F374643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 267 | 161 | 266 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100000021|Ga0068854_10000002155 |
| Length | 243 |
| Sequence | MNTLQIKSEPKSFVKRTLHKKYGGGVLHRQTIYNRTRPMTSQRETLLNLIATHSFKLGDFTLASGQKSDYYIDCRTTTLHAEGGRLSGLVFYELIRERFPQAEAVGGLTMGADPLVSNTASASAWYALQQGQDPANPATKLLQGFLVRKSEKTHGTGRRIEGFLKPGAAVVIVDDVCTTGGSTITAIEAARESGMNVIGILCLVDREQGGRANIEAAAKGAPFISVFTASDVRAAHLALKDIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 43 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 44 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 71 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 75 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 76 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 77 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 78 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 79 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 80 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 81 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 82 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 83 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 140 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 159 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 160 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 161 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.87 |
| Nodule | 0 |
| Rhizoplane | 7.12 |
| Rhizosphere | 86.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000458 | 3300000546 | Bacteria | 7166 |
| 2 | rootL2_10108404 | 3300003322 | Bacteria | 2817 |
| 3 | Ga0070658_10000007 | 3300005327 | Bacteria | 349444 |
| 4 | Ga0070658_10036319 | 3300005327 | Bacteria | 3972 |
| 5 | Ga0070658_10072349 | 3300005327 | Bacteria | 2825 |
| 6 | Ga0070658_10079589 | 3300005327 | Bacteria | 2691 |
| 7 | Ga0070658_10132797 | 3300005327 | Bacteria | 2075 |
| 8 | Ga0070658_10157909 | 3300005327 | Bacteria | 1901 |
| 9 | Ga0070658_10178834 | 3300005327 | Bacteria | 1785 |
| 10 | Ga0070683_100652593 | 3300005329 | Unclassified | 1007 |
| 11 | Ga0070680_100026305 | 3300005336 | Bacteria | 4653 |
| 12 | Ga0070682_100396077 | 3300005337 | Bacteria | 1043 |
| 13 | Ga0070660_100055675 | 3300005339 | Bacteria | 3057 |
| 14 | Ga0070660_100128162 | 3300005339 | Bacteria | 2029 |
| 15 | Ga0070661_100052544 | 3300005344 | Bacteria | 2983 |
| 16 | Ga0070671_100080369 | 3300005355 | Bacteria | 2726 |
| 17 | Ga0070671_100117989 | 3300005355 | Bacteria | 2232 |
| 18 | Ga0070659_100065273 | 3300005366 | Bacteria | 2883 |
| 19 | Ga0070714_101562904 | 3300005435 | Bacteria | 644 |
| 20 | Ga0070710_10630671 | 3300005437 | Bacteria | 749 |
| 21 | Ga0070663_100079177 | 3300005455 | Bacteria | 2410 |
| 22 | Ga0070663_100165104 | 3300005455 | Bacteria | 1707 |
| 23 | Ga0070681_10045065 | 3300005458 | Bacteria | 4414 |
| 24 | Ga0070681_10882990 | 3300005458 | Unclassified | 812 |
| 25 | Ga0070679_100055245 | 3300005530 | Bacteria | 3954 |
| 26 | Ga0068853_100000027 | 3300005539 | Bacteria | 127120 |
| 27 | Ga0070665_100018986 | 3300005548 | Bacteria | 6896 |
| 28 | Ga0070665_100030811 | 3300005548 | Bacteria | 5398 |
| 29 | Ga0070665_100037855 | 3300005548 | Bacteria | 4849 |
| 30 | Ga0070665_100118195 | 3300005548 | Bacteria | 2653 |
| 31 | Ga0070665_100173366 | 3300005548 | Bacteria | 2158 |
| 32 | Ga0068855_100043770 | 3300005563 | Bacteria | 5301 |
| 33 | Ga0068855_100052360 | 3300005563 | Bacteria | 4806 |
| 34 | Ga0068855_100112310 | 3300005563 | Bacteria | 3127 |
| 35 | Ga0070664_100610000 | 3300005564 | Bacteria | 1012 |
| 36 | Ga0068857_100109552 | 3300005577 | Bacteria | 2481 |
| 37 | Ga0068854_100000021 | 3300005578 | Bacteria | 130648 |
| 38 | Ga0068854_100065160 | 3300005578 | Bacteria | 2648 |
| 39 | Ga0068856_100049616 | 3300005614 | Bacteria | 4137 |
| 40 | Ga0068856_100306233 | 3300005614 | Bacteria | 1607 |
| 41 | Ga0068858_100044316 | 3300005842 | Bacteria | 4124 |
| 42 | Ga0081540_1031181 | 3300005983 | Bacteria | 2936 |
| 43 | Ga0070717_10287480 | 3300006028 | Unclassified | 1459 |
| 44 | Ga0105240_10079154 | 3300009093 | Bacteria | 4045 |
| 45 | Ga0105240_10174634 | 3300009093 | Bacteria | 2541 |
| 46 | Ga0105240_10232922 | 3300009093 | Bacteria | 2139 |
| 47 | Ga0105240_10373966 | 3300009093 | Bacteria | 1610 |
| 48 | Ga0105240_10783252 | 3300009093 | Bacteria | 1034 |
| 49 | Ga0105240_11140558 | 3300009093 | Unclassified | 828 |
| 50 | Ga0105245_10558392 | 3300009098 | Bacteria | 1167 |
| 51 | Ga0105248_10000024 | 3300009177 | Bacteria | 263817 |
| 52 | Ga0105248_10006467 | 3300009177 | Bacteria | 12854 |
| 53 | Ga0105248_10103260 | 3300009177 | Bacteria | 3213 |
| 54 | Ga0105248_10119787 | 3300009177 | Bacteria | 2969 |
| 55 | Ga0105248_10811412 | 3300009177 | Bacteria | 1056 |
| 56 | Ga0105248_11158878 | 3300009177 | Bacteria | 874 |
| 57 | Ga0105237_10017262 | 3300009545 | Bacteria | 7484 |
| 58 | Ga0105237_10144415 | 3300009545 | Bacteria | 2374 |
| 59 | Ga0105238_10095943 | 3300009551 | Bacteria | 2952 |
| 60 | Ga0105238_10437761 | 3300009551 | Bacteria | 1303 |
| 61 | Ga0157370_10181848 | 3300013104 | Bacteria | 1954 |
| 62 | Ga0157369_10026085 | 3300013105 | Bacteria | 6483 |
| 63 | Ga0157369_10026444 | 3300013105 | Bacteria | 6435 |
| 64 | Ga0157369_10033542 | 3300013105 | Bacteria | 5641 |
| 65 | Ga0157369_10332765 | 3300013105 | Bacteria | 1578 |
| 66 | Ga0157369_10476880 | 3300013105 | Bacteria | 1291 |
| 67 | Ga0157374_10181179 | 3300013296 | Bacteria | 2058 |
| 68 | Ga0157374_10310703 | 3300013296 | Bacteria | 1561 |
| 69 | Ga0157374_10557855 | 3300013296 | Bacteria | 1153 |
| 70 | Ga0157378_10084096 | 3300013297 | Bacteria | 2881 |
| 71 | Ga0157378_10369755 | 3300013297 | Unclassified | 1405 |
| 72 | Ga0163162_10002032 | 3300013306 | Bacteria | 19036 |
| 73 | Ga0163162_10174241 | 3300013306 | Bacteria | 2276 |
| 74 | Ga0157372_10131190 | 3300013307 | Bacteria | 2883 |
| 75 | Ga0157375_10973489 | 3300013308 | Bacteria | 989 |
| 76 | Ga0163163_10013587 | 3300014325 | Bacteria | 7457 |
| 77 | Ga0163163_10208876 | 3300014325 | Bacteria | 2001 |
| 78 | Ga0157379_10037485 | 3300014968 | Bacteria | 4323 |
| 79 | Ga0157379_10159104 | 3300014968 | Unclassified | 2038 |
| 80 | Ga0157379_10175079 | 3300014968 | Bacteria | 1937 |
| 81 | Ga0157376_10002633 | 3300014969 | Bacteria | 12203 |
| 82 | Ga0157376_10005999 | 3300014969 | Bacteria | 8537 |
| 83 | Ga0157376_10136350 | 3300014969 | Bacteria | 2196 |
| 84 | Ga0213872_10123079 | 3300021361 | Bacteria | 1146 |
| 85 | Ga0213871_10007466 | 3300021441 | Bacteria | 2366 |
| 86 | Ga0213871_10019602 | 3300021441 | Bacteria | 1667 |
| 87 | Ga0209233_1001575 | 3300025261 | Bacteria | 8923 |
| 88 | Ga0207680_10170150 | 3300025903 | Bacteria | 1467 |
| 89 | Ga0207647_10018112 | 3300025904 | Bacteria | 4773 |
| 90 | Ga0207705_10000013 | 3300025909 | Bacteria | 451680 |
| 91 | Ga0207705_10002388 | 3300025909 | Bacteria | 14511 |
| 92 | Ga0207705_10044307 | 3300025909 | Bacteria | 3197 |
| 93 | Ga0207705_10075419 | 3300025909 | Bacteria | 2449 |
| 94 | Ga0207705_10081348 | 3300025909 | Bacteria | 2361 |
| 95 | Ga0207705_10122848 | 3300025909 | Bacteria | 1928 |
| 96 | Ga0207705_10430833 | 3300025909 | Bacteria | 1022 |
| 97 | Ga0207707_10018246 | 3300025912 | Bacteria | 6116 |
| 98 | Ga0207707_10748524 | 3300025912 | Unclassified | 817 |
| 99 | Ga0207695_10034523 | 3300025913 | Bacteria | 5499 |
| 100 | Ga0207695_10064447 | 3300025913 | Bacteria | 3773 |
| 101 | Ga0207695_10070182 | 3300025913 | Bacteria | 3583 |
| 102 | Ga0207695_10292563 | 3300025913 | Bacteria | 1521 |
| 103 | Ga0207671_10362674 | 3300025914 | Bacteria | 1150 |
| 104 | Ga0207657_10001554 | 3300025919 | Bacteria | 24621 |
| 105 | Ga0207657_10005268 | 3300025919 | Bacteria | 13548 |
| 106 | Ga0207657_10207395 | 3300025919 | Bacteria | 1574 |
| 107 | Ga0207657_10529590 | 3300025919 | Bacteria | 922 |
| 108 | Ga0207652_10022218 | 3300025921 | Bacteria | 5244 |
| 109 | Ga0207694_10011596 | 3300025924 | Bacteria | 6651 |
| 110 | Ga0207644_10126607 | 3300025931 | Bacteria | 1950 |
| 111 | Ga0207644_10314382 | 3300025931 | Bacteria | 1265 |
| 112 | Ga0207690_10008299 | 3300025932 | Bacteria | 6160 |
| 113 | Ga0207711_10000007 | 3300025941 | Bacteria | 759410 |
| 114 | Ga0207711_10000018 | 3300025941 | Bacteria | 431036 |
| 115 | Ga0207711_10043785 | 3300025941 | Bacteria | 3820 |
| 116 | Ga0207711_10111045 | 3300025941 | Bacteria | 2439 |
| 117 | Ga0207661_10040290 | 3300025944 | Bacteria | 3671 |
| 118 | Ga0207679_10179567 | 3300025945 | Bacteria | 1750 |
| 119 | Ga0207667_10007958 | 3300025949 | Bacteria | 12648 |
| 120 | Ga0207667_10018770 | 3300025949 | Bacteria | 7744 |
| 121 | Ga0207667_10034192 | 3300025949 | Bacteria | 5460 |
| 122 | Ga0207667_10286106 | 3300025949 | Bacteria | 1684 |
| 123 | Ga0207640_10000007 | 3300025981 | Bacteria | 303287 |
| 124 | Ga0207640_10013549 | 3300025981 | Bacteria | 4679 |
| 125 | Ga0207703_10032234 | 3300026035 | Bacteria | 4147 |
| 126 | Ga0207639_10000036 | 3300026041 | Bacteria | 148421 |
| 127 | Ga0207639_10028132 | 3300026041 | Bacteria | 4101 |
| 128 | Ga0207678_10001807 | 3300026067 | Bacteria | 19591 |
| 129 | Ga0207678_10023375 | 3300026067 | Bacteria | 5405 |
| 130 | Ga0207678_10269350 | 3300026067 | Bacteria | 1460 |
| 131 | Ga0207702_10224250 | 3300026078 | Bacteria | 1753 |
| 132 | Ga0207641_10254253 | 3300026088 | Bacteria | 1642 |
| 133 | Ga0207674_10001390 | 3300026116 | Bacteria | 31168 |
| 134 | Ga0268266_10002041 | 3300028379 | Bacteria | 22418 |
| 135 | Ga0268266_10054103 | 3300028379 | Bacteria | 3449 |
| 136 | Ga0268266_10065318 | 3300028379 | Bacteria | 3146 |
| 137 | Ga0265338_10007591 | 3300028800 | Bacteria | 13398 |
| 138 | Ga0265338_10460983 | 3300028800 | Bacteria | 899 |
| 139 | Ga0265330_10002227 | 3300031235 | Bacteria | 10683 |
| 140 | Ga0265325_10000859 | 3300031241 | Bacteria | 21901 |
| 141 | Ga0265339_10076518 | 3300031249 | Bacteria | 1775 |
| 142 | Ga0265313_10020841 | 3300031595 | Bacteria | 3602 |
| 143 | Ga0265313_10025001 | 3300031595 | Bacteria | 3175 |
| 144 | Ga0265313_10140895 | 3300031595 | Bacteria | 1037 |
| 145 | Ga0265314_10019716 | 3300031711 | Bacteria | 5217 |
| 146 | Ga0265342_10010169 | 3300031712 | Bacteria | 6551 |
| 147 | Ga0265342_10017781 | 3300031712 | Bacteria | 4617 |
| 148 | Ga0307510_10040393 | 3300033180 | Bacteria | 5122 |
| 149 | Ga0307510_10096075 | 3300033180 | Bacteria | 2781 |
| 150 | Ga0307510_10096936 | 3300033180 | Bacteria | 2762 |
| 151 | Ga0373953_0212318 | 3300035117 | Unclassified | 838 |
| 152 | Ga0436360_0096904 | 3300039438 | Bacteria | 2536 |
| 153 | Ga0436360_0156801 | 3300039438 | Bacteria | 1958 |
| 154 | Ga0436360_1014516 | 3300039438 | Bacteria | 2807 |
| 155 | Ga0436361_0398402 | 3300039447 | Bacteria | 7007 |
| 156 | Ga0436361_0539690 | 3300039447 | Bacteria | 30745 |
| 157 | Ga0451577_0000290 | 3300042876 | Bacteria | 97706 |
| 158 | Ga0453683_0067348 | 3300044673 | Bacteria | 2238 |
| 159 | Ga0453683_0121270 | 3300044673 | Bacteria | 1646 |
| 160 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 161 | Ga0451576_0013580 | 3300045051 | Bacteria | 9104 |
| 162 | Ga0495629_0008172 | 3300046459 | Bacteria | 7697 |
| 163 | Ga0495629_0545622 | 3300046459 | Bacteria | 778 |
| 164 | Ga0495638_0296288 | 3300046460 | Bacteria | 873 |
| 165 | Ga0495651_0079552 | 3300046462 | Bacteria | 2477 |
| 166 | Ga0495650_0000022 | 3300046471 | Bacteria | 530747 |
| 167 | Ga0495650_0010525 | 3300046471 | Bacteria | 5153 |
| 168 | Ga0495580_0087072 | 3300046472 | Bacteria | 2176 |
| 169 | Ga0495639_0003332 | 3300046475 | Bacteria | 6964 |
| 170 | Ga0495662_0033051 | 3300046476 | Bacteria | 2500 |
| 171 | Ga0495664_0007697 | 3300046477 | Bacteria | 5991 |
| 172 | Ga0495594_0001550 | 3300046499 | Bacteria | 11933 |
| 173 | Ga0495594_0031242 | 3300046499 | Bacteria | 2886 |
| 174 | Ga0495594_0031863 | 3300046499 | Bacteria | 2860 |
| 175 | Ga0495596_0050065 | 3300046500 | Bacteria | 1637 |
| 176 | Ga0495583_0042874 | 3300046506 | Bacteria | 2110 |
| 177 | Ga0495583_0114403 | 3300046506 | Bacteria | 1141 |
| 178 | Ga0495606_0042098 | 3300046507 | Bacteria | 3058 |
| 179 | Ga0495643_0044157 | 3300046522 | Bacteria | 2423 |
| 180 | Ga0495644_0000085 | 3300046523 | Bacteria | 46343 |
| 181 | Ga0495642_0064479 | 3300046528 | Bacteria | 1524 |
| 182 | Ga0495652_0246693 | 3300046529 | Bacteria | 1325 |
| 183 | Ga0495665_0044332 | 3300046531 | Bacteria | 2363 |
| 184 | Ga0495640_0007805 | 3300046533 | Bacteria | 8419 |
| 185 | Ga0495586_0008223 | 3300046535 | Bacteria | 5560 |
| 186 | Ga0495587_0084862 | 3300046536 | Bacteria | 1834 |
| 187 | Ga0495609_0022911 | 3300046538 | Bacteria | 2876 |
| 188 | Ga0495645_0015464 | 3300046543 | Bacteria | 5427 |
| 189 | Ga0495645_0131788 | 3300046543 | Bacteria | 1751 |
| 190 | Ga0495668_0090127 | 3300046616 | Bacteria | 1680 |
| 191 | Ga0495634_0006074 | 3300046642 | Bacteria | 9209 |
| 192 | Ga0495625_0000276 | 3300046660 | Bacteria | 79774 |
| 193 | Ga0495625_0047468 | 3300046660 | Bacteria | 3096 |
| 194 | Ga0495625_0197476 | 3300046660 | Bacteria | 1330 |
| 195 | Ga0495661_0029625 | 3300046665 | Bacteria | 3492 |
| 196 | Ga0495588_0093408 | 3300046674 | Bacteria | 1577 |
| 197 | Ga0495599_0061229 | 3300046678 | Bacteria | 2352 |
| 198 | Ga0495623_0308997 | 3300046679 | Bacteria | 871 |
| 199 | Ga0495646_0002767 | 3300046680 | Bacteria | 10850 |
| 200 | Ga0495669_0005400 | 3300046684 | Bacteria | 5330 |
| 201 | Ga0495613_0004952 | 3300046689 | Bacteria | 9999 |
| 202 | Ga0495670_0207671 | 3300046691 | Bacteria | 1038 |
| 203 | Ga0495649_0176784 | 3300046694 | Bacteria | 1115 |
| 204 | Ga0495600_0002830 | 3300046809 | Bacteria | 10093 |
| 205 | Ga0495674_0011508 | 3300047319 | Bacteria | 8346 |
| 206 | Ga0495672_0002247 | 3300047320 | Bacteria | 17973 |
| 207 | Ga0495676_0002715 | 3300047321 | Bacteria | 15874 |
| 208 | Ga0495680_0302821 | 3300047322 | Bacteria | 1122 |
| 209 | Ga0495687_016849 | 3300047443 | Bacteria | 3665 |
| 210 | Ga0495686_0000035 | 3300047472 | Bacteria | 314930 |
| 211 | Ga0495686_0002787 | 3300047472 | Bacteria | 15931 |
| 212 | Ga0495686_0005939 | 3300047472 | Bacteria | 9500 |
| 213 | Ga0495686_0007028 | 3300047472 | Bacteria | 8499 |
| 214 | Ga0495686_0025520 | 3300047472 | Bacteria | 3873 |
| 215 | Ga0495614_0000939 | 3300048089 | Bacteria | 12404 |
| 216 | Ga0496101_0014816 | 3300048904 | Bacteria | 5246 |
| 217 | Ga0496102_0048809 | 3300048905 | Bacteria | 3849 |
| 218 | Ga0496103_0095726 | 3300048906 | Bacteria | 1876 |
| 219 | Ga0496104_0000076 | 3300048907 | Bacteria | 102010 |
| 220 | Ga0496104_0018863 | 3300048907 | Bacteria | 6300 |
| 221 | Ga0496104_0138229 | 3300048907 | Bacteria | 2341 |
| 222 | Ga0496104_0621073 | 3300048907 | Bacteria | 990 |
| 223 | Ga0496105_0070214 | 3300048908 | Unclassified | 2895 |
| 224 | Ga0496105_0143535 | 3300048908 | Bacteria | 1964 |
| 225 | Ga0496108_0379438 | 3300048911 | Bacteria | 1234 |
| 226 | Ga0496109_0137061 | 3300048912 | Bacteria | 2287 |
| 227 | Ga0496110_0104565 | 3300048913 | Bacteria | 2540 |
| 228 | Ga0496111_0487755 | 3300048914 | Bacteria | 907 |
| 229 | Ga0496112_0037508 | 3300048915 | Bacteria | 4729 |
| 230 | Ga0496112_0553872 | 3300048915 | Bacteria | 1084 |
| 231 | Ga0496113_0070242 | 3300048916 | Bacteria | 2661 |
| 232 | Ga0496115_0106245 | 3300048918 | Bacteria | 2304 |
| 233 | Ga0496115_0131544 | 3300048918 | Bacteria | 2062 |
| 234 | Ga0496115_0134595 | 3300048918 | Unclassified | 2038 |
| 235 | Ga0496120_0260333 | 3300048923 | Bacteria | 810 |
| 236 | Ga0496121_0146910 | 3300048924 | Bacteria | 1741 |
| 237 | Ga0496126_0000010 | 3300048929 | Bacteria | 744888 |
| 238 | Ga0496126_0000042 | 3300048929 | Bacteria | 340121 |
| 239 | Ga0496126_0000245 | 3300048929 | Bacteria | 116888 |
| 240 | Ga0496126_0002019 | 3300048929 | Bacteria | 28695 |
| 241 | Ga0496126_0037465 | 3300048929 | Bacteria | 4525 |
| 242 | Ga0495682_0047545 | 3300049460 | Bacteria | 1565 |
| 243 | Ga0501031_0139959 | 3300049568 | Bacteria | 1581 |
| 244 | Ga0501032_0000563 | 3300049569 | Bacteria | 30073 |
| 245 | Ga0501034_0373203 | 3300049571 | Bacteria | 1352 |
| 246 | Ga0501036_0000595 | 3300049572 | Bacteria | 26224 |
| 247 | Ga0501037_0009272 | 3300049573 | Bacteria | 7216 |
| 248 | Ga0501038_0014533 | 3300049574 | Bacteria | 7174 |
| 249 | Ga0501039_0036028 | 3300049575 | Bacteria | 3817 |
| 250 | Ga0501043_0007443 | 3300049579 | Bacteria | 8693 |
| 251 | Ga0501046_0000259 | 3300049580 | Bacteria | 53817 |
| 252 | Ga0501047_0011353 | 3300049581 | Bacteria | 8433 |
| 253 | Ga0501047_0049024 | 3300049581 | Bacteria | 4078 |
| 254 | Ga0501048_0367725 | 3300049582 | Bacteria | 1026 |
| 255 | Ga0501068_0023172 | 3300049584 | Bacteria | 3637 |
| 256 | Ga0501070_0070655 | 3300049586 | Bacteria | 2891 |
| 257 | Ga0501073_0032948 | 3300049589 | Bacteria | 3692 |
| 258 | Ga0501080_0707184 | 3300049742 | Bacteria | 888 |
| 259 | Ga0501035_0147720 | 3300049822 | Bacteria | 2041 |
| 260 | Ga0501044_0050534 | 3300049823 | Bacteria | 4289 |
| 261 | Ga0501044_0075606 | 3300049823 | Bacteria | 3419 |
| 262 | Ga0501044_0695519 | 3300049823 | Bacteria | 902 |
| 263 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 264 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 265 | Ga0500655_019675 | 3300053133 | Bacteria | 1258 |
| 266 | Ga0500661_002268 | 3300055283 | Bacteria | 3636 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10476880 | Ga0157369_104768801 | 185 |
| 2 | 3300046459 | Ga0495629_0008172 | Ga0495629_0008172_2756_3364 | 193 |
| 3 | 3300046499 | Ga0495594_0031863 | Ga0495594_0031863_1538_2146 | 193 |
| 4 | 3300046531 | Ga0495665_0044332 | Ga0495665_0044332_169_768 | 193 |
| 5 | iso_pu_bacteria | 2884215851 | 2884216137 | 193 |
| 6 | 3300005327 | Ga0070658_10072349 | Ga0070658_100723492 | 195 |
| 7 | 3300005336 | Ga0070680_100026305 | Ga0070680_1000263052 | 195 |
| 8 | 3300005344 | Ga0070661_100052544 | Ga0070661_1000525442 | 195 |
| 9 | 3300005458 | Ga0070681_10045065 | Ga0070681_100450654 | 195 |
| 10 | 3300005530 | Ga0070679_100055245 | Ga0070679_1000552452 | 195 |
| 11 | 3300005563 | Ga0068855_100112310 | Ga0068855_1001123101 | 195 |
| 12 | 3300005577 | Ga0068857_100109552 | Ga0068857_1001095522 | 195 |
| 13 | 3300005578 | Ga0068854_100065160 | Ga0068854_1000651602 | 195 |
| 14 | 3300009093 | Ga0105240_10079154 | Ga0105240_100791543 | 195 |
| 15 | 3300009545 | Ga0105237_10017262 | Ga0105237_100172626 | 195 |
| 16 | 3300009551 | Ga0105238_10095943 | Ga0105238_100959432 | 195 |
| 17 | 3300013105 | Ga0157369_10026444 | Ga0157369_100264445 | 195 |
| 18 | 3300013307 | Ga0157372_10131190 | Ga0157372_101311902 | 195 |
| 19 | 3300025261 | Ga0209233_1001575 | Ga0209233_10015757 | 195 |
| 20 | 3300025909 | Ga0207705_10002388 | Ga0207705_1000238810 | 195 |
| 21 | 3300025912 | Ga0207707_10018246 | Ga0207707_100182462 | 195 |
| 22 | 3300025913 | Ga0207695_10064447 | Ga0207695_100644472 | 195 |
| 23 | 3300025919 | Ga0207657_10001554 | Ga0207657_1000155422 | 195 |
| 24 | 3300025921 | Ga0207652_10022218 | Ga0207652_100222182 | 195 |
| 25 | 3300025944 | Ga0207661_10040290 | Ga0207661_100402902 | 195 |
| 26 | 3300025949 | Ga0207667_10034192 | Ga0207667_100341922 | 195 |
| 27 | 3300025981 | Ga0207640_10013549 | Ga0207640_100135493 | 195 |
| 28 | 3300026041 | Ga0207639_10028132 | Ga0207639_100281322 | 195 |
| 29 | 3300026067 | Ga0207678_10001807 | Ga0207678_1000180716 | 195 |
| 30 | 3300026116 | Ga0207674_10001390 | Ga0207674_1000139024 | 195 |
| 31 | 3300047472 | Ga0495686_0000035 | Ga0495686_0000035_249227_249835 | 195 |
| 32 | 3300047472 | Ga0495686_0002787 | Ga0495686_0002787_3446_4099 | 195 |
| 33 | 3300047472 | Ga0495686_0007028 | Ga0495686_0007028_70_678 | 195 |
| 34 | 3300047472 | Ga0495686_0025520 | Ga0495686_0025520_936_1544 | 195 |
| 35 | 3300048929 | Ga0496126_0000042 | Ga0496126_0000042_1715_2323 | 195 |
| 36 | 3300003322 | rootL2_10108404 | rootL2_101084043 | 196 |
| 37 | 3300025903 | Ga0207680_10170150 | Ga0207680_101701501 | 196 |
| 38 | 3300046507 | Ga0495606_0042098 | Ga0495606_0042098_2029_2625 | 196 |
| 39 | 3300046522 | Ga0495643_0044157 | Ga0495643_0044157_1706_2302 | 196 |
| 40 | 3300046543 | Ga0495645_0131788 | Ga0495645_0131788_434_1081 | 196 |
| 41 | 3300046694 | Ga0495649_0176784 | Ga0495649_0176784_451_1047 | 196 |
| 42 | 3300047443 | Ga0495687_016849 | Ga0495687_016849_808_1404 | 196 |
| 43 | 3300005327 | Ga0070658_10000007 | Ga0070658_10000007220 | 197 |
| 44 | 3300005327 | Ga0070658_10079589 | Ga0070658_100795892 | 197 |
| 45 | 3300005327 | Ga0070658_10132797 | Ga0070658_101327972 | 197 |
| 46 | 3300005327 | Ga0070658_10178834 | Ga0070658_101788343 | 197 |
| 47 | 3300005339 | Ga0070660_100055675 | Ga0070660_1000556752 | 197 |
| 48 | 3300005366 | Ga0070659_100065273 | Ga0070659_1000652732 | 197 |
| 49 | 3300005539 | Ga0068853_100000027 | Ga0068853_10000002780 | 197 |
| 50 | 3300005548 | Ga0070665_100037855 | Ga0070665_1000378556 | 197 |
| 51 | 3300005548 | Ga0070665_100118195 | Ga0070665_1001181954 | 197 |
| 52 | 3300005563 | Ga0068855_100043770 | Ga0068855_1000437703 | 197 |
| 53 | 3300005614 | Ga0068856_100306233 | Ga0068856_1003062332 | 197 |
| 54 | 3300009177 | Ga0105248_10103260 | Ga0105248_101032603 | 197 |
| 55 | 3300013104 | Ga0157370_10181848 | Ga0157370_101818481 | 197 |
| 56 | 3300013105 | Ga0157369_10033542 | Ga0157369_100335422 | 197 |
| 57 | 3300025909 | Ga0207705_10000013 | Ga0207705_10000013155 | 197 |
| 58 | 3300025909 | Ga0207705_10044307 | Ga0207705_100443072 | 197 |
| 59 | 3300025909 | Ga0207705_10075419 | Ga0207705_100754192 | 197 |
| 60 | 3300025909 | Ga0207705_10430833 | Ga0207705_104308331 | 197 |
| 61 | 3300025919 | Ga0207657_10005268 | Ga0207657_100052682 | 197 |
| 62 | 3300025919 | Ga0207657_10207395 | Ga0207657_102073952 | 197 |
| 63 | 3300025932 | Ga0207690_10008299 | Ga0207690_100082992 | 197 |
| 64 | 3300025941 | Ga0207711_10111045 | Ga0207711_101110452 | 197 |
| 65 | 3300025949 | Ga0207667_10007958 | Ga0207667_100079582 | 197 |
| 66 | 3300025949 | Ga0207667_10018770 | Ga0207667_100187703 | 197 |
| 67 | 3300026041 | Ga0207639_10000036 | Ga0207639_10000036104 | 197 |
| 68 | 3300026067 | Ga0207678_10023375 | Ga0207678_100233753 | 197 |
| 69 | 3300026078 | Ga0207702_10224250 | Ga0207702_102242502 | 197 |
| 70 | 3300028379 | Ga0268266_10002041 | Ga0268266_1000204118 | 197 |
| 71 | 3300028800 | Ga0265338_10460983 | Ga0265338_104609831 | 197 |
| 72 | 3300033180 | Ga0307510_10096936 | Ga0307510_100969362 | 197 |
| 73 | 3300046660 | Ga0495625_0000276 | Ga0495625_0000276_48221_48823 | 197 |
| 74 | 3300047320 | Ga0495672_0002247 | Ga0495672_0002247_15211_15804 | 197 |
| 75 | 3300047472 | Ga0495686_0005939 | Ga0495686_0005939_6428_7036 | 197 |
| 76 | 3300048929 | Ga0496126_0000010 | Ga0496126_0000010_100387_101058 | 197 |
| 77 | 3300049460 | Ga0495682_0047545 | Ga0495682_0047545_198_860 | 197 |
| 78 | 3300049568 | Ga0501031_0139959 | Ga0501031_0139959_224_835 | 197 |
| 79 | 3300049569 | Ga0501032_0000563 | Ga0501032_0000563_591_1202 | 197 |
| 80 | 3300049571 | Ga0501034_0373203 | Ga0501034_0373203_508_1119 | 197 |
| 81 | 3300049572 | Ga0501036_0000595 | Ga0501036_0000595_24848_25459 | 197 |
| 82 | 3300049573 | Ga0501037_0009272 | Ga0501037_0009272_2722_3333 | 197 |
| 83 | 3300049574 | Ga0501038_0014533 | Ga0501038_0014533_751_1362 | 197 |
| 84 | 3300049575 | Ga0501039_0036028 | Ga0501039_0036028_2840_3451 | 197 |
| 85 | 3300049579 | Ga0501043_0007443 | Ga0501043_0007443_508_1119 | 197 |
| 86 | 3300049580 | Ga0501046_0000259 | Ga0501046_0000259_50362_50973 | 197 |
| 87 | 3300049581 | Ga0501047_0049024 | Ga0501047_0049024_38_649 | 197 |
| 88 | 3300049582 | Ga0501048_0367725 | Ga0501048_0367725_357_968 | 197 |
| 89 | 3300049584 | Ga0501068_0023172 | Ga0501068_0023172_778_1389 | 197 |
| 90 | 3300049586 | Ga0501070_0070655 | Ga0501070_0070655_523_1119 | 197 |
| 91 | 3300049589 | Ga0501073_0032948 | Ga0501073_0032948_1034_1645 | 197 |
| 92 | 3300049742 | Ga0501080_0707184 | Ga0501080_0707184_169_780 | 197 |
| 93 | 3300049822 | Ga0501035_0147720 | Ga0501035_0147720_448_1044 | 197 |
| 94 | 3300049823 | Ga0501044_0050534 | Ga0501044_0050534_1778_2437 | 197 |
| 95 | 3300049823 | Ga0501044_0075606 | Ga0501044_0075606_2020_2631 | 197 |
| 96 | 3300049823 | Ga0501044_0695519 | Ga0501044_0695519_124_720 | 197 |
| 97 | 3300005327 | Ga0070658_10157909 | Ga0070658_101579093 | 198 |
| 98 | 3300005337 | Ga0070682_100396077 | Ga0070682_1003960771 | 198 |
| 99 | 3300005355 | Ga0070671_100117989 | Ga0070671_1001179893 | 198 |
| 100 | 3300005455 | Ga0070663_100079177 | Ga0070663_1000791773 | 198 |
| 101 | 3300005458 | Ga0070681_10882990 | Ga0070681_108829901 | 198 |
| 102 | 3300005548 | Ga0070665_100030811 | Ga0070665_1000308111 | 198 |
| 103 | 3300005563 | Ga0068855_100052360 | Ga0068855_1000523604 | 198 |
| 104 | 3300005578 | Ga0068854_100000021 | Ga0068854_10000002155 | 198 |
| 105 | 3300005842 | Ga0068858_100044316 | Ga0068858_1000443162 | 198 |
| 106 | 3300009093 | Ga0105240_10174634 | Ga0105240_101746342 | 198 |
| 107 | 3300009093 | Ga0105240_10232922 | Ga0105240_102329222 | 198 |
| 108 | 3300009093 | Ga0105240_10373966 | Ga0105240_103739662 | 198 |
| 109 | 3300009093 | Ga0105240_10783252 | Ga0105240_107832521 | 198 |
| 110 | 3300009098 | Ga0105245_10558392 | Ga0105245_105583922 | 198 |
| 111 | 3300009177 | Ga0105248_10811412 | Ga0105248_108114121 | 198 |
| 112 | 3300009545 | Ga0105237_10144415 | Ga0105237_101444153 | 198 |
| 113 | 3300009551 | Ga0105238_10437761 | Ga0105238_104377612 | 198 |
| 114 | 3300013296 | Ga0157374_10181179 | Ga0157374_101811793 | 198 |
| 115 | 3300013296 | Ga0157374_10557855 | Ga0157374_105578552 | 198 |
| 116 | 3300013306 | Ga0163162_10002032 | Ga0163162_1000203210 | 198 |
| 117 | 3300013308 | Ga0157375_10973489 | Ga0157375_109734892 | 198 |
| 118 | 3300014325 | Ga0163163_10208876 | Ga0163163_102088763 | 198 |
| 119 | 3300014968 | Ga0157379_10159104 | Ga0157379_101591042 | 198 |
| 120 | 3300014968 | Ga0157379_10175079 | Ga0157379_101750792 | 198 |
| 121 | 3300014969 | Ga0157376_10136350 | Ga0157376_101363502 | 198 |
| 122 | 3300025909 | Ga0207705_10122848 | Ga0207705_101228482 | 198 |
| 123 | 3300025912 | Ga0207707_10748524 | Ga0207707_107485241 | 198 |
| 124 | 3300025913 | Ga0207695_10070182 | Ga0207695_100701821 | 198 |
| 125 | 3300025913 | Ga0207695_10292563 | Ga0207695_102925632 | 198 |
| 126 | 3300025914 | Ga0207671_10362674 | Ga0207671_103626741 | 198 |
| 127 | 3300025924 | Ga0207694_10011596 | Ga0207694_100115961 | 198 |
| 128 | 3300025931 | Ga0207644_10126607 | Ga0207644_101266073 | 198 |
| 129 | 3300025949 | Ga0207667_10286106 | Ga0207667_102861062 | 198 |
| 130 | 3300025981 | Ga0207640_10000007 | Ga0207640_10000007173 | 198 |
| 131 | 3300026035 | Ga0207703_10032234 | Ga0207703_100322342 | 198 |
| 132 | 3300026088 | Ga0207641_10254253 | Ga0207641_102542531 | 198 |
| 133 | 3300033180 | Ga0307510_10040393 | Ga0307510_100403935 | 198 |
| 134 | 3300033180 | Ga0307510_10096075 | Ga0307510_100960753 | 198 |
| 135 | 3300042876 | Ga0451577_0000290 | Ga0451577_0000290_7611_8246 | 198 |
| 136 | 3300044673 | Ga0453683_0067348 | Ga0453683_0067348_1326_1961 | 198 |
| 137 | 3300044673 | Ga0453683_0121270 | Ga0453683_0121270_933_1568 | 198 |
| 138 | 3300044712 | Ga0453684_0000104 | Ga0453684_0000104_362806_363441 | 198 |
| 139 | 3300045051 | Ga0451576_0013580 | Ga0451576_0013580_3292_3927 | 198 |
| 140 | 3300046459 | Ga0495629_0545622 | Ga0495629_0545622_104_703 | 198 |
| 141 | 3300046460 | Ga0495638_0296288 | Ga0495638_0296288_165_767 | 198 |
| 142 | 3300046462 | Ga0495651_0079552 | Ga0495651_0079552_239_838 | 198 |
| 143 | 3300046471 | Ga0495650_0000022 | Ga0495650_0000022_110307_110915 | 198 |
| 144 | 3300046472 | Ga0495580_0087072 | Ga0495580_0087072_519_1118 | 198 |
| 145 | 3300046475 | Ga0495639_0003332 | Ga0495639_0003332_5965_6564 | 198 |
| 146 | 3300046476 | Ga0495662_0033051 | Ga0495662_0033051_1339_1938 | 198 |
| 147 | 3300046477 | Ga0495664_0007697 | Ga0495664_0007697_2082_2681 | 198 |
| 148 | 3300046499 | Ga0495594_0001550 | Ga0495594_0001550_6087_6686 | 198 |
| 149 | 3300046499 | Ga0495594_0031242 | Ga0495594_0031242_1632_2240 | 198 |
| 150 | 3300046500 | Ga0495596_0050065 | Ga0495596_0050065_219_827 | 198 |
| 151 | 3300046506 | Ga0495583_0042874 | Ga0495583_0042874_390_989 | 198 |
| 152 | 3300046506 | Ga0495583_0114403 | Ga0495583_0114403_494_1090 | 198 |
| 153 | 3300046523 | Ga0495644_0000085 | Ga0495644_0000085_9110_9718 | 198 |
| 154 | 3300046528 | Ga0495642_0064479 | Ga0495642_0064479_312_920 | 198 |
| 155 | 3300046529 | Ga0495652_0246693 | Ga0495652_0246693_113_721 | 198 |
| 156 | 3300046533 | Ga0495640_0007805 | Ga0495640_0007805_6225_6824 | 198 |
| 157 | 3300046535 | Ga0495586_0008223 | Ga0495586_0008223_621_1220 | 198 |
| 158 | 3300046538 | Ga0495609_0022911 | Ga0495609_0022911_411_1019 | 198 |
| 159 | 3300046543 | Ga0495645_0015464 | Ga0495645_0015464_449_1048 | 198 |
| 160 | 3300046616 | Ga0495668_0090127 | Ga0495668_0090127_202_810 | 198 |
| 161 | 3300046642 | Ga0495634_0006074 | Ga0495634_0006074_4011_4610 | 198 |
| 162 | 3300046660 | Ga0495625_0047468 | Ga0495625_0047468_2400_2996 | 198 |
| 163 | 3300046660 | Ga0495625_0197476 | Ga0495625_0197476_123_743 | 198 |
| 164 | 3300046665 | Ga0495661_0029625 | Ga0495661_0029625_2404_3033 | 198 |
| 165 | 3300046674 | Ga0495588_0093408 | Ga0495588_0093408_19_627 | 198 |
| 166 | 3300046678 | Ga0495599_0061229 | Ga0495599_0061229_1214_1813 | 198 |
| 167 | 3300046679 | Ga0495623_0308997 | Ga0495623_0308997_29_628 | 198 |
| 168 | 3300046680 | Ga0495646_0002767 | Ga0495646_0002767_3793_4392 | 198 |
| 169 | 3300046684 | Ga0495669_0005400 | Ga0495669_0005400_1896_2504 | 198 |
| 170 | 3300046689 | Ga0495613_0004952 | Ga0495613_0004952_4470_5069 | 198 |
| 171 | 3300046691 | Ga0495670_0207671 | Ga0495670_0207671_60_668 | 198 |
| 172 | 3300046809 | Ga0495600_0002830 | Ga0495600_0002830_6223_6822 | 198 |
| 173 | 3300047319 | Ga0495674_0011508 | Ga0495674_0011508_5772_6371 | 198 |
| 174 | 3300047321 | Ga0495676_0002715 | Ga0495676_0002715_4143_4742 | 198 |
| 175 | 3300047322 | Ga0495680_0302821 | Ga0495680_0302821_185_784 | 198 |
| 176 | 3300048089 | Ga0495614_0000939 | Ga0495614_0000939_7481_8080 | 198 |
| 177 | 3300048907 | Ga0496104_0000076 | Ga0496104_0000076_35309_35926 | 198 |
| 178 | 3300048907 | Ga0496104_0138229 | Ga0496104_0138229_728_1336 | 198 |
| 179 | 3300048908 | Ga0496105_0143535 | Ga0496105_0143535_1069_1677 | 198 |
| 180 | 3300048915 | Ga0496112_0553872 | Ga0496112_0553872_146_748 | 198 |
| 181 | 3300048918 | Ga0496115_0106245 | Ga0496115_0106245_876_1484 | 198 |
| 182 | 3300048924 | Ga0496121_0146910 | Ga0496121_0146910_872_1468 | 198 |
| 183 | 3300048929 | Ga0496126_0000245 | Ga0496126_0000245_92224_92826 | 198 |
| 184 | 3300053093 | Ga0500651_0000005 | Ga0500651_0000005_288531_289133 | 198 |
| 185 | 3300053119 | Ga0500595_000004 | Ga0500595_000004_342182_342784 | 198 |
| 186 | 3300055283 | Ga0500661_002268 | Ga0500661_002268_427_1029 | 198 |
| 187 | 3300009093 | Ga0105240_11140558 | Ga0105240_111405581 | 199 |
| 188 | 3300013297 | Ga0157378_10084096 | Ga0157378_100840962 | 199 |
| 189 | 3300025913 | Ga0207695_10034523 | Ga0207695_100345234 | 199 |
| 190 | 3300028800 | Ga0265338_10007591 | Ga0265338_100075916 | 199 |
| 191 | 3300031249 | Ga0265339_10076518 | Ga0265339_100765182 | 199 |
| 192 | 3300031711 | Ga0265314_10019716 | Ga0265314_100197163 | 199 |
| 193 | 3300049581 | Ga0501047_0011353 | Ga0501047_0011353_3169_3858 | 199 |
| 194 | 3300005437 | Ga0070710_10630671 | Ga0070710_106306711 | 200 |
| 195 | 3300005983 | Ga0081540_1031181 | Ga0081540_10311813 | 200 |
| 196 | 3300013105 | Ga0157369_10332765 | Ga0157369_103327651 | 200 |
| 197 | 3300014969 | Ga0157376_10002633 | Ga0157376_100026339 | 200 |
| 198 | 3300021361 | Ga0213872_10123079 | Ga0213872_101230791 | 200 |
| 199 | 3300021441 | Ga0213871_10007466 | Ga0213871_100074662 | 200 |
| 200 | 3300021441 | Ga0213871_10019602 | Ga0213871_100196022 | 200 |
| 201 | 3300039438 | Ga0436360_0096904 | Ga0436360_0096904_971_1573 | 200 |
| 202 | 3300039438 | Ga0436360_0156801 | Ga0436360_0156801_31_633 | 200 |
| 203 | 3300039438 | Ga0436360_1014516 | Ga0436360_1014516_735_1337 | 200 |
| 204 | 3300039447 | Ga0436361_0398402 | Ga0436361_0398402_6057_6659 | 200 |
| 205 | 3300039447 | Ga0436361_0539690 | Ga0436361_0539690_1720_2322 | 200 |
| 206 | 3300046471 | Ga0495650_0010525 | Ga0495650_0010525_4235_4885 | 200 |
| 207 | 3300048929 | Ga0496126_0002019 | Ga0496126_0002019_10834_11436 | 200 |
| 208 | 3300005329 | Ga0070683_100652593 | Ga0070683_1006525932 | 201 |
| 209 | 3300006028 | Ga0070717_10287480 | Ga0070717_102874802 | 201 |
| 210 | 3300009177 | Ga0105248_11158878 | Ga0105248_111588782 | 201 |
| 211 | 3300014968 | Ga0157379_10037485 | Ga0157379_100374852 | 201 |
| 212 | 3300031235 | Ga0265330_10002227 | Ga0265330_1000222710 | 201 |
| 213 | 3300031241 | Ga0265325_10000859 | Ga0265325_1000085913 | 201 |
| 214 | 3300031595 | Ga0265313_10020841 | Ga0265313_100208412 | 201 |
| 215 | 3300031595 | Ga0265313_10025001 | Ga0265313_100250013 | 201 |
| 216 | 3300031595 | Ga0265313_10140895 | Ga0265313_101408952 | 201 |
| 217 | 3300031712 | Ga0265342_10010169 | Ga0265342_100101696 | 201 |
| 218 | 3300031712 | Ga0265342_10017781 | Ga0265342_100177813 | 201 |
| 219 | 3300035117 | Ga0373953_0212318 | Ga0373953_0212318_152_766 | 201 |
| 220 | 3300046536 | Ga0495587_0084862 | Ga0495587_0084862_1160_1774 | 201 |
| 221 | 3300048907 | Ga0496104_0621073 | Ga0496104_0621073_122_742 | 201 |
| 222 | 3300048918 | Ga0496115_0134595 | Ga0496115_0134595_1190_1810 | 201 |
| 223 | 3300000546 | LJNas_1000458 | LJNas_10004583 | 202 |
| 224 | 3300005327 | Ga0070658_10036319 | Ga0070658_100363194 | 202 |
| 225 | 3300005339 | Ga0070660_100128162 | Ga0070660_1001281623 | 202 |
| 226 | 3300005355 | Ga0070671_100080369 | Ga0070671_1000803693 | 202 |
| 227 | 3300005435 | Ga0070714_101562904 | Ga0070714_1015629041 | 202 |
| 228 | 3300005455 | Ga0070663_100165104 | Ga0070663_1001651042 | 202 |
| 229 | 3300005548 | Ga0070665_100018986 | Ga0070665_1000189863 | 202 |
| 230 | 3300005548 | Ga0070665_100173366 | Ga0070665_1001733662 | 202 |
| 231 | 3300005564 | Ga0070664_100610000 | Ga0070664_1006100001 | 202 |
| 232 | 3300005614 | Ga0068856_100049616 | Ga0068856_1000496164 | 202 |
| 233 | 3300009177 | Ga0105248_10000024 | Ga0105248_1000002452 | 202 |
| 234 | 3300009177 | Ga0105248_10006467 | Ga0105248_100064673 | 202 |
| 235 | 3300009177 | Ga0105248_10119787 | Ga0105248_101197873 | 202 |
| 236 | 3300013105 | Ga0157369_10026085 | Ga0157369_100260854 | 202 |
| 237 | 3300013296 | Ga0157374_10310703 | Ga0157374_103107032 | 202 |
| 238 | 3300013297 | Ga0157378_10369755 | Ga0157378_103697553 | 202 |
| 239 | 3300013306 | Ga0163162_10174241 | Ga0163162_101742414 | 202 |
| 240 | 3300014325 | Ga0163163_10013587 | Ga0163163_100135873 | 202 |
| 241 | 3300014969 | Ga0157376_10005999 | Ga0157376_100059998 | 202 |
| 242 | 3300025904 | Ga0207647_10018112 | Ga0207647_100181124 | 202 |
| 243 | 3300025909 | Ga0207705_10081348 | Ga0207705_100813483 | 202 |
| 244 | 3300025919 | Ga0207657_10529590 | Ga0207657_105295902 | 202 |
| 245 | 3300025931 | Ga0207644_10314382 | Ga0207644_103143821 | 202 |
| 246 | 3300025941 | Ga0207711_10000007 | Ga0207711_10000007393 | 202 |
| 247 | 3300025941 | Ga0207711_10000018 | Ga0207711_10000018113 | 202 |
| 248 | 3300025941 | Ga0207711_10043785 | Ga0207711_100437852 | 202 |
| 249 | 3300025945 | Ga0207679_10179567 | Ga0207679_101795671 | 202 |
| 250 | 3300026067 | Ga0207678_10269350 | Ga0207678_102693502 | 202 |
| 251 | 3300028379 | Ga0268266_10054103 | Ga0268266_100541031 | 202 |
| 252 | 3300028379 | Ga0268266_10065318 | Ga0268266_100653182 | 202 |
| 253 | 3300048904 | Ga0496101_0014816 | Ga0496101_0014816_3525_4133 | 202 |
| 254 | 3300048905 | Ga0496102_0048809 | Ga0496102_0048809_796_1404 | 202 |
| 255 | 3300048906 | Ga0496103_0095726 | Ga0496103_0095726_1124_1732 | 202 |
| 256 | 3300048907 | Ga0496104_0018863 | Ga0496104_0018863_5213_5821 | 202 |
| 257 | 3300048908 | Ga0496105_0070214 | Ga0496105_0070214_1176_1784 | 202 |
| 258 | 3300048911 | Ga0496108_0379438 | Ga0496108_0379438_573_1181 | 202 |
| 259 | 3300048912 | Ga0496109_0137061 | Ga0496109_0137061_105_713 | 202 |
| 260 | 3300048913 | Ga0496110_0104565 | Ga0496110_0104565_257_865 | 202 |
| 261 | 3300048914 | Ga0496111_0487755 | Ga0496111_0487755_191_799 | 202 |
| 262 | 3300048915 | Ga0496112_0037508 | Ga0496112_0037508_4042_4650 | 202 |
| 263 | 3300048916 | Ga0496113_0070242 | Ga0496113_0070242_71_679 | 202 |
| 264 | 3300048918 | Ga0496115_0131544 | Ga0496115_0131544_1258_1866 | 202 |
| 265 | 3300048923 | Ga0496120_0260333 | Ga0496120_0260333_25_633 | 202 |
| 266 | 3300048929 | Ga0496126_0037465 | Ga0496126_0037465_465_1073 | 202 |
| 267 | 3300053133 | Ga0500655_019675 | Ga0500655_019675_102_719 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hkl-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with inorganic phosphate | 0.9448 | 7 | 193 |
| 5hkf-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.939 | 6 | 192 |
| 5hki-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with fe(iii) dicitrate | 0.9361 | 7 | 192 |
| 5hkf-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis h37rv orotate phosphoribosyltransferase in complex with 5-phospho-alpha-d-ribosyl 1-diphosphate (prpp) | 0.9239 | 7 | 193 |
| 2p1z-assembly1.cif.gz_B | crystal structure of phosphoribosyltransferase from corynebacterium diphtheriae | 0.9227 | 6 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hkiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9361 | 7 | 192 | 3.40.50.2020 |
| 5hkiC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9149 | 7 | 192 | 3.40.50.2020 |
| af_G5EDZ2_3_216_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8848 | 2 | 192 | 3.40.50.2020 |
| af_Q58509_1_175_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8808 | 7 | 193 | 3.40.50.2020 |
| af_P09556_2_207_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.877 | 8 | 198 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5M8SXU7-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9932 | 7 | 198 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A2V9V9B0-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9925 | 7 | 198 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-E6QHS7-F1-model_v4 | orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9882 | 7 | 198 |
GO:0004588
GO:0019856 GO:0044205 |
| AF-A0A7Y5RI34-F1-model_v4 | Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) | 0.9788 | 7 | 198 |
GO:0000287
GO:0004588 GO:0019856 GO:0044205 |
| AF-A0A838NGI6-F1-model_v4 | orotate phosphoribosyltransferase (EC 2.4.2.10) | 0.9671 | 4 | 167 |
GO:0004588
GO:0019856 GO:0044205 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar