F374357

General Info

Members Datasets Scaffolds Average Seq Length
266 130 532 163

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0123353|Ga0501070_0123353_1556_2131
Length 191
Sequence MGSCCHARQAAYRPKARQPIYAATMTALSESARDLPLTTIDGQPSSLRAFDGKALLIVNVASRCGLAPQYEKLEELQKTYSDRGFAVLGFPSNQFLQELGSEDAIKQYCSTTWGVTFPMFERVKVNGKSAHPLYQELKKTPDASGKAGRVQWNFEKFLVSPDRAVQRFRPRTEPDAPEVISAIETALPAAA

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
10 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
11 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
12 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
13 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
14 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
15 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
16 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
18 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
19 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
20 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
21 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
22 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
23 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
24 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
25 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
26 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
27 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
28 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
31 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
32 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
33 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
34 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
35 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
36 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
37 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
38 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
39 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
40 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
41 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
42 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
43 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
44 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
45 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
46 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
47 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
48 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
49 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
50 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
51 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
52 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
53 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
54 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
55 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
56 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
57 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
58 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
75 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
90 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
91 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
92 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
93 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
94 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
97 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
98 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
99 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
100 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
103 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
104 2643221546 Microbacterium sp. Root53 Isolate Unclassified
105 2643221553 Microbacterium sp. Root553 Isolate Unclassified
106 2643221630 Microbacterium sp. Root322 Isolate Unclassified
107 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
108 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
109 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
110 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
111 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
112 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
113 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
114 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
115 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
116 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
117 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
118 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
119 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
120 2919395869 Microbacterium resistens 2980 Isolate Unclassified
121 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
122 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
123 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
124 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
125 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
126 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
127 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
128 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
129 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
130 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.97
Metatranscriptomes 1.5
Isolates 10.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 1.88
Rhizosphere 67.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0123353 3300049586 Bacteria 2141
2 JGI25154J39366_1002943 3300002738 Bacteria 3920
3 Ga0007427J51700_100443 3300003559 Bacteria 1890
4 Ga0006781J51513_1001570 3300003568 Bacteria 1322
5 Ga0006780_1005142 3300003735 Bacteria 1923
6 Ga0070687_100686909 3300005343 Bacteria 713
7 Ga0070665_100196402 3300005548 Bacteria 2019
8 Ga0075368_10061598 3300006042 Bacteria 1503
9 Ga0075364_10012084 3300006051 Bacteria 5270
10 Ga0075364_10313613 3300006051 Bacteria 1068
11 Ga0075369_10023371 3300006186 Bacteria 2555
12 Ga0105247_10437619 3300009101 Bacteria 940
13 Ga0157371_10054635 3300013102 Bacteria 2835
14 Ga0157370_10511068 3300013104 Bacteria 1103
15 Ga0157380_10353325 3300014326 Bacteria 1376
16 Ga0209646_1000071 3300025246 Bacteria 228702
17 Ga0268266_10205762 3300028379 Bacteria 1803
18 Ga0307413_10717978 3300031824 Bacteria 832
19 Ga0307406_10000833 3300031901 Bacteria 17322
20 Ga0307406_10017923 3300031901 Bacteria 4131
21 Ga0307406_10067004 3300031901 Bacteria 2339
22 Ga0307414_10031186 3300032004 Bacteria 3493
23 Ga0307414_10140646 3300032004 Bacteria 1889
24 Ga0307414_10249686 3300032004 Bacteria 1474
25 Ga0395899_0009007 3300037312 Bacteria 7672
26 Ga0395898_0003231 3300037466 Bacteria 18309
27 Ga0395898_0011523 3300037466 Bacteria 9181
28 Ga0395901_0079931 3300038443 Bacteria 3413
29 Ga0451791_0299855 3300041451 Bacteria 826
30 Ga0451793_0108948 3300041452 Bacteria 656
31 Ga0451793_1413562 3300041452 Bacteria 872
32 Ga0451797_0303284 3300041453 Bacteria 819
33 Ga0451833_0605919 3300041491 Bacteria 1462
34 Ga0451841_0056327 3300041498 Bacteria 1606
35 Ga0451841_0391712 3300041498 Bacteria 694
36 Ga0451847_0257588 3300041503 Bacteria 649
37 Ga0451853_3421444 3300041512 Bacteria 1299
38 Ga0451853_3701324 3300041512 Bacteria 612
39 Ga0466965_0514373 3300044683 Bacteria 673
40 Ga0466964_0079139 3300044706 Bacteria 1407
41 Ga0466968_0046114 3300044735 Bacteria 1851
42 Ga0466970_0000885 3300044765 Bacteria 14433
43 Ga0466970_0062141 3300044765 Bacteria 2002
44 Ga0466960_0235056 3300044901 Bacteria 1013
45 Ga0466958_0174967 3300045836 Bacteria 1360
46 Ga0466967_0104364 3300045976 Bacteria 2595
47 Ga0495627_003056 3300046453 Bacteria 7624
48 Ga0495650_0060851 3300046471 Bacteria 1515
49 Ga0495650_0107600 3300046471 Bacteria 1039
50 Ga0495620_0046874 3300046515 Bacteria 1864
51 Ga0495643_0205898 3300046522 Bacteria 942
52 Ga0495598_0285308 3300046537 Bacteria 621
53 Ga0495625_0798457 3300046660 Bacteria 549
54 Ga0495649_0124304 3300046694 Bacteria 1363
55 Ga0495672_0006206 3300047320 Bacteria 9320
56 Ga0495615_0090425 3300048090 Bacteria 852
57 Ga0495626_0132267 3300048091 Bacteria 1064
58 Ga0496105_0085934 3300048908 Bacteria 2600
59 Ga0496116_0036708 3300048919 Bacteria 3425
60 Ga0496117_0000603 3300048920 Bacteria 58910
61 Ga0496117_0001321 3300048920 Bacteria 36462
62 Ga0496117_0021815 3300048920 Bacteria 5164
63 Ga0496117_0026081 3300048920 Bacteria 4579
64 Ga0496117_0326315 3300048920 Bacteria 802
65 Ga0496117_0502461 3300048920 Bacteria 587
66 Ga0496118_0000610 3300048921 Bacteria 58893
67 Ga0496118_0004020 3300048921 Bacteria 17887
68 Ga0496118_0020829 3300048921 Bacteria 5801
69 Ga0496118_0125287 3300048921 Bacteria 1664
70 Ga0496119_0014544 3300048922 Bacteria 6143
71 Ga0496119_0037113 3300048922 Bacteria 3170
72 Ga0496119_0115735 3300048922 Bacteria 1481
73 Ga0496120_0005583 3300048923 Bacteria 9984
74 Ga0496120_0033227 3300048923 Bacteria 3101
75 Ga0496122_0000030 3300048925 Bacteria 331586
76 Ga0496122_0003787 3300048925 Bacteria 19492
77 Ga0496122_0007477 3300048925 Bacteria 12125
78 Ga0496122_0053246 3300048925 Bacteria 3053
79 Ga0496122_0168546 3300048925 Bacteria 1324
80 Ga0496122_0186181 3300048925 Bacteria 1231
81 Ga0496122_0251935 3300048925 Bacteria 987
82 Ga0496123_0000024 3300048926 Bacteria 331587
83 Ga0496123_0004981 3300048926 Bacteria 13608
84 Ga0496123_0043494 3300048926 Bacteria 3084
85 Ga0496124_0000135 3300048927 Bacteria 152458
86 Ga0496124_0035177 3300048927 Bacteria 4385
87 Ga0496124_0036980 3300048927 Bacteria 4250
88 Ga0496124_0094219 3300048927 Bacteria 2435
89 Ga0496124_0097522 3300048927 Bacteria 2386
90 Ga0496124_0193869 3300048927 Bacteria 1552
91 Ga0496124_0261717 3300048927 Bacteria 1272
92 Ga0496125_0003878 3300048928 Bacteria 17678
93 Ga0496125_0013003 3300048928 Bacteria 8215
94 Ga0496125_0029220 3300048928 Bacteria 4958
95 Ga0496125_0088626 3300048928 Bacteria 2331
96 Ga0496125_0276531 3300048928 Bacteria 1043
97 Ga0496126_0022032 3300048929 Bacteria 6208
98 Ga0496126_0062259 3300048929 Bacteria 3349
99 Ga0496126_0124083 3300048929 Bacteria 2236
100 Ga0496126_0469511 3300048929 Bacteria 1010
101 Ga0501031_0003972 3300049568 Bacteria 9530
102 Ga0501031_0010463 3300049568 Bacteria 6042
103 Ga0501031_0277919 3300049568 Bacteria 1087
104 Ga0501032_0010022 3300049569 Bacteria 6840
105 Ga0501032_0027646 3300049569 Bacteria 3898
106 Ga0501032_0268998 3300049569 Bacteria 1104
107 Ga0501033_0007078 3300049570 Bacteria 8758
108 Ga0501033_0012624 3300049570 Bacteria 6448
109 Ga0501033_0026266 3300049570 Bacteria 4383
110 Ga0501034_0001058 3300049571 Bacteria 39041
111 Ga0501034_0012883 3300049571 Bacteria 8624
112 Ga0501034_0019588 3300049571 Bacteria 6918
113 Ga0501034_0033302 3300049571 Bacteria 5229
114 Ga0501034_0037614 3300049571 Bacteria 4901
115 Ga0501034_0071076 3300049571 Bacteria 3490
116 Ga0501034_0075401 3300049571 Bacteria 3380
117 Ga0501036_0013274 3300049572 Bacteria 6839
118 Ga0501036_0043599 3300049572 Bacteria 3799
119 Ga0501036_0048269 3300049572 Bacteria 3604
120 Ga0501036_0052832 3300049572 Bacteria 3441
121 Ga0501037_0014385 3300049573 Bacteria 5824
122 Ga0501037_0014602 3300049573 Bacteria 5779
123 Ga0501037_0018512 3300049573 Bacteria 5133
124 Ga0501037_0054994 3300049573 Bacteria 2911
125 Ga0501038_0022798 3300049574 Bacteria 5604
126 Ga0501038_0031422 3300049574 Bacteria 4693
127 Ga0501038_0045687 3300049574 Bacteria 3800
128 Ga0501038_0048942 3300049574 Bacteria 3656
129 Ga0501038_0050562 3300049574 Bacteria 3590
130 Ga0501038_0140241 3300049574 Bacteria 1978
131 Ga0501039_0002561 3300049575 Bacteria 13563
132 Ga0501039_0015514 3300049575 Bacteria 5831
133 Ga0501039_0318208 3300049575 Bacteria 1223
134 Ga0501039_0455150 3300049575 Bacteria 1005
135 Ga0501039_0740529 3300049575 Bacteria 768
136 Ga0501039_1249252 3300049575 Bacteria 574
137 Ga0501040_0006625 3300049576 Bacteria 7517
138 Ga0501040_0068212 3300049576 Bacteria 2453
139 Ga0501041_0003420 3300049577 Bacteria 9133
140 Ga0501041_0187768 3300049577 Bacteria 1294
141 Ga0501041_0241989 3300049577 Bacteria 1134
142 Ga0501042_0054084 3300049578 Bacteria 2864
143 Ga0501042_0056770 3300049578 Bacteria 2793
144 Ga0501042_0311320 3300049578 Bacteria 1137
145 Ga0501042_0467914 3300049578 Bacteria 914
146 Ga0501043_0026911 3300049579 Bacteria 4513
147 Ga0501043_0030687 3300049579 Bacteria 4226
148 Ga0501043_0033821 3300049579 Bacteria 4022
149 Ga0501043_0037976 3300049579 Bacteria 3787
150 Ga0501043_0330433 3300049579 Bacteria 1161
151 Ga0501043_0669522 3300049579 Bacteria 761
152 Ga0501046_0002115 3300049580 Bacteria 18796
153 Ga0501046_0026743 3300049580 Bacteria 4712
154 Ga0501046_0040848 3300049580 Bacteria 3704
155 Ga0501046_0392287 3300049580 Bacteria 1003
156 Ga0501047_0020657 3300049581 Bacteria 6322
157 Ga0501047_0025961 3300049581 Bacteria 5633
158 Ga0501047_0063576 3300049581 Bacteria 3560
159 Ga0501048_0002740 3300049582 Bacteria 13433
160 Ga0501048_0011752 3300049582 Bacteria 6527
161 Ga0501048_0012829 3300049582 Bacteria 6226
162 Ga0501068_0021507 3300049584 Bacteria 3766
163 Ga0501068_0568550 3300049584 Bacteria 738
164 Ga0501069_0085047 3300049585 Bacteria 1785
165 Ga0501070_0005514 3300049586 Bacteria 10794
166 Ga0501070_0095731 3300049586 Bacteria 2456
167 Ga0501070_0100846 3300049586 Bacteria 2388
168 Ga0501070_0365142 3300049586 Bacteria 1171
169 Ga0501071_0000066 3300049587 Bacteria 37099
170 Ga0501071_0003303 3300049587 Bacteria 10077
171 Ga0501071_0096556 3300049587 Bacteria 2175
172 Ga0501072_0001959 3300049588 Bacteria 15333
173 Ga0501072_0065100 3300049588 Bacteria 2874
174 Ga0501072_0080014 3300049588 Bacteria 2588
175 Ga0501072_0101147 3300049588 Bacteria 2291
176 Ga0501073_0028548 3300049589 Bacteria 3987
177 Ga0501073_0061933 3300049589 Bacteria 2610
178 Ga0501073_0074186 3300049589 Bacteria 2369
179 Ga0501073_0082704 3300049589 Bacteria 2234
180 Ga0501073_0235689 3300049589 Bacteria 1264
181 Ga0501074_0009231 3300049590 Bacteria 7166
182 Ga0501074_0058463 3300049590 Bacteria 2778
183 Ga0501074_0138598 3300049590 Bacteria 1740
184 Ga0501074_0271348 3300049590 Bacteria 1206
185 Ga0501075_0003515 3300049591 Bacteria 10482
186 Ga0501075_0033726 3300049591 Bacteria 3809
187 Ga0501075_0039688 3300049591 Bacteria 3523
188 Ga0501075_0541485 3300049591 Bacteria 888
189 Ga0501076_0001266 3300049592 Bacteria 16837
190 Ga0501076_0012305 3300049592 Bacteria 6399
191 Ga0501076_0055629 3300049592 Bacteria 3138
192 Ga0501077_0003063 3300049593 Bacteria 10034
193 Ga0501077_0110123 3300049593 Bacteria 1745
194 Ga0501079_0012658 3300049741 Bacteria 6444
195 Ga0501079_0449741 3300049741 Bacteria 1012
196 Ga0501080_0060858 3300049742 Bacteria 3515
197 Ga0501080_0085824 3300049742 Bacteria 2925
198 Ga0501081_0001056 3300049743 Bacteria 16515
199 Ga0501081_0062484 3300049743 Bacteria 2583
200 Ga0501081_0289406 3300049743 Bacteria 1200
201 Ga0501081_0312621 3300049743 Bacteria 1154
202 Ga0501083_0050355 3300049744 Bacteria 2804
203 Ga0501083_0321718 3300049744 Bacteria 1006
204 Ga0501035_0012191 3300049822 Bacteria 7948
205 Ga0501035_0029140 3300049822 Bacteria 5034
206 Ga0501035_0029998 3300049822 Bacteria 4959
207 Ga0501035_0032831 3300049822 Bacteria 4721
208 Ga0501035_1070153 3300049822 Bacteria 631
209 Ga0501044_0015624 3300049823 Bacteria 8176
210 Ga0501044_0070062 3300049823 Bacteria 3568
211 Ga0501044_0120945 3300049823 Bacteria 2619
212 Ga0501044_0822509 3300049823 Bacteria 807
213 Ga0501045_0015583 3300049824 Bacteria 5393
214 Ga0501045_0056679 3300049824 Bacteria 2866
215 Ga0501045_0095097 3300049824 Bacteria 2204
216 Ga0501045_0196201 3300049824 Bacteria 1504
217 Ga0501045_0978767 3300049824 Bacteria 621
218 nmdc:mga03683_415880_c1 3300050489 Bacteria 643
219 nmdc:mga03n38_33164_c1 3300050490 Bacteria 2194
220 nmdc:mga00v17_15500_c1 3300050491 Bacteria 4278
221 nmdc:mga0yw44_16278_c1 3300050492 Bacteria 4013
222 nmdc:mga0yw44_790335_c1 3300050492 Bacteria 644
223 nmdc:mga06z11_103541_c1 3300050494 Bacteria 1566
224 nmdc:mga04h51_40248_c1 3300050495 Bacteria 1522
225 nmdc:mga07m45_12088_c1 3300050496 Bacteria 4554
226 nmdc:mga0sz30_10784_c2 3300050516 Bacteria 2555
227 Ga0500559_0000102 3300053136 Bacteria 66427
228 Ga0500559_0013224 3300053136 Bacteria 3497
229 Ga0500573_0028513 3300053140 Bacteria 3215
230 Ga0500573_0398081 3300053140 Bacteria 653
231 Ga0501084_0017042 3300054114 Bacteria 6036
232 Ga0501084_0169998 3300054114 Bacteria 1840
233 Ga0587101_001490 3300059623 Bacteria 2029
234 Ga0501082_0156964 3300060353 Bacteria 1977
235 Ga0501082_0352319 3300060353 Bacteria 1283
236 Ga0501082_0414628 3300060353 Bacteria 1176
237 Ga0530510_0004310 3300061734 Bacteria 9843
238 Ga0530510_0165203 3300061734 Bacteria 1638
239 2643733505 2643221542 Bacteria 3563959
240 2643752302 2643221546 Bacteria 2910897
241 2643785999 2643221553 Bacteria 3544260
242 2644170080 2643221630 Bacteria 3601215
243 2644680415 2643221724 Bacteria 3593515
244 2730229869 2728369380 Bacteria 3620317
245 2747953450 2747842429 Bacteria 3914386
246 2753303656 2751185788 Bacteria 4541048
247 2808631168 2808606306 Bacteria 3608896
248 2821270028 2821268502 Bacteria 3750023
249 2833713163 2833709550 Bacteria 4008291
250 2844853242 2844852863 Bacteria 3849151
251 2852647490 2852646457 Bacteria 3408613
252 2852665421 2852663356 Bacteria 4090475
253 2857724043 2857723135 Bacteria 4217853
254 2857735567 2857733635 Bacteria 3532004
255 2919043218 2919042368 Bacteria 3905917
256 2919398787 2919395869 Bacteria 3704152
257 2928105512 2928104781 Bacteria 3877447
258 2945972007 2945968032 Bacteria 4111363
259 2946033614 2946033335 Bacteria 3835514
260 2946044416 2946041624 Bacteria 4191385
261 2946080772 2946080515 Bacteria 4310960
262 2966924562 2966921586 Bacteria 3092803
263 2984551954 2984551494 Bacteria 3877562
264 8004185012 8004182704 Bacteria 3391155
265 8004214344 8004212874 Bacteria 2861420
266 8056038521 8056037122 Bacteria 3854319
267 Ga0501070_0123353
268 JGI25154J39366_1002943
269 Ga0007427J51700_100443
270 Ga0006781J51513_1001570
271 Ga0006780_1005142
272 Ga0070687_100686909
273 Ga0070665_100196402
274 Ga0075368_10061598
275 Ga0075364_10012084
276 Ga0075364_10313613
277 Ga0075369_10023371
278 Ga0105247_10437619
279 Ga0157371_10054635
280 Ga0157370_10511068
281 Ga0157380_10353325
282 Ga0209646_1000071
283 Ga0268266_10205762
284 Ga0307413_10717978
285 Ga0307406_10000833
286 Ga0307406_10017923
287 Ga0307406_10067004
288 Ga0307414_10031186
289 Ga0307414_10140646
290 Ga0307414_10249686
291 Ga0395899_0009007
292 Ga0395898_0003231
293 Ga0395898_0011523
294 Ga0395901_0079931
295 Ga0451791_0299855
296 Ga0451793_0108948
297 Ga0451793_1413562
298 Ga0451797_0303284
299 Ga0451833_0605919
300 Ga0451841_0056327
301 Ga0451841_0391712
302 Ga0451847_0257588
303 Ga0451853_3421444
304 Ga0451853_3701324
305 Ga0466965_0514373
306 Ga0466964_0079139
307 Ga0466968_0046114
308 Ga0466970_0000885
309 Ga0466970_0062141
310 Ga0466960_0235056
311 Ga0466958_0174967
312 Ga0466967_0104364
313 Ga0495627_003056
314 Ga0495650_0060851
315 Ga0495650_0107600
316 Ga0495620_0046874
317 Ga0495643_0205898
318 Ga0495598_0285308
319 Ga0495625_0798457
320 Ga0495649_0124304
321 Ga0495672_0006206
322 Ga0495615_0090425
323 Ga0495626_0132267
324 Ga0496105_0085934
325 Ga0496116_0036708
326 Ga0496117_0000603
327 Ga0496117_0001321
328 Ga0496117_0021815
329 Ga0496117_0026081
330 Ga0496117_0326315
331 Ga0496117_0502461
332 Ga0496118_0000610
333 Ga0496118_0004020
334 Ga0496118_0020829
335 Ga0496118_0125287
336 Ga0496119_0014544
337 Ga0496119_0037113
338 Ga0496119_0115735
339 Ga0496120_0005583
340 Ga0496120_0033227
341 Ga0496122_0000030
342 Ga0496122_0003787
343 Ga0496122_0007477
344 Ga0496122_0053246
345 Ga0496122_0168546
346 Ga0496122_0186181
347 Ga0496122_0251935
348 Ga0496123_0000024
349 Ga0496123_0004981
350 Ga0496123_0043494
351 Ga0496124_0000135
352 Ga0496124_0035177
353 Ga0496124_0036980
354 Ga0496124_0094219
355 Ga0496124_0097522
356 Ga0496124_0193869
357 Ga0496124_0261717
358 Ga0496125_0003878
359 Ga0496125_0013003
360 Ga0496125_0029220
361 Ga0496125_0088626
362 Ga0496125_0276531
363 Ga0496126_0022032
364 Ga0496126_0062259
365 Ga0496126_0124083
366 Ga0496126_0469511
367 Ga0501031_0003972
368 Ga0501031_0010463
369 Ga0501031_0277919
370 Ga0501032_0010022
371 Ga0501032_0027646
372 Ga0501032_0268998
373 Ga0501033_0007078
374 Ga0501033_0012624
375 Ga0501033_0026266
376 Ga0501034_0001058
377 Ga0501034_0012883
378 Ga0501034_0019588
379 Ga0501034_0033302
380 Ga0501034_0037614
381 Ga0501034_0071076
382 Ga0501034_0075401
383 Ga0501036_0013274
384 Ga0501036_0043599
385 Ga0501036_0048269
386 Ga0501036_0052832
387 Ga0501037_0014385
388 Ga0501037_0014602
389 Ga0501037_0018512
390 Ga0501037_0054994
391 Ga0501038_0022798
392 Ga0501038_0031422
393 Ga0501038_0045687
394 Ga0501038_0048942
395 Ga0501038_0050562
396 Ga0501038_0140241
397 Ga0501039_0002561
398 Ga0501039_0015514
399 Ga0501039_0318208
400 Ga0501039_0455150
401 Ga0501039_0740529
402 Ga0501039_1249252
403 Ga0501040_0006625
404 Ga0501040_0068212
405 Ga0501041_0003420
406 Ga0501041_0187768
407 Ga0501041_0241989
408 Ga0501042_0054084
409 Ga0501042_0056770
410 Ga0501042_0311320
411 Ga0501042_0467914
412 Ga0501043_0026911
413 Ga0501043_0030687
414 Ga0501043_0033821
415 Ga0501043_0037976
416 Ga0501043_0330433
417 Ga0501043_0669522
418 Ga0501046_0002115
419 Ga0501046_0026743
420 Ga0501046_0040848
421 Ga0501046_0392287
422 Ga0501047_0020657
423 Ga0501047_0025961
424 Ga0501047_0063576
425 Ga0501048_0002740
426 Ga0501048_0011752
427 Ga0501048_0012829
428 Ga0501068_0021507
429 Ga0501068_0568550
430 Ga0501069_0085047
431 Ga0501070_0005514
432 Ga0501070_0095731
433 Ga0501070_0100846
434 Ga0501070_0365142
435 Ga0501071_0000066
436 Ga0501071_0003303
437 Ga0501071_0096556
438 Ga0501072_0001959
439 Ga0501072_0065100
440 Ga0501072_0080014
441 Ga0501072_0101147
442 Ga0501073_0028548
443 Ga0501073_0061933
444 Ga0501073_0074186
445 Ga0501073_0082704
446 Ga0501073_0235689
447 Ga0501074_0009231
448 Ga0501074_0058463
449 Ga0501074_0138598
450 Ga0501074_0271348
451 Ga0501075_0003515
452 Ga0501075_0033726
453 Ga0501075_0039688
454 Ga0501075_0541485
455 Ga0501076_0001266
456 Ga0501076_0012305
457 Ga0501076_0055629
458 Ga0501077_0003063
459 Ga0501077_0110123
460 Ga0501079_0012658
461 Ga0501079_0449741
462 Ga0501080_0060858
463 Ga0501080_0085824
464 Ga0501081_0001056
465 Ga0501081_0062484
466 Ga0501081_0289406
467 Ga0501081_0312621
468 Ga0501083_0050355
469 Ga0501083_0321718
470 Ga0501035_0012191
471 Ga0501035_0029140
472 Ga0501035_0029998
473 Ga0501035_0032831
474 Ga0501035_1070153
475 Ga0501044_0015624
476 Ga0501044_0070062
477 Ga0501044_0120945
478 Ga0501044_0822509
479 Ga0501045_0015583
480 Ga0501045_0056679
481 Ga0501045_0095097
482 Ga0501045_0196201
483 Ga0501045_0978767
484 nmdc:mga03683_415880_c1
485 nmdc:mga03n38_33164_c1
486 nmdc:mga00v17_15500_c1
487 nmdc:mga0yw44_16278_c1
488 nmdc:mga0yw44_790335_c1
489 nmdc:mga06z11_103541_c1
490 nmdc:mga04h51_40248_c1
491 nmdc:mga07m45_12088_c1
492 nmdc:mga0sz30_10784_c2
493 Ga0500559_0000102
494 Ga0500559_0013224
495 Ga0500573_0028513
496 Ga0500573_0398081
497 Ga0501084_0017042
498 Ga0501084_0169998
499 Ga0587101_001490
500 Ga0501082_0156964
501 Ga0501082_0352319
502 Ga0501082_0414628
503 Ga0530510_0004310
504 Ga0530510_0165203
505 2643733505
506 2643752302
507 2643785999
508 2644170080
509 2644680415
510 2730229869
511 2747953450
512 2753303656
513 2808631168
514 2821270028
515 2833713163
516 2844853242
517 2852647490
518 2852665421
519 2857724043
520 2857735567
521 2919043218
522 2919398787
523 2928105512
524 2945972007
525 2946033614
526 2946044416
527 2946080772
528 2966924562
529 2984551954
530 8004185012
531 8004214344
532 8056038521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

33

138

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9033 5 161
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9 6 164
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.8935 6 163
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.8902 6 162
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.8862 6 157
ID Description Score Start End Superfamily
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.902 6 161 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9007 6 162 3.40.30.10
2p31B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8935 6 163 3.40.30.10
af_H2KYJ6_16_188_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8923 6 161 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8911 1 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4P7FJ29-F1-model_v4 deleted 0.9656 6 161
AF-A0A6P1EVN9-F1-model_v4 Glutathione peroxidase 0.9633 6 164 GO:0004601
GO:0034599
AF-A0A7X0EYC3-F1-model_v4 Glutathione peroxidase 0.9598 6 162 GO:0004602
GO:0034599
AF-A0A846W0Y6-F1-model_v4 Glutathione peroxidase 0.9597 6 162 GO:0004601
GO:0034599
AF-A0A376CM97-F1-model_v4 Glutathione peroxidase 0.958 6 164 GO:0004601
GO:0034599

Map