F374591

General Info

Members Datasets Scaffolds Average Seq Length
267 186 534 222

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100161315|Ga0070678_1001613152
Length 257
Sequence MVRPRFAAPNGPDDGAGAHCAPRKEGLVETFLLVLAALFPVVNPPGAGLIFLSMTRNASPQTRRSLARRVAVNAFFVMAVSLPVGALVLKIYGISIPVLRVAGGLIVAVAGWKLLNEGSPKTASDISPEGNKTDFADKAFYPLTLPLTTGPGTIAVMISLGLSRSAYSDVGQDLQFFVATLLATLVIALTIYLCFAYSDRVQRGLGIAGTDILVRLTAFILFCLGVQIVWTGASELLSTVVLQKSAMTCLSCHEALL

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 2643221734 Bosea sp. Root670 Isolate Unclassified
177 2738543024 Aminobacter sp. AP02 Isolate Unclassified
178 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
179 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
180 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
181 2842694124 Methylopila sp. R-72369 Isolate Unclassified
182 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
183 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
184 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
185 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
186 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.49
Nodule 0
Rhizoplane 3.37
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 26.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100161315 3300005456 Bacteria 1817
2 Ga0065712_10398410 3300005290 Unclassified 734
3 Ga0065707_10273631 3300005295 Unclassified 1065
4 Ga0070658_10012535 3300005327 Bacteria 6802
5 Ga0070658_10034170 3300005327 Bacteria 4091
6 Ga0070658_10426322 3300005327 Bacteria 1141
7 Ga0070683_100505927 3300005329 Bacteria 1154
8 Ga0070680_100141623 3300005336 Bacteria 2017
9 Ga0070680_100176142 3300005336 Bacteria 1800
10 Ga0070680_100229170 3300005336 Bacteria 1569
11 Ga0070680_100247674 3300005336 Bacteria 1506
12 Ga0070660_100043402 3300005339 Bacteria 3436
13 Ga0070660_100115935 3300005339 Bacteria 2136
14 Ga0070660_100504150 3300005339 Unclassified 1007
15 Ga0070692_10143306 3300005345 Unclassified 1354
16 Ga0070668_100427713 3300005347 Unclassified 1135
17 Ga0070668_100475218 3300005347 Unclassified 1078
18 Ga0070674_100268508 3300005356 Unclassified 1347
19 Ga0070659_100382622 3300005366 Bacteria 1185
20 Ga0070659_100630703 3300005366 Unclassified 923
21 Ga0070667_100258018 3300005367 Bacteria 1560
22 Ga0070667_100576028 3300005367 Bacteria 1036
23 Ga0070667_100687645 3300005367 Unclassified 946
24 Ga0070709_10424437 3300005434 Bacteria 997
25 Ga0070714_100024774 3300005435 Bacteria 4944
26 Ga0070713_100436426 3300005436 Bacteria 1228
27 Ga0070711_100119694 3300005439 Bacteria 1945
28 Ga0070705_100275686 3300005440 Unclassified 1193
29 Ga0070705_100420591 3300005440 Unclassified 995
30 Ga0070663_100265614 3300005455 Unclassified 1362
31 Ga0070662_100214576 3300005457 Bacteria 1533
32 Ga0070681_10050139 3300005458 Bacteria 4166
33 Ga0070679_100113939 3300005530 Bacteria 2689
34 Ga0070679_100162053 3300005530 Bacteria 2211
35 Ga0070679_100168363 3300005530 Bacteria 2164
36 Ga0070686_100305545 3300005544 Unclassified 1181
37 Ga0070695_100107491 3300005545 Bacteria 1888
38 Ga0070695_100263275 3300005545 Unclassified 1260
39 Ga0070696_100432915 3300005546 Unclassified 1035
40 Ga0068855_100000854 3300005563 Bacteria 37817
41 Ga0068855_100055124 3300005563 Bacteria 4670
42 Ga0068855_100077646 3300005563 Bacteria 3853
43 Ga0068855_100218493 3300005563 Bacteria 2138
44 Ga0068854_100086530 3300005578 Bacteria 2324
45 Ga0068856_100120039 3300005614 Bacteria 2631
46 Ga0068856_100942587 3300005614 Bacteria 882
47 Ga0070702_100140906 3300005615 Unclassified 1535
48 Ga0068852_100077261 3300005616 Bacteria 2942
49 Ga0068852_100163986 3300005616 Bacteria 2077
50 Ga0068859_101124433 3300005617 Unclassified 864
51 Ga0068861_100157578 3300005719 Unclassified 1869
52 Ga0068861_100430482 3300005719 Unclassified 1178
53 Ga0068860_100354057 3300005843 Unclassified 1445
54 Ga0068862_100218204 3300005844 Bacteria 1726
55 Ga0068862_100802497 3300005844 Unclassified 919
56 Ga0070717_10412855 3300006028 Bacteria 1214
57 Ga0075365_10001594 3300006038 Bacteria 10433
58 Ga0075365_10055231 3300006038 Bacteria 2635
59 Ga0075365_10595463 3300006038 Unclassified 782
60 Ga0075364_10015846 3300006051 Bacteria 4678
61 Ga0070712_100281092 3300006175 Bacteria 1341
62 Ga0075362_10140728 3300006177 Bacteria 1153
63 Ga0075367_10020614 3300006178 Bacteria 3674
64 Ga0075367_10079050 3300006178 Unclassified 1987
65 Ga0075370_10020818 3300006353 Bacteria 3588
66 Ga0075430_100378423 3300006846 Bacteria 1168
67 Ga0075431_100318629 3300006847 Bacteria 1568
68 Ga0075431_100571654 3300006847 Bacteria 1116
69 Ga0075434_100817570 3300006871 Unclassified 948
70 Ga0068865_100027405 3300006881 Bacteria 3764
71 Ga0068865_100169536 3300006881 Bacteria 1672
72 Ga0097620_101124397 3300006931 Unclassified 864
73 Ga0105240_10023270 3300009093 Bacteria 8199
74 Ga0105240_10379887 3300009093 Bacteria 1596
75 Ga0111539_10003293 3300009094 Bacteria 21343
76 Ga0111539_10268988 3300009094 Bacteria 1984
77 Ga0114129_10000124 3300009147 Bacteria 77871
78 Ga0114129_10370446 3300009147 Unclassified 1893
79 Ga0105243_10333426 3300009148 Bacteria 1387
80 Ga0105242_10393515 3300009176 Bacteria 1291
81 Ga0105249_10454968 3300009553 Bacteria 1319
82 Ga0105249_10528915 3300009553 Bacteria 1227
83 Ga0105239_10958537 3300010375 Bacteria 983
84 Ga0105246_10022297 3300011119 Unclassified 4084
85 Ga0105246_10039218 3300011119 Bacteria 3189
86 Ga0157371_10088777 3300013102 Bacteria 2189
87 Ga0157370_10200168 3300013104 Bacteria 1853
88 Ga0157370_10222056 3300013104 Bacteria 1750
89 Ga0157370_10376071 3300013104 Bacteria 1309
90 Ga0157369_10034282 3300013105 Bacteria 5572
91 Ga0157369_10545570 3300013105 Bacteria 1198
92 Ga0157374_10706963 3300013296 Bacteria 1021
93 Ga0157378_10176187 3300013297 Bacteria 2009
94 Ga0157378_10195309 3300013297 Bacteria 1911
95 Ga0157378_10454275 3300013297 Unclassified 1272
96 Ga0163162_10346750 3300013306 Bacteria 1618
97 Ga0163162_10865032 3300013306 Unclassified 1019
98 Ga0157372_10297090 3300013307 Bacteria 1879
99 Ga0157372_10635670 3300013307 Bacteria 1243
100 Ga0157375_10005983 3300013308 Bacteria 10611
101 Ga0157380_10044486 3300014326 Bacteria 3480
102 Ga0157380_11245692 3300014326 Unclassified 789
103 Ga0157376_10245432 3300014969 Bacteria 1670
104 Ga0157376_10394600 3300014969 Unclassified 1336
105 Ga0163161_10061211 3300017792 Bacteria 2740
106 Ga0213876_10029533 3300021384 Bacteria 2889
107 Ga0213876_10330663 3300021384 Unclassified 810
108 Ga0209148_1000501 3300025254 Bacteria 39942
109 Ga0209675_1000402 3300025291 Bacteria 35747
110 Ga0207688_10554935 3300025901 Unclassified 722
111 Ga0207647_10221099 3300025904 Bacteria 1091
112 Ga0207685_10123405 3300025905 Unclassified 1140
113 Ga0207645_10134001 3300025907 Unclassified 1613
114 Ga0207705_10062971 3300025909 Bacteria 2679
115 Ga0207707_10030730 3300025912 Bacteria 4698
116 Ga0207707_10062812 3300025912 Bacteria 3232
117 Ga0207707_10549288 3300025912 Bacteria 981
118 Ga0207695_10061422 3300025913 Bacteria 3884
119 Ga0207693_10181694 3300025915 Bacteria 1655
120 Ga0207663_10624834 3300025916 Unclassified 848
121 Ga0207660_10044023 3300025917 Bacteria 3139
122 Ga0207660_10451772 3300025917 Bacteria 1039
123 Ga0207657_10035729 3300025919 Bacteria 4453
124 Ga0207657_10444925 3300025919 Unclassified 1017
125 Ga0207652_10148222 3300025921 Bacteria 2100
126 Ga0207652_10273966 3300025921 Bacteria 1522
127 Ga0207694_10014415 3300025924 Bacteria 5958
128 Ga0207659_10116718 3300025926 Bacteria 2038
129 Ga0207700_10313685 3300025928 Bacteria 1357
130 Ga0207664_10135531 3300025929 Bacteria 2077
131 Ga0207706_10300364 3300025933 Unclassified 1399
132 Ga0207686_10278816 3300025934 Bacteria 1233
133 Ga0207669_10216656 3300025937 Unclassified 1402
134 Ga0207704_10173329 3300025938 Unclassified 1550
135 Ga0207704_10364626 3300025938 Unclassified 1129
136 Ga0207691_10248327 3300025940 Unclassified 1537
137 Ga0207667_10002571 3300025949 Bacteria 22570
138 Ga0207667_10194187 3300025949 Bacteria 2083
139 Ga0207667_10409362 3300025949 Bacteria 1380
140 Ga0207667_10920445 3300025949 Bacteria 865
141 Ga0207668_10359650 3300025972 Unclassified 1219
142 Ga0207668_10416079 3300025972 Unclassified 1140
143 Ga0207640_11117529 3300025981 Unclassified 698
144 Ga0207702_10553847 3300026078 Bacteria 1125
145 Ga0207702_10716639 3300026078 Bacteria 986
146 Ga0207674_10312518 3300026116 Bacteria 1521
147 Ga0207675_100066881 3300026118 Bacteria 3359
148 Ga0207675_100193538 3300026118 Unclassified 1951
149 Ga0207683_10059985 3300026121 Bacteria 3343
150 Ga0207698_10068069 3300026142 Bacteria 2810
151 Ga0207698_10149029 3300026142 Bacteria 2028
152 Ga0207428_10305628 3300027907 Bacteria 1176
153 Ga0268264_10475698 3300028381 Unclassified 1214
154 Ga0265330_10075735 3300031235 Bacteria 1453
155 Ga0265328_10021344 3300031239 Bacteria 2471
156 Ga0265327_10000665 3300031251 Bacteria 55138
157 Ga0265316_10009516 3300031344 Bacteria 8945
158 Ga0265313_10024700 3300031595 Bacteria 3204
159 Ga0265342_10001367 3300031712 Bacteria 22821
160 Ga0373936_0192371 3300035113 Unclassified 898
161 Ga0373954_0180346 3300035118 Bacteria 1036
162 Ga0373943_0012314 3300035170 Bacteria 3848
163 Ga0373946_0006761 3300035171 Bacteria 4167
164 Ga0373935_0014776 3300035692 Bacteria 4713
165 Ga0373933_0531099 3300035724 Unclassified 771
166 Ga0373947_0009212 3300035725 Bacteria 5674
167 Ga0373947_0170833 3300035725 Bacteria 1410
168 Ga0373947_0400572 3300035725 Bacteria 926
169 Ga0373937_0104419 3300036401 Unclassified 2633
170 Ga0373925_0006604 3300037068 Bacteria 8522
171 Ga0373925_0134222 3300037068 Bacteria 1933
172 Ga0395899_0002676 3300037312 Bacteria 14366
173 Ga0395900_0000709 3300037418 Bacteria 44342
174 Ga0395900_0257998 3300037418 Unclassified 1742
175 Ga0395898_0009588 3300037466 Bacteria 10168
176 Ga0436364_0869782 3300037853 Bacteria 2407
177 Ga0395901_0923107 3300038443 Unclassified 853
178 Ga0436365_0449211 3300039437 Bacteria 3593
179 Ga0436365_0863611 3300039437 Unclassified 1262
180 Ga0436362_0477826 3300039453 Bacteria 1227
181 Ga0451577_0197482 3300042876 Bacteria 1816
182 Ga0453683_0004209 3300044673 Bacteria 10289
183 Ga0453684_0010465 3300044712 Bacteria 15853
184 Ga0466959_0319423 3300045049 Bacteria 1062
185 Ga0451576_0001185 3300045051 Bacteria 46719
186 Ga0451576_0141925 3300045051 Bacteria 2504
187 Ga0451576_0147384 3300045051 Bacteria 2454
188 Ga0451576_0461213 3300045051 Bacteria 1334
189 Ga0495580_0016626 3300046472 Bacteria 5519
190 Ga0495582_0020193 3300046473 Bacteria 3645
191 Ga0495585_0142581 3300046492 Bacteria 1254
192 Ga0495587_0132321 3300046536 Unclassified 1425
193 Ga0495667_0127489 3300046559 Bacteria 1642
194 Ga0495658_0001679 3300046683 Bacteria 11517
195 Ga0495581_0038381 3300047315 Bacteria 2772
196 Ga0496101_0189142 3300048904 Bacteria 1588
197 Ga0496101_0495583 3300048904 Unclassified 965
198 Ga0496102_0334605 3300048905 Unclassified 1426
199 Ga0496103_0346771 3300048906 Unclassified 955
200 Ga0496111_0508166 3300048914 Unclassified 887
201 Ga0496114_0226272 3300048917 Bacteria 1643
202 Ga0496114_0320175 3300048917 Unclassified 1370
203 Ga0496124_0043928 3300048927 Bacteria 3838
204 Ga0496124_0212528 3300048927 Bacteria 1462
205 Ga0501039_0135427 3300049575 Bacteria 1934
206 Ga0501040_0337272 3300049576 Unclassified 1079
207 Ga0501041_0126208 3300049577 Bacteria 1593
208 Ga0501041_0348280 3300049577 Unclassified 936
209 Ga0501042_0228562 3300049578 Bacteria 1342
210 Ga0501042_0409751 3300049578 Unclassified 982
211 Ga0501047_0086743 3300049581 Bacteria 3007
212 Ga0501047_0149380 3300049581 Bacteria 2213
213 Ga0501068_0108088 3300049584 Unclassified 1728
214 Ga0501069_0014107 3300049585 Bacteria 4266
215 Ga0501070_0019395 3300049586 Bacteria 5701
216 Ga0501070_0022541 3300049586 Bacteria 5275
217 Ga0501070_0340769 3300049586 Bacteria 1218
218 Ga0501070_0407734 3300049586 Unclassified 1099
219 Ga0501071_0353587 3300049587 Bacteria 1118
220 Ga0501072_0280171 3300049588 Unclassified 1326
221 Ga0501073_0072219 3300049589 Bacteria 2403
222 Ga0501073_0163267 3300049589 Bacteria 1543
223 Ga0501074_0120469 3300049590 Bacteria 1876
224 Ga0501074_0230090 3300049590 Bacteria 1320
225 Ga0501075_0027710 3300049591 Bacteria 4176
226 Ga0501075_0037180 3300049591 Bacteria 3636
227 Ga0501076_0072321 3300049592 Bacteria 2760
228 Ga0501079_0003677 3300049741 Bacteria 11302
229 Ga0501079_0307614 3300049741 Bacteria 1240
230 Ga0501080_0086459 3300049742 Bacteria 2913
231 Ga0501081_0171373 3300049743 Bacteria 1567
232 Ga0501081_0315197 3300049743 Bacteria 1149
233 Ga0501035_0000418 3300049822 Bacteria 47993
234 Ga0501044_0053404 3300049823 Bacteria 4158
235 Ga0501045_0505075 3300049824 Bacteria 898
236 Ga0501045_0537960 3300049824 Bacteria 867
237 nmdc:mga03683_289446_c1 3300050489 Bacteria 766
238 nmdc:mga00v17_77721_c1 3300050491 Unclassified 2067
239 nmdc:mga0yw44_4159_c1 3300050492 Bacteria 6576
240 nmdc:mga0yw44_498167_c1 3300050492 Unclassified 826
241 nmdc:mga0k408_191546_c1 3300050493 Bacteria 1220
242 nmdc:mga06z11_54712_c1 3300050494 Unclassified 2058
243 nmdc:mga07m45_69949_c1 3300050496 Bacteria 1996
244 nmdc:mga05p37_772212_c1 3300050507 Unclassified 1056
245 nmdc:mga0qj67_139257_c1 3300050509 Bacteria 1967
246 nmdc:mga06r32_355645_c1 3300050510 Bacteria 1449
247 nmdc:mga06r32_558734_c1 3300050510 Bacteria 1118
248 nmdc:mga08y16_238515_c1 3300050511 Bacteria 1880
249 nmdc:mga0n895_921982_c1 3300050512 Unclassified 858
250 Ga0495601_0002135 3300053077 Bacteria 11127
251 Ga0500641_0027479 3300053096 Bacteria 2215
252 Ga0500568_0120667 3300053139 Unclassified 977
253 Ga0500622_0229122 3300053156 Bacteria 828
254 Ga0501084_0595228 3300054114 Unclassified 934
255 Ga0501082_0050956 3300060353 Bacteria 3569
256 Ga0501082_0068546 3300060353 Bacteria 3054
257 2644737693 2643221734 Bacteria 5365412
258 2739309423 2738543024 Bacteria 5603683
259 2765468933 2765235802 Bacteria 5618596
260 2770197264 2767802442 Bacteria 5747986
261 2840764805 2840764183 Bacteria 6358399
262 2842697465 2842694124 Bacteria 4063419
263 2883294753 2883291878 Bacteria 5894118
264 2883356766 2883354860 Bacteria 5865246
265 2894774360 2894772417 Bacteria 5305674
266 2894821432 2894817345 Bacteria 4892941
267 8046771632 8046767195 Bacteria 7547379
268 Ga0070678_100161315
269 Ga0065712_10398410
270 Ga0065707_10273631
271 Ga0070658_10012535
272 Ga0070658_10034170
273 Ga0070658_10426322
274 Ga0070683_100505927
275 Ga0070680_100141623
276 Ga0070680_100176142
277 Ga0070680_100229170
278 Ga0070680_100247674
279 Ga0070660_100043402
280 Ga0070660_100115935
281 Ga0070660_100504150
282 Ga0070692_10143306
283 Ga0070668_100427713
284 Ga0070668_100475218
285 Ga0070674_100268508
286 Ga0070659_100382622
287 Ga0070659_100630703
288 Ga0070667_100258018
289 Ga0070667_100576028
290 Ga0070667_100687645
291 Ga0070709_10424437
292 Ga0070714_100024774
293 Ga0070713_100436426
294 Ga0070711_100119694
295 Ga0070705_100275686
296 Ga0070705_100420591
297 Ga0070663_100265614
298 Ga0070662_100214576
299 Ga0070681_10050139
300 Ga0070679_100113939
301 Ga0070679_100162053
302 Ga0070679_100168363
303 Ga0070686_100305545
304 Ga0070695_100107491
305 Ga0070695_100263275
306 Ga0070696_100432915
307 Ga0068855_100000854
308 Ga0068855_100055124
309 Ga0068855_100077646
310 Ga0068855_100218493
311 Ga0068854_100086530
312 Ga0068856_100120039
313 Ga0068856_100942587
314 Ga0070702_100140906
315 Ga0068852_100077261
316 Ga0068852_100163986
317 Ga0068859_101124433
318 Ga0068861_100157578
319 Ga0068861_100430482
320 Ga0068860_100354057
321 Ga0068862_100218204
322 Ga0068862_100802497
323 Ga0070717_10412855
324 Ga0075365_10001594
325 Ga0075365_10055231
326 Ga0075365_10595463
327 Ga0075364_10015846
328 Ga0070712_100281092
329 Ga0075362_10140728
330 Ga0075367_10020614
331 Ga0075367_10079050
332 Ga0075370_10020818
333 Ga0075430_100378423
334 Ga0075431_100318629
335 Ga0075431_100571654
336 Ga0075434_100817570
337 Ga0068865_100027405
338 Ga0068865_100169536
339 Ga0097620_101124397
340 Ga0105240_10023270
341 Ga0105240_10379887
342 Ga0111539_10003293
343 Ga0111539_10268988
344 Ga0114129_10000124
345 Ga0114129_10370446
346 Ga0105243_10333426
347 Ga0105242_10393515
348 Ga0105249_10454968
349 Ga0105249_10528915
350 Ga0105239_10958537
351 Ga0105246_10022297
352 Ga0105246_10039218
353 Ga0157371_10088777
354 Ga0157370_10200168
355 Ga0157370_10222056
356 Ga0157370_10376071
357 Ga0157369_10034282
358 Ga0157369_10545570
359 Ga0157374_10706963
360 Ga0157378_10176187
361 Ga0157378_10195309
362 Ga0157378_10454275
363 Ga0163162_10346750
364 Ga0163162_10865032
365 Ga0157372_10297090
366 Ga0157372_10635670
367 Ga0157375_10005983
368 Ga0157380_10044486
369 Ga0157380_11245692
370 Ga0157376_10245432
371 Ga0157376_10394600
372 Ga0163161_10061211
373 Ga0213876_10029533
374 Ga0213876_10330663
375 Ga0209148_1000501
376 Ga0209675_1000402
377 Ga0207688_10554935
378 Ga0207647_10221099
379 Ga0207685_10123405
380 Ga0207645_10134001
381 Ga0207705_10062971
382 Ga0207707_10030730
383 Ga0207707_10062812
384 Ga0207707_10549288
385 Ga0207695_10061422
386 Ga0207693_10181694
387 Ga0207663_10624834
388 Ga0207660_10044023
389 Ga0207660_10451772
390 Ga0207657_10035729
391 Ga0207657_10444925
392 Ga0207652_10148222
393 Ga0207652_10273966
394 Ga0207694_10014415
395 Ga0207659_10116718
396 Ga0207700_10313685
397 Ga0207664_10135531
398 Ga0207706_10300364
399 Ga0207686_10278816
400 Ga0207669_10216656
401 Ga0207704_10173329
402 Ga0207704_10364626
403 Ga0207691_10248327
404 Ga0207667_10002571
405 Ga0207667_10194187
406 Ga0207667_10409362
407 Ga0207667_10920445
408 Ga0207668_10359650
409 Ga0207668_10416079
410 Ga0207640_11117529
411 Ga0207702_10553847
412 Ga0207702_10716639
413 Ga0207674_10312518
414 Ga0207675_100066881
415 Ga0207675_100193538
416 Ga0207683_10059985
417 Ga0207698_10068069
418 Ga0207698_10149029
419 Ga0207428_10305628
420 Ga0268264_10475698
421 Ga0265330_10075735
422 Ga0265328_10021344
423 Ga0265327_10000665
424 Ga0265316_10009516
425 Ga0265313_10024700
426 Ga0265342_10001367
427 Ga0373936_0192371
428 Ga0373954_0180346
429 Ga0373943_0012314
430 Ga0373946_0006761
431 Ga0373935_0014776
432 Ga0373933_0531099
433 Ga0373947_0009212
434 Ga0373947_0170833
435 Ga0373947_0400572
436 Ga0373937_0104419
437 Ga0373925_0006604
438 Ga0373925_0134222
439 Ga0395899_0002676
440 Ga0395900_0000709
441 Ga0395900_0257998
442 Ga0395898_0009588
443 Ga0436364_0869782
444 Ga0395901_0923107
445 Ga0436365_0449211
446 Ga0436365_0863611
447 Ga0436362_0477826
448 Ga0451577_0197482
449 Ga0453683_0004209
450 Ga0453684_0010465
451 Ga0466959_0319423
452 Ga0451576_0001185
453 Ga0451576_0141925
454 Ga0451576_0147384
455 Ga0451576_0461213
456 Ga0495580_0016626
457 Ga0495582_0020193
458 Ga0495585_0142581
459 Ga0495587_0132321
460 Ga0495667_0127489
461 Ga0495658_0001679
462 Ga0495581_0038381
463 Ga0496101_0189142
464 Ga0496101_0495583
465 Ga0496102_0334605
466 Ga0496103_0346771
467 Ga0496111_0508166
468 Ga0496114_0226272
469 Ga0496114_0320175
470 Ga0496124_0043928
471 Ga0496124_0212528
472 Ga0501039_0135427
473 Ga0501040_0337272
474 Ga0501041_0126208
475 Ga0501041_0348280
476 Ga0501042_0228562
477 Ga0501042_0409751
478 Ga0501047_0086743
479 Ga0501047_0149380
480 Ga0501068_0108088
481 Ga0501069_0014107
482 Ga0501070_0019395
483 Ga0501070_0022541
484 Ga0501070_0340769
485 Ga0501070_0407734
486 Ga0501071_0353587
487 Ga0501072_0280171
488 Ga0501073_0072219
489 Ga0501073_0163267
490 Ga0501074_0120469
491 Ga0501074_0230090
492 Ga0501075_0027710
493 Ga0501075_0037180
494 Ga0501076_0072321
495 Ga0501079_0003677
496 Ga0501079_0307614
497 Ga0501080_0086459
498 Ga0501081_0171373
499 Ga0501081_0315197
500 Ga0501035_0000418
501 Ga0501044_0053404
502 Ga0501045_0505075
503 Ga0501045_0537960
504 nmdc:mga03683_289446_c1
505 nmdc:mga00v17_77721_c1
506 nmdc:mga0yw44_4159_c1
507 nmdc:mga0yw44_498167_c1
508 nmdc:mga0k408_191546_c1
509 nmdc:mga06z11_54712_c1
510 nmdc:mga07m45_69949_c1
511 nmdc:mga05p37_772212_c1
512 nmdc:mga0qj67_139257_c1
513 nmdc:mga06r32_355645_c1
514 nmdc:mga06r32_558734_c1
515 nmdc:mga08y16_238515_c1
516 nmdc:mga0n895_921982_c1
517 Ga0495601_0002135
518 Ga0500641_0027479
519 Ga0500568_0120667
520 Ga0500622_0229122
521 Ga0501084_0595228
522 Ga0501082_0050956
523 Ga0501082_0068546
524 2644737693
525 2739309423
526 2765468933
527 2770197264
528 2840764805
529 2842697465
530 2883294753
531 2883356766
532 2894774360
533 2894821432
534 8046771632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01914

MarC

MarC family integral membrane protein

28

237

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvp-assembly1.cif.gz_A solution structure of the r10 domain of talin 0.5288 72 194
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.5119 4 189
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.5063 2 189
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.4871 2 189
4xni-assembly1.cif.gz_A x-ray structure of peptst1 0.4796 4 194
ID Description Score Start End Superfamily
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5875 1 192 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5825 40 188 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5685 40 188 1.20.1250.20
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5578 1 192 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5476 5 192 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A193GEN1-F1-model_v4 UPF0056 membrane protein 0.8686 5 200 GO:0005886
AF-A0A170Q5T9-F1-model_v4 deleted 0.8645 2 200
AF-A0A6J5DBR6-F1-model_v4 UPF0056 membrane protein 0.8623 2 204 GO:0005886
AF-A2WF93-F1-model_v4 deleted 0.8609 2 197
AF-A0A0Q6QVL9-F1-model_v4 UPF0056 membrane protein 0.8607 1 204 GO:0005886

Map