049573 Ga0501037_0009272 Ga0501037_0009272_2722_3333 197
83 3300049574 Ga0501038_0014533 Ga0501038_0014533_751_1362 197
84 3300049575 Ga0501039_0036028 Ga0501039_0036028_2840_3451 197
85 3300049579 Ga0501043_0007443 Ga0501043_0007443_508_1119 197
86 3300049580 Ga0501046_0000259 Ga0501046_0000259_50362_50973 197
87 3300049581 Ga0501047_0049024 Ga0501047_0049024_38_649 197
88 3300049582 Ga0501048_0367725 Ga0501048_0367725_357_968 197
89 3300049584 Ga0501068_0023172 Ga0501068_0023172_778_1389 197
90 3300049586 Ga0501070_0070655 Ga0501070_0070655_523_1119 197
91 3300049589 Ga0501073_0032948 Ga0501073_0032948_1034_1645 197
92 3300049742 Ga0501080_0707184 Ga0501080_0707184_169_780 197
93 3300049822 Ga0501035_0147720 Ga0501035_0147720_448_1044 197
94 3300049823 Ga0501044_0050534 Ga0501044_0050534_1778_2437 197
95 3300049823 Ga0501044_0075606 Ga0501044_0075606_2020_2631 197
96 3300049823 Ga0501044_0695519 Ga0501044_0695519_124_720 197
97 3300005327 Ga0070658_10157909 Ga0070658_101579093 198
98 3300005337 Ga0070682_100396077 Ga0070682_1003960771 198
99 3300005355 Ga0070671_100117989 Ga0070671_1001179893 198
100 3300005455 Ga0070663_100079177 Ga0070663_1000791773 198
101 3300005458 Ga0070681_10882990 Ga0070681_108829901 198
102 3300005548 Ga0070665_100030811 Ga0070665_1000308111 198
103 3300005563 Ga0068855_100052360 Ga0068855_1000523604 198
104 3300005578 Ga0068854_100000021 Ga0068854_10000002155 198
105 3300005842 Ga0068858_100044316 Ga0068858_1000443162 198
106 3300009093 Ga0105240_10174634 Ga0105240_101746342 198
107 3300009093 Ga0105240_10232922 Ga0105240_102329222 198
108 3300009093 Ga0105240_10373966 Ga0105240_103739662 198
109 3300009093 Ga0105240_10783252 Ga0105240_107832521 198
110 3300009098 Ga0105245_10558392 Ga0105245_105583922 198
111 3300009177 Ga0105248_10811412 Ga0105248_108114121 198
112 3300009545 Ga0105237_10144415 Ga0105237_101444153 198
113 3300009551 Ga0105238_10437761 Ga0105238_104377612 198
114 3300013296 Ga0157374_10181179 Ga0157374_101811793 198
115 3300013296 Ga0157374_10557855 Ga0157374_105578552 198
116 3300013306 Ga0163162_10002032 Ga0163162_1000203210 198
117 3300013308 Ga0157375_10973489 Ga0157375_109734892 198
118 3300014325 Ga0163163_10208876 Ga0163163_102088763 198
119 3300014968 Ga0157379_10159104 Ga0157379_101591042 198
120 3300014968 Ga0157379_10175079 Ga0157379_101750792 198
121 3300014969 Ga0157376_10136350 Ga0157376_101363502 198
122 3300025909 Ga0207705_10122848 Ga0207705_101228482 198
123 3300025912 Ga0207707_10748524 Ga0207707_107485241 198
124 3300025913 Ga0207695_10070182 Ga0207695_100701821 198
125 3300025913 Ga0207695_10292563 Ga0207695_102925632 198
126 3300025914 Ga0207671_10362674 Ga0207671_103626741 198
127 3300025924 Ga0207694_10011596 Ga0207694_100115961 198
128 3300025931 Ga0207644_10126607 Ga0207644_101266073 198
129 3300025949 Ga0207667_10286106 Ga0207667_102861062 198
130 3300025981 Ga0207640_10000007 Ga0207640_10000007173 198
131 3300026035 Ga0207703_10032234 Ga0207703_100322342 198
132 3300026088 Ga0207641_10254253 Ga0207641_102542531 198
133 3300033180 Ga0307510_10040393 Ga0307510_100403935 198
134 3300033180 Ga0307510_10096075 Ga0307510_100960753 198
135 3300042876 Ga0451577_0000290 Ga0451577_0000290_7611_8246 198
136 3300044673 Ga0453683_0067348 Ga0453683_0067348_1326_1961 198
137 3300044673 Ga0453683_0121270 Ga0453683_0121270_933_1568 198
138 3300044712 Ga0453684_0000104 Ga0453684_0000104_362806_363441 198
139 3300045051 Ga0451576_0013580 Ga0451576_0013580_3292_3927 198
140 3300046459 Ga0495629_0545622 Ga0495629_0545622_104_703 198
141 3300046460 Ga0495638_0296288 Ga0495638_0296288_165_767 198
142 3300046462 Ga0495651_0079552 Ga0495651_0079552_239_838 198
143 3300046471 Ga0495650_0000022 Ga0495650_0000022_110307_110915 198
144 3300046472 Ga0495580_0087072 Ga0495580_0087072_519_1118 198
145 3300046475 Ga0495639_0003332 Ga0495639_0003332_5965_6564 198
146 3300046476 Ga0495662_0033051 Ga0495662_0033051_1339_1938 198
147 3300046477 Ga0495664_0007697 Ga0495664_0007697_2082_2681 198
148 3300046499 Ga0495594_0001550 Ga0495594_0001550_6087_6686 198
149 3300046499 Ga0495594_0031242 Ga0495594_0031242_1632_2240 198
150 3300046500 Ga0495596_0050065 Ga0495596_0050065_219_827 198
151 3300046506 Ga0495583_0042874 Ga0495583_0042874_390_989 198
152 3300046506 Ga0495583_0114403 Ga0495583_0114403_494_1090 198
153 3300046523 Ga0495644_0000085 Ga0495644_0000085_9110_9718 198
154 3300046528 Ga0495642_0064479 Ga0495642_0064479_312_920 198
155 3300046529 Ga0495652_0246693 Ga0495652_0246693_113_721 198
156 3300046533 Ga0495640_0007805 Ga0495640_0007805_6225_6824 198
157 3300046535 Ga0495586_0008223 Ga0495586_0008223_621_1220 198
158 3300046538 Ga0495609_0022911 Ga0495609_0022911_411_1019 198
159 3300046543 Ga0495645_0015464 Ga0495645_0015464_449_1048 198
160 3300046616 Ga0495668_0090127 Ga0495668_0090127_202_810 198
161 3300046642 Ga0495634_0006074 Ga0495634_0006074_4011_4610 198
162 3300046660 Ga0495625_0047468 Ga0495625_0047468_2400_2996 198
163 3300046660 Ga0495625_0197476 Ga0495625_0197476_123_743 198
164 3300046665 Ga0495661_0029625 Ga0495661_0029625_2404_3033 198
165 3300046674 Ga0495588_0093408 Ga0495588_0093408_19_627 198
166 3300046678 Ga0495599_0061229 Ga0495599_0061229_1214_1813 198
167 3300046679 Ga0495623_0308997 Ga0495623_0308997_29_628 198
168 3300046680 Ga0495646_0002767 Ga0495646_0002767_3793_4392 198
169 3300046684 Ga0495669_0005400 Ga0495669_0005400_1896_2504 198
170 3300046689 Ga0495613_0004952 Ga0495613_0004952_4470_5069 198
171 3300046691 Ga0495670_0207671 Ga0495670_0207671_60_668 198
172 3300046809 Ga0495600_0002830 Ga0495600_0002830_6223_6822 198
173 3300047319 Ga0495674_0011508 Ga0495674_0011508_5772_6371 198
174 3300047321 Ga0495676_0002715 Ga0495676_0002715_4143_4742 198
175 3300047322 Ga0495680_0302821 Ga0495680_0302821_185_784 198
176 3300048089 Ga0495614_0000939 Ga0495614_0000939_7481_8080 198
177 3300048907 Ga0496104_0000076 Ga0496104_0000076_35309_35926 198
178 3300048907 Ga0496104_0138229 Ga0496104_0138229_728_1336 198
179 3300048908 Ga0496105_0143535 Ga0496105_0143535_1069_1677 198
180 3300048915 Ga0496112_0553872 Ga0496112_0553872_146_748 198
181 3300048918 Ga0496115_0106245 Ga0496115_0106245_876_1484 198
182 3300048924 Ga0496121_0146910 Ga0496121_0146910_872_1468 198
183 3300048929 Ga0496126_0000245 Ga0496126_0000245_92224_92826 198
184 3300053093 Ga0500651_0000005 Ga0500651_0000005_288531_289133 198
185 3300053119 Ga0500595_000004 Ga0500595_000004_342182_342784 198
186 3300055283 Ga0500661_002268 Ga0500661_002268_427_1029 198
187 3300009093 Ga0105240_11140558 Ga0105240_111405581 199
188 3300013297 Ga0157378_10084096 Ga0157378_100840962 199
189 3300025913 Ga0207695_10034523 Ga0207695_100345234 199
190 3300028800 Ga0265338_10007591 Ga0265338_100075916 199
191 3300031249 Ga0265339_10076518 Ga0265339_100765182 199
192 3300031711 Ga0265314_10019716 Ga0265314_100197163 199
193 3300049581 Ga0501047_0011353 Ga0501047_0011353_3169_3858 199
194 3300005437 Ga0070710_10630671 Ga0070710_106306711 200
195 3300005983 Ga0081540_1031181 Ga0081540_10311813 200
196 3300013105 Ga0157369_10332765 Ga0157369_103327651 200
197 3300014969 Ga0157376_10002633 Ga0157376_100026339 200
198 3300021361 Ga0213872_10123079 Ga0213872_101230791 200
199 3300021441 Ga0213871_10007466 Ga0213871_100074662 200
200 3300021441 Ga0213871_10019602 Ga0213871_100196022 200
201 3300039438 Ga0436360_0096904 Ga0436360_0096904_971_1573 200
202 3300039438 Ga0436360_0156801 Ga0436360_0156801_31_633 200
203 3300039438 Ga0436360_1014516 Ga0436360_1014516_735_1337 200
204 3300039447 Ga0436361_0398402 Ga0436361_0398402_6057_6659 200
205 3300039447 Ga0436361_0539690 Ga0436361_0539690_1720_2322 200
206 3300046471 Ga0495650_0010525 Ga0495650_0010525_4235_4885 200
207 3300048929 Ga0496126_0002019 Ga0496126_0002019_10834_11436 200
208 3300005329 Ga0070683_100652593 Ga0070683_1006525932 201
209 3300006028 Ga0070717_10287480 Ga0070717_102874802 201
210 3300009177 Ga0105248_11158878 Ga0105248_111588782 201
211 3300014968 Ga0157379_10037485 Ga0157379_100374852 201
212 3300031235 Ga0265330_10002227 Ga0265330_1000222710 201
213 3300031241 Ga0265325_10000859 Ga0265325_1000085913 201
214 3300031595 Ga0265313_10020841 Ga0265313_100208412 201
215 3300031595 Ga0265313_10025001 Ga0265313_100250013 201
216 3300031595 Ga0265313_10140895 Ga0265313_101408952 201
217 3300031712 Ga0265342_10010169 Ga0265342_100101696 201
218 3300031712 Ga0265342_10017781 Ga0265342_100177813 201
219 3300035117 Ga0373953_0212318 Ga0373953_0212318_152_766 201
220 3300046536 Ga0495587_0084862 Ga0495587_0084862_1160_1774 201
221 3300048907 Ga0496104_0621073 Ga0496104_0621073_122_742 201
222 3300048918 Ga0496115_0134595 Ga0496115_0134595_1190_1810 201
223 3300000546 LJNas_1000458 LJNas_10004583 202
224 3300005327 Ga0070658_10036319 Ga0070658_100363194 202
225 3300005339 Ga0070660_100128162 Ga0070660_1001281623 202
226 3300005355 Ga0070671_100080369 Ga0070671_1000803693 202
227 3300005435 Ga0070714_101562904 Ga0070714_1015629041 202
228 3300005455 Ga0070663_100165104 Ga0070663_1001651042 202
229 3300005548 Ga0070665_100018986 Ga0070665_1000189863 202
230 3300005548 Ga0070665_100173366 Ga0070665_1001733662 202
231 3300005564 Ga0070664_100610000 Ga0070664_1006100001 202
232 3300005614 Ga0068856_100049616 Ga0068856_1000496164 202
233 3300009177 Ga0105248_10000024 Ga0105248_1000002452 202
234 3300009177 Ga0105248_10006467 Ga0105248_100064673 202
235 3300009177 Ga0105248_10119787 Ga0105248_101197873 202
236 3300013105 Ga0157369_10026085 Ga0157369_100260854 202
237 3300013296 Ga0157374_10310703 Ga0157374_103107032 202
238 3300013297 Ga0157378_10369755 Ga0157378_103697553 202
239 3300013306 Ga0163162_10174241 Ga0163162_101742414 202
240 3300014325 Ga0163163_10013587 Ga0163163_100135873 202
241 3300014969 Ga0157376_10005999 Ga0157376_100059998 202
242 3300025904 Ga0207647_10018112 Ga0207647_100181124 202
243 3300025909 Ga0207705_10081348 Ga0207705_100813483 202
244 3300025919 Ga0207657_10529590 Ga0207657_105295902 202
245 3300025931 Ga0207644_10314382 Ga0207644_103143821 202
246 3300025941 Ga0207711_10000007 Ga0207711_10000007393 202
247 3300025941 Ga0207711_10000018 Ga0207711_10000018113 202
248 3300025941 Ga0207711_10043785 Ga0207711_100437852 202
249 3300025945 Ga0207679_10179567 Ga0207679_101795671 202
250 3300026067 Ga0207678_10269350 Ga0207678_102693502 202
251 3300028379 Ga0268266_10054103 Ga0268266_100541031 202
252 3300028379 Ga0268266_10065318 Ga0268266_100653182 202
253 3300048904 Ga0496101_0014816 Ga0496101_0014816_3525_4133 202
254 3300048905 Ga0496102_0048809 Ga0496102_0048809_796_1404 202
255 3300048906 Ga0496103_0095726 Ga0496103_0095726_1124_1732 202
256 3300048907 Ga0496104_0018863 Ga0496104_0018863_5213_5821 202
257 3300048908 Ga0496105_0070214 Ga0496105_0070214_1176_1784 202
258 3300048911 Ga0496108_0379438 Ga0496108_0379438_573_1181 202
259 3300048912 Ga0496109_0137061 Ga0496109_0137061_105_713 202
260 3300048913 Ga0496110_0104565 Ga0496110_0104565_257_865 202
261 3300048914 Ga0496111_0487755 Ga0496111_0487755_191_799 202
262 3300048915 Ga0496112_0037508 Ga0496112_0037508_4042_4650 202
263 3300048916 Ga0496113_0070242 Ga0496113_0070242_71_679 202
264 3300048918 Ga0496115_0131544 Ga0496115_0131544_1258_1866 202
265 3300048923 Ga0496120_0260333 Ga0496120_0260333_25_633 202
266 3300048929 Ga0496126_0037465 Ga0496126_0037465_465_1073 202
267 3300053133 Ga0500655_019675 Ga0500655_019675_102_719 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

139

230

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hkl-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate 0.9448 7 193
5hkf-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.939 6 192
5hki-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate 0.9361 7 192
5hkf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) 0.9239 7 193
2p1z-assembly1.cif.gz_B crystal structure of phosphoribosyltransferase from corynebacterium diphtheriae 0.9227 6 193
ID Description Score Start End Superfamily
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9361 7 192 3.40.50.2020
5hkiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9149 7 192 3.40.50.2020
af_G5EDZ2_3_216_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8848 2 192 3.40.50.2020
af_Q58509_1_175_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8808 7 193 3.40.50.2020
af_P09556_2_207_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.877 8 198 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A5M8SXU7-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9932 7 198 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A2V9V9B0-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9925 7 198 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-E6QHS7-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9882 7 198 GO:0004588
GO:0019856
GO:0044205
AF-A0A7Y5RI34-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9788 7 198 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A838NGI6-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9671 4 167 GO:0004588
GO:0019856
GO:0044205

Feature Viewer

pLDDT pTM Quality
92.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map